(data stored in ACNUC10043 zone)

EMBL: AP011532

ID   AP011532; SV 1; circular; genomic DNA; STD; PRO; 2957635 BP.
XX
AC   AP011532;
XX
PR   Project:PRJDA20361;
XX
DT   27-DEC-2009 (Rel. 103, Created)
DT   07-OCT-2016 (Rel. 130, Last updated, Version 2)
XX
DE   Methanocella paludicola SANAE DNA, complete genome.
XX
KW   .
XX
OS   Methanocella paludicola SANAE
OC   Archaea; Euryarchaeota; Stenosarchaea group; Methanomicrobia;
OC   Methanocellales; Methanocellaceae; Methanocella.
XX
RN   [1]
RP   1-2957635
RA   Sakai S., Takaki Y., Shimamura S., Sekine M., Tajima T., Kosugi H.,
RA   Ichikawa N., Tasumi E., Hiraki A., Shimizu A., Kato Y., Nishiko R., Ito M.,
RA   Mori K., Fujita N., Imachi H., Takai K.;
RT   ;
RL   Submitted (23-JUN-2009) to the INSDC.
RL   Contact:Sanae Sakai Japan Agency for Maine-Earth Science and Technology,
RL   Institute of Biogeosciences; 2-15 Natsushima-cho, Yokosuka, Kanagawa
RL   237-0061, Japan URL    :http://www.jamstec.go.jp/j/
XX
RN   [2]
RA   Sakai S., Takaki Y., Shimamura S., Sekine M., Tajima T., Kosugi H.,
RA   Ichikawa N., Tasumi E., Hiraki A., Shimizu A., Kato Y., Nishiko R., Ito M.,
RA   Mori K., Fujita N., Imachi H., Takai K.;
RT   "Complete Genome Sequence of the Mesophilic Hydrogenotrophic Methanogenic
RT   Archaea, Methanocella paludicola";
RL   Unpublished.
XX
RN   [3]
RX   DOI; 10.1128/AEM.03008-06.
RX   PUBMED; 17483259.
RA   Sakai S., Imachi H., Sekiguchi Y., Ohashi A., Harada H., Kamagata Y.;
RT   "Isolation of key methanogens for global methane emission from rice paddy
RT   fields: a novel isolate affiliated with the clone cluster rice cluster I";
RL   Appl. Environ. Microbiol. 73(13):4326-4331(2007).
XX
RN   [4]
RX   DOI; 10.1099/ijs.0.65571-0.
RX   PUBMED; 18398197.
RA   Sakai S., Imachi H., Hanada S., Ohashi A., Harada H., Kamagata Y.;
RT   "Methanocella paludicola gen. nov., sp. nov., a methane-producing archaeon,
RT   the first isolate of the lineage 'Rice Cluster I', and proposal of the new
RT   archaeal order Methanocellales ord. nov";
RL   Int. J. Syst. Evol. Microbiol. 58(Pt 4):929-936(2008).
XX
DR   MD5; e6352f083396b9e96a1e5e74ee0c1126.
DR   BioSample; SAMD00060931.
DR   EnsemblGenomes-Gn; EBG00001099281.
DR   EnsemblGenomes-Gn; EBG00001099282.
DR   EnsemblGenomes-Gn; EBG00001099283.
DR   EnsemblGenomes-Gn; EBG00001099284.
DR   EnsemblGenomes-Gn; EBG00001099285.
DR   EnsemblGenomes-Gn; EBG00001099286.
DR   EnsemblGenomes-Gn; EBG00001099287.
DR   EnsemblGenomes-Gn; EBG00001099288.
DR   EnsemblGenomes-Gn; EBG00001099289.
DR   EnsemblGenomes-Gn; EBG00001099290.
DR   EnsemblGenomes-Gn; EBG00001099291.
DR   EnsemblGenomes-Gn; EBG00001099292.
DR   EnsemblGenomes-Gn; EBG00001099293.
DR   EnsemblGenomes-Gn; EBG00001099294.
DR   EnsemblGenomes-Gn; EBG00001099295.
DR   EnsemblGenomes-Gn; EBG00001099296.
DR   EnsemblGenomes-Gn; EBG00001099297.
DR   EnsemblGenomes-Gn; EBG00001099298.
DR   EnsemblGenomes-Gn; EBG00001099300.
DR   EnsemblGenomes-Gn; EBG00001099301.
DR   EnsemblGenomes-Gn; EBG00001099302.
DR   EnsemblGenomes-Gn; EBG00001099303.
DR   EnsemblGenomes-Gn; EBG00001099304.
DR   EnsemblGenomes-Gn; EBG00001099305.
DR   EnsemblGenomes-Gn; EBG00001099306.
DR   EnsemblGenomes-Gn; EBG00001099307.
DR   EnsemblGenomes-Gn; EBG00001099308.
DR   EnsemblGenomes-Gn; EBG00001099309.
DR   EnsemblGenomes-Gn; EBG00001099310.
DR   EnsemblGenomes-Gn; EBG00001099311.
DR   EnsemblGenomes-Gn; EBG00001099312.
DR   EnsemblGenomes-Gn; EBG00001099313.
DR   EnsemblGenomes-Gn; EBG00001099314.
DR   EnsemblGenomes-Gn; EBG00001099315.
DR   EnsemblGenomes-Gn; EBG00001099316.
DR   EnsemblGenomes-Gn; EBG00001099317.
DR   EnsemblGenomes-Gn; EBG00001099320.
DR   EnsemblGenomes-Gn; EBG00001099321.
DR   EnsemblGenomes-Gn; EBG00001099322.
DR   EnsemblGenomes-Gn; EBG00001099323.
DR   EnsemblGenomes-Gn; EBG00001099324.
DR   EnsemblGenomes-Gn; EBG00001099325.
DR   EnsemblGenomes-Gn; EBG00001099326.
DR   EnsemblGenomes-Gn; EBG00001099327.
DR   EnsemblGenomes-Gn; EBG00001099328.
DR   EnsemblGenomes-Gn; EBG00001099329.
DR   EnsemblGenomes-Gn; EBG00001099330.
DR   EnsemblGenomes-Gn; EBG00001099331.
DR   EnsemblGenomes-Gn; EBG00001099332.
DR   EnsemblGenomes-Gn; EBG00001099333.
DR   EnsemblGenomes-Gn; EBG00001099334.
DR   EnsemblGenomes-Gn; EBG00001099335.
DR   EnsemblGenomes-Gn; EBG00001099336.
DR   EnsemblGenomes-Gn; EBG00001099337.
DR   EnsemblGenomes-Gn; EBG00001099338.
DR   EnsemblGenomes-Gn; EBG00001099339.
DR   EnsemblGenomes-Gn; EBG00001099340.
DR   EnsemblGenomes-Gn; EBG00001099341.
DR   EnsemblGenomes-Gn; EBG00001099342.
DR   EnsemblGenomes-Gn; EBG00001099343.
DR   EnsemblGenomes-Gn; EBG00001099344.
DR   EnsemblGenomes-Gn; EBG00001099345.
DR   EnsemblGenomes-Gn; EBG00001099346.
DR   EnsemblGenomes-Gn; EBG00001099347.
DR   EnsemblGenomes-Gn; EBG00001099348.
DR   EnsemblGenomes-Gn; MCP_m0001.
DR   EnsemblGenomes-Gn; MCP_m0002.
DR   EnsemblGenomes-Gn; MCP_r0001.
DR   EnsemblGenomes-Gn; MCP_r0002.
DR   EnsemblGenomes-Gn; MCP_r0003.
DR   EnsemblGenomes-Gn; MCP_r0004.
DR   EnsemblGenomes-Gn; MCP_r0005.
DR   EnsemblGenomes-Gn; MCP_r0006.
DR   EnsemblGenomes-Gn; MCP_r0007.
DR   EnsemblGenomes-Gn; MCP_r0008.
DR   EnsemblGenomes-Gn; MCP_t0001.
DR   EnsemblGenomes-Gn; MCP_t0002.
DR   EnsemblGenomes-Gn; MCP_t0003.
DR   EnsemblGenomes-Gn; MCP_t0004.
DR   EnsemblGenomes-Gn; MCP_t0005.
DR   EnsemblGenomes-Gn; MCP_t0006.
DR   EnsemblGenomes-Gn; MCP_t0007.
DR   EnsemblGenomes-Gn; MCP_t0008.
DR   EnsemblGenomes-Gn; MCP_t0009.
DR   EnsemblGenomes-Gn; MCP_t0010.
DR   EnsemblGenomes-Gn; MCP_t0011.
DR   EnsemblGenomes-Gn; MCP_t0012.
DR   EnsemblGenomes-Gn; MCP_t0013.
DR   EnsemblGenomes-Gn; MCP_t0014.
DR   EnsemblGenomes-Gn; MCP_t0015.
DR   EnsemblGenomes-Gn; MCP_t0016.
DR   EnsemblGenomes-Gn; MCP_t0017.
DR   EnsemblGenomes-Gn; MCP_t0018.
DR   EnsemblGenomes-Gn; MCP_t0019.
DR   EnsemblGenomes-Gn; MCP_t0020.
DR   EnsemblGenomes-Gn; MCP_t0021.
DR   EnsemblGenomes-Gn; MCP_t0022.
DR   EnsemblGenomes-Gn; MCP_t0023.
DR   EnsemblGenomes-Gn; MCP_t0024.
DR   EnsemblGenomes-Gn; MCP_t0025.
DR   EnsemblGenomes-Gn; MCP_t0026.
DR   EnsemblGenomes-Gn; MCP_t0027.
DR   EnsemblGenomes-Gn; MCP_t0028.
DR   EnsemblGenomes-Gn; MCP_t0029.
DR   EnsemblGenomes-Gn; MCP_t0030.
DR   EnsemblGenomes-Gn; MCP_t0031.
DR   EnsemblGenomes-Gn; MCP_t0032.
DR   EnsemblGenomes-Gn; MCP_t0033.
DR   EnsemblGenomes-Gn; MCP_t0034.
DR   EnsemblGenomes-Gn; MCP_t0035.
DR   EnsemblGenomes-Gn; MCP_t0036.
DR   EnsemblGenomes-Gn; MCP_t0037.
DR   EnsemblGenomes-Gn; MCP_t0038.
DR   EnsemblGenomes-Gn; MCP_t0039.
DR   EnsemblGenomes-Gn; MCP_t0040.
DR   EnsemblGenomes-Gn; MCP_t0041.
DR   EnsemblGenomes-Gn; MCP_t0042.
DR   EnsemblGenomes-Gn; MCP_t0043.
DR   EnsemblGenomes-Gn; MCP_t0044.
DR   EnsemblGenomes-Gn; MCP_t0045.
DR   EnsemblGenomes-Gn; MCP_t0046.
DR   EnsemblGenomes-Gn; MCP_t0047.
DR   EnsemblGenomes-Gn; MCP_t0048.
DR   EnsemblGenomes-Tr; EBT00001553711.
DR   EnsemblGenomes-Tr; EBT00001553712.
DR   EnsemblGenomes-Tr; EBT00001553714.
DR   EnsemblGenomes-Tr; EBT00001553716.
DR   EnsemblGenomes-Tr; EBT00001553718.
DR   EnsemblGenomes-Tr; EBT00001553720.
DR   EnsemblGenomes-Tr; EBT00001553722.
DR   EnsemblGenomes-Tr; EBT00001553725.
DR   EnsemblGenomes-Tr; EBT00001553727.
DR   EnsemblGenomes-Tr; EBT00001553728.
DR   EnsemblGenomes-Tr; EBT00001553732.
DR   EnsemblGenomes-Tr; EBT00001553735.
DR   EnsemblGenomes-Tr; EBT00001553738.
DR   EnsemblGenomes-Tr; EBT00001553740.
DR   EnsemblGenomes-Tr; EBT00001553742.
DR   EnsemblGenomes-Tr; EBT00001553743.
DR   EnsemblGenomes-Tr; EBT00001553744.
DR   EnsemblGenomes-Tr; EBT00001553745.
DR   EnsemblGenomes-Tr; EBT00001553746.
DR   EnsemblGenomes-Tr; EBT00001553747.
DR   EnsemblGenomes-Tr; EBT00001553748.
DR   EnsemblGenomes-Tr; EBT00001553749.
DR   EnsemblGenomes-Tr; EBT00001553750.
DR   EnsemblGenomes-Tr; EBT00001553751.
DR   EnsemblGenomes-Tr; EBT00001553753.
DR   EnsemblGenomes-Tr; EBT00001553754.
DR   EnsemblGenomes-Tr; EBT00001553755.
DR   EnsemblGenomes-Tr; EBT00001553756.
DR   EnsemblGenomes-Tr; EBT00001553757.
DR   EnsemblGenomes-Tr; EBT00001553758.
DR   EnsemblGenomes-Tr; EBT00001553759.
DR   EnsemblGenomes-Tr; EBT00001553760.
DR   EnsemblGenomes-Tr; EBT00001553761.
DR   EnsemblGenomes-Tr; EBT00001553762.
DR   EnsemblGenomes-Tr; EBT00001553763.
DR   EnsemblGenomes-Tr; EBT00001553764.
DR   EnsemblGenomes-Tr; EBT00001553765.
DR   EnsemblGenomes-Tr; EBT00001553766.
DR   EnsemblGenomes-Tr; EBT00001553767.
DR   EnsemblGenomes-Tr; EBT00001553768.
DR   EnsemblGenomes-Tr; EBT00001553769.
DR   EnsemblGenomes-Tr; EBT00001553770.
DR   EnsemblGenomes-Tr; EBT00001553771.
DR   EnsemblGenomes-Tr; EBT00001553772.
DR   EnsemblGenomes-Tr; EBT00001553773.
DR   EnsemblGenomes-Tr; EBT00001553774.
DR   EnsemblGenomes-Tr; EBT00001553775.
DR   EnsemblGenomes-Tr; EBT00001553776.
DR   EnsemblGenomes-Tr; EBT00001553777.
DR   EnsemblGenomes-Tr; EBT00001553778.
DR   EnsemblGenomes-Tr; EBT00001553780.
DR   EnsemblGenomes-Tr; EBT00001553781.
DR   EnsemblGenomes-Tr; EBT00001553782.
DR   EnsemblGenomes-Tr; EBT00001553783.
DR   EnsemblGenomes-Tr; EBT00001553784.
DR   EnsemblGenomes-Tr; EBT00001553785.
DR   EnsemblGenomes-Tr; EBT00001553786.
DR   EnsemblGenomes-Tr; EBT00001553787.
DR   EnsemblGenomes-Tr; EBT00001553788.
DR   EnsemblGenomes-Tr; EBT00001553789.
DR   EnsemblGenomes-Tr; EBT00001553790.
DR   EnsemblGenomes-Tr; EBT00001553791.
DR   EnsemblGenomes-Tr; EBT00001553792.
DR   EnsemblGenomes-Tr; EBT00001553793.
DR   EnsemblGenomes-Tr; EBT00001553794.
DR   EnsemblGenomes-Tr; MCP_m0001-1.
DR   EnsemblGenomes-Tr; MCP_m0002-1.
DR   EnsemblGenomes-Tr; MCP_r0001-1.
DR   EnsemblGenomes-Tr; MCP_r0002-1.
DR   EnsemblGenomes-Tr; MCP_r0003-1.
DR   EnsemblGenomes-Tr; MCP_r0004-1.
DR   EnsemblGenomes-Tr; MCP_r0005-1.
DR   EnsemblGenomes-Tr; MCP_r0006-1.
DR   EnsemblGenomes-Tr; MCP_r0007-1.
DR   EnsemblGenomes-Tr; MCP_r0008-1.
DR   EnsemblGenomes-Tr; MCP_t0001-1.
DR   EnsemblGenomes-Tr; MCP_t0002-1.
DR   EnsemblGenomes-Tr; MCP_t0003-1.
DR   EnsemblGenomes-Tr; MCP_t0004-1.
DR   EnsemblGenomes-Tr; MCP_t0005-1.
DR   EnsemblGenomes-Tr; MCP_t0006-1.
DR   EnsemblGenomes-Tr; MCP_t0007-1.
DR   EnsemblGenomes-Tr; MCP_t0008-1.
DR   EnsemblGenomes-Tr; MCP_t0009-1.
DR   EnsemblGenomes-Tr; MCP_t0010-1.
DR   EnsemblGenomes-Tr; MCP_t0011-1.
DR   EnsemblGenomes-Tr; MCP_t0012-1.
DR   EnsemblGenomes-Tr; MCP_t0013-1.
DR   EnsemblGenomes-Tr; MCP_t0014-1.
DR   EnsemblGenomes-Tr; MCP_t0015-1.
DR   EnsemblGenomes-Tr; MCP_t0016-1.
DR   EnsemblGenomes-Tr; MCP_t0017-1.
DR   EnsemblGenomes-Tr; MCP_t0018-1.
DR   EnsemblGenomes-Tr; MCP_t0019-1.
DR   EnsemblGenomes-Tr; MCP_t0020-1.
DR   EnsemblGenomes-Tr; MCP_t0021-1.
DR   EnsemblGenomes-Tr; MCP_t0022-1.
DR   EnsemblGenomes-Tr; MCP_t0023-1.
DR   EnsemblGenomes-Tr; MCP_t0024-1.
DR   EnsemblGenomes-Tr; MCP_t0025-1.
DR   EnsemblGenomes-Tr; MCP_t0026-1.
DR   EnsemblGenomes-Tr; MCP_t0027-1.
DR   EnsemblGenomes-Tr; MCP_t0028-1.
DR   EnsemblGenomes-Tr; MCP_t0029-1.
DR   EnsemblGenomes-Tr; MCP_t0030-1.
DR   EnsemblGenomes-Tr; MCP_t0031-1.
DR   EnsemblGenomes-Tr; MCP_t0032-1.
DR   EnsemblGenomes-Tr; MCP_t0033-1.
DR   EnsemblGenomes-Tr; MCP_t0034-1.
DR   EnsemblGenomes-Tr; MCP_t0035-1.
DR   EnsemblGenomes-Tr; MCP_t0036-1.
DR   EnsemblGenomes-Tr; MCP_t0037-1.
DR   EnsemblGenomes-Tr; MCP_t0038-1.
DR   EnsemblGenomes-Tr; MCP_t0039-1.
DR   EnsemblGenomes-Tr; MCP_t0040-1.
DR   EnsemblGenomes-Tr; MCP_t0041-1.
DR   EnsemblGenomes-Tr; MCP_t0042-1.
DR   EnsemblGenomes-Tr; MCP_t0043-1.
DR   EnsemblGenomes-Tr; MCP_t0044-1.
DR   EnsemblGenomes-Tr; MCP_t0045-1.
DR   EnsemblGenomes-Tr; MCP_t0046-1.
DR   EnsemblGenomes-Tr; MCP_t0047-1.
DR   EnsemblGenomes-Tr; MCP_t0048-1.
DR   EuropePMC; PMC3035365; 21304750.
DR   EuropePMC; PMC3146512; 21829548.
DR   EuropePMC; PMC3236047.
DR   EuropePMC; PMC3328440; 22530002.
DR   EuropePMC; PMC3430981; 22969752.
DR   EuropePMC; PMC5817203; 28869407.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00373; RNaseP_arch.
DR   RFAM; RF01133; sR3.
DR   RFAM; RF01857; Archaea_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; AP011532.
DR   SILVA-SSU; AP011532.
DR   StrainInfo; 802398; 1.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2957635
FT                   /organism="Methanocella paludicola SANAE"
FT                   /strain="SANAE"
FT                   /mol_type="genomic DNA"
FT                   /note="type strain of Methanocella paludicola"
FT                   /db_xref="taxon:304371"
FT   CDS_pept        599..1900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cdc6-1"
FT                   /locus_tag="MCP_0001"
FT                   /product="cell division control protein 6 homolog"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0001"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60073"
FT                   /db_xref="GOA:D1YUF1"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR014277"
FT                   /db_xref="InterPro:IPR015163"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUF1"
FT                   /protein_id="BAI60073.1"
FT                   /translation="MDNNRGLFDDLVKENPEESSIDRLFENLLSMKPIFSNREVLRPSY
FT                   TPDYLPHRLDQINAVAEILVAALRGESPSNILIYGKTGTGKTATLESVSKKLMDLSDKM
FT                   HIECKVLFINCERIDTQYRILAHLARHYNRDVPITGWPTDQVFNEFREALDKKEQIAII
FT                   ILDEIDNLVKKSGDDILYNLSRINADLKKAKVSIIGISNDLTFTDYLDPRVKSSLGEEE
FT                   IIFPPYNADQLRDILEQRSKMAFKDNTLEPAVIPLCAAFAAQEHGDARKALDLLRVSAE
FT                   LAERQRDTVVREEHVRKAREKIEIDRITEVVRTLPTQSKLVLFSIVQLDSTGSHELNTG
FT                   DVYNVYRRLCRMIDMDVLTQRRVTDLISELDMLGIINAIVVSKGRYGRTKEIALSVPAE
FT                   STRKVLLDDYRLRTLKDARPHFETQQRFNESQPG"
FT   CDS_pept        complement(1936..2277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0002"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Putative general stress protein B in
FT                   uncultured methanogenic archaeon (Q0W564)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0002"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60074"
FT                   /db_xref="InterPro:IPR019626"
FT                   /db_xref="InterPro:IPR038956"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUF2"
FT                   /protein_id="BAI60074.1"
FT                   /translation="MAEKEEKGDMTVEEAGRKGGEKTAKTHGKEFYQEIGHKGGEKTSE
FT                   THGKEFYQEIGHKGGEVGGHKGGEATARTHGKEFYQEIGHKGGEIGGKKGGQRVKELIE
FT                   EGKEAEEKK"
FT   CDS_pept        complement(2354..2851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0003"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0003"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60075"
FT                   /db_xref="GOA:D1YUF3"
FT                   /db_xref="InterPro:IPR001733"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUF3"
FT                   /protein_id="BAI60075.1"
FT                   /translation="MKGLLRDTALTLALVLALAGALYLYAGVWPPLVSVDGTSMYPNLM
FT                   PGDLIVLRGLDRVGVVPGCEAVNVSYSAFNGYGDVIVYIPMGDRNRTPVIHRAACWVSE
FT                   GQPMWPGGPSAPHSGFLTLGDNNFFYDQSTSISPDQPVRPEWVLGVSQFRIPYLGLLRS
FT                   FL"
FT   CDS_pept        2976..3488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0004"
FT                   /product="putative peroxiredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0004"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60076"
FT                   /db_xref="GOA:D1YUF4"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUF4"
FT                   /protein_id="BAI60076.1"
FT                   /translation="MYKLVLRLDVGSRAEDFTLKDFNGNAVSLGSLIGRGIVFLTFYRG
FT                   GFDKESVRYLRALADNHERLKDLGVEVVAVTPELPEKARGTAESLSLPFTVLCDPELTA
FT                   TKQYDVYDPSMEWCWPAGFVIGEDGAVQYVYRGVSPPNTPPVPYLMKKFEQMRSPPEEA
FT                   AGRAAAR"
FT   CDS_pept        complement(3489..3986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0005"
FT                   /product="hypothetical protein"
FT                   /note="Contains one Cupin 2, conserved barrel domain
FT                   (IPR013096)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0005"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60077"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUF5"
FT                   /protein_id="BAI60077.1"
FT                   /translation="MEVYRIDIPEGGGPVSLRACPIKTDKVAFNVYSFRPWQALSAHRH
FT                   PGSDEVFFVVDGRCLFYVGRDTEALGPNNAVYVPSGALHAILSCERGATLVSVQGPQPV
FT                   TSIYGNLKYFCPACGLEAPLLEGTRTGDLNTCPRCKTAVRLKEAGEAFDAFEIAPPGGA
FT                   RA"
FT   CDS_pept        complement(4039..5295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0006"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains at least six Pyrrolo-quinoline quinone
FT                   repeats (IPR002372)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0006"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60078"
FT                   /db_xref="InterPro:IPR002372"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR018391"
FT                   /db_xref="InterPro:IPR025666"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUF6"
FT                   /protein_id="BAI60078.1"
FT                   /translation="MSHISRLFIVSIIVALFAAPALAADQPAVDWSKQLGQEGGAYISA
FT                   SPLYNNGILYVCSWDGTVYGLQTMNGAPLWKFRVGVNVYSTPVYKDSTLYVGSSNGTFY
FT                   AIETLYGKEKWRFRALSNVDSTPLLMNGIVFVGSDDNRVYALDPGTGSEIWNVSVGSGI
FT                   STALEDYDNIVYAGTSDGSLVAIEPNFGKIKWSTKVGERAYSPLANDGTIYVGTYDGYL
FT                   VSVDQYQGSINWKGQAGGAISSKPVYYGGNIYIGSWDGKLYCFNASNGRVAWTYTTYGP
FT                   IKAAPLIDKGKGIIYVGSGDEYLYAIDARSGGLYWKFQADSPVSSTPITVNDRLYFSSY
FT                   GTSASGGTVYALTLPDTLTLITPTPAPTVAPTPTVAPTSTPVVVTYVPSATPDPSWCPL
FT                   PGLLAVMLGAFALVTYRRR"
FT   CDS_pept        complement(5409..7250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0007"
FT                   /product="glucan 1,4-alpha-glucosidase"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0007"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60079"
FT                   /db_xref="GOA:D1YUF7"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUF7"
FT                   /protein_id="BAI60079.1"
FT                   /translation="MRPLIYGNGTLLVCVDERGVVRDFYYPYAGMENHGGNIRLGLYDI
FT                   DLKKFGWLDTWGLRQRYEGSSLTGESLYESPGFGASVTVKETVHHELNFFLRSFEVRNA
FT                   SNVAKHFRLFSAQNYHILENNYANTAVRDGDMMSHYKRDRFILQSSRPAFDQFTAGISE
FT                   WRGMEGTWKDAEDGALSGNVVAHGSADSALGWTLPELRPGEAATVHFWACIGRNFPEAK
FT                   RIHDWIRARDVGEVYHSGRKFWDAFGAKARGLDGLPPSVREAYYRSLLTVACHLDRGGS
FT                   IIASCDSQIKQQGADYYTYCWPRDAAWAAVALDRAGYGHLSMHTYRFFKKIIDPKGYFR
FT                   HKYTPAGDLGSTWHPLPMVQIDETAAPVYAVHVHWQETRDVKELSSLYEPLVKPAADSL
FT                   MSFLSGGLPRASFDLWEERKGIYTYSCASVYSGLRSAAAIGRILGDEGSALAWDGAAAG
FT                   LKSASLERLYDPALGRFRRGVFDDTVDASAFAAWYLGLVGPDSPMAAGTMAAIERELTR
FT                   PNGGVARYAGDGYQGPMNAWPLCTLWLAQWHIRINNLPRALELIEWCARNSAPTGLMPE
FT                   QVGKNGEPVSVLPLAWSHSTFMLAVIEYLEALSGAAR"
FT   CDS_pept        complement(7299..8342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0008"
FT                   /product="putative signal recognition particle receptor"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0008"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60080"
FT                   /db_xref="GOA:D1YUF8"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004390"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUF8"
FT                   /protein_id="BAI60080.1"
FT                   /translation="MFDRLREKLGDFRKSIDEKLKASPQEPVQEKAEAKVEEKIEAPKA
FT                   EAPAEAPRSGILDRAKAITRGEVILSEKDLEGPLWELEMALLESDVALPVAESIIDRIR
FT                   KDLSGQHKKFLRSTGDIAEDALRDAILTILSAHTLDFDDYVKGHDKPVIVVFTGVNGTG
FT                   KTTTIAKLAERLKESNVGVVIAAGDTFRAGAIEQLQKHADRLGVKMIKHDQGSDPAAVI
FT                   YDAVAYAKSNKKDVVLADTAGRLHTNVNLMEQLKKISRIIRPDLVIFVDEAIAGNDAVE
FT                   RAKLFNDAVPISGSILTKADADSKGGAAISIAHITGKPILFLGVGQEYKDLRKFDPDWF
FT                   VERLLER"
FT   CDS_pept        complement(8349..8771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pfdA"
FT                   /locus_tag="MCP_0009"
FT                   /product="prefoldin alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0009"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60081"
FT                   /db_xref="GOA:D1YUF9"
FT                   /db_xref="InterPro:IPR004127"
FT                   /db_xref="InterPro:IPR009053"
FT                   /db_xref="InterPro:IPR011599"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUF9"
FT                   /protein_id="BAI60081.1"
FT                   /translation="MADVNPEANEEQIRELISRIQVSQQRMDALQQQASLVQMSLNDLD
FT                   NALKALATLEGKGEDQELLVSIGAGSYVHAKLATPDRAIIGLGAGVSVEKSFADSKGII
FT                   QSRRTELEKALLDTTGAMDQVATELNRLQQEAQKYQ"
FT   CDS_pept        complement(8775..8951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplX"
FT                   /locus_tag="MCP_0010"
FT                   /product="50S ribosomal protein LX"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0010"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60082"
FT                   /db_xref="GOA:D1YUG0"
FT                   /db_xref="InterPro:IPR023573"
FT                   /db_xref="InterPro:IPR028877"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUG0"
FT                   /protein_id="BAI60082.1"
FT                   /translation="MANYIVEGRFKAGVQWENFSKEVESVNENTAREKVLSTFGSKHGI
FT                   NRNQIKIESVKEA"
FT   CDS_pept        complement(8958..9620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aif6"
FT                   /locus_tag="MCP_0011"
FT                   /product="translation initiation factor 6"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0011"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60083"
FT                   /db_xref="GOA:D1YUG1"
FT                   /db_xref="InterPro:IPR002769"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUG1"
FT                   /protein_id="BAI60083.1"
FT                   /translation="MIRQLDFYGYPYVGIYGANTENYVVLPPDLPAHTADEAAETLGVA
FT                   AIRTLINDSTLIGSMMTGNSNGFIVSDLALEREVAALEKALPTARLKGKMTAAGNIILA
FT                   NDTAALVHPALSDRHLEVIRDTLKVDVRRGTIGGLKTVGMAGVATNKGLLVHPRATEEE
FT                   LSALEELFRLPVDIGTVSFGSPLVGSAILATTKGLVTGTKTSGPEVGRIEDALQLGE"
FT   CDS_pept        complement(9633..9890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpl31e"
FT                   /locus_tag="MCP_0012"
FT                   /product="50S ribosomal protein L31e"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0012"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60084"
FT                   /db_xref="GOA:D1YUG2"
FT                   /db_xref="InterPro:IPR000054"
FT                   /db_xref="InterPro:IPR023621"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUG2"
FT                   /protein_id="BAI60084.1"
FT                   /translation="MADEQIYTIPLDTEGYPHWKKGNLAVKKVREYLSRHMKVDEDKIK
FT                   INAPLNETIWEHGIRKPPRKIRVKATRVEDGGVEADIVGE"
FT   CDS_pept        complement(9900..10052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpl39e"
FT                   /locus_tag="MCP_0013"
FT                   /product="50S ribosomal protein L39e"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0013"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60085"
FT                   /db_xref="GOA:D1YUG3"
FT                   /db_xref="InterPro:IPR000077"
FT                   /db_xref="InterPro:IPR023626"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUG3"
FT                   /protein_id="BAI60085.1"
FT                   /translation="MTKKSKGKKIRLAKYANQNRRVPAWVIMKTNRAVMTHPKRRSWRR
FT                   TSLPE"
FT   CDS_pept        complement(10049..10636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0014"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0014"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60086"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUG4"
FT                   /protein_id="BAI60086.1"
FT                   /translation="MKVRVLYSGGQDSSLSAVLLEPFFDVELVTCSFGSASWRHAGRAA
FT                   EAIGFPFRVLKLSPEVMEGCIDLMLKYGYPRYGINYVHLKALEAAAKGGGYVADGTRRD
FT                   DHSPALTMAEVKSLEMRLDVQYIRPLAGYGRHAIDALVKQHFEIVEGPAIEKSDYESEI
FT                   RSSIIEKYGKETVSRLFPQEHPQSRVMRRLQK"
FT   CDS_pept        complement(10638..10973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0015"
FT                   /product="DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0015"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60087"
FT                   /db_xref="GOA:D1YUG5"
FT                   /db_xref="InterPro:IPR002836"
FT                   /db_xref="InterPro:IPR022889"
FT                   /db_xref="InterPro:IPR036883"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUG5"
FT                   /protein_id="BAI60087.1"
FT                   /translation="MLMSGDELDEIRRRKMEELQRAQSDAYAQEQQRQQYEQQKASAMR
FT                   QILTPEARERLNTIRMTRPEFVASVEAQLIALAQSGRLKSQIDDAQLVKILEQVTPKKR
FT                   DIKIRRI"
FT   CDS_pept        complement(11016..11471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rps19e"
FT                   /locus_tag="MCP_0016"
FT                   /product="30S ribosomal protein S19e"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0016"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60088"
FT                   /db_xref="GOA:D1YUG6"
FT                   /db_xref="InterPro:IPR001266"
FT                   /db_xref="InterPro:IPR018277"
FT                   /db_xref="InterPro:IPR027548"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR038111"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUG6"
FT                   /protein_id="BAI60088.1"
FT                   /translation="MAVVYDVPATAFVVKAGQKLKESGKVQAPEWAADVKTGTHRQYPP
FT                   IQQDWWYTRCASILRRIYIDGPVGVQRLRSLYGGKKNRGVKPDRHERGSGSIIRDALQQ
FT                   LEKAGFVKAVKGGRVVTPQGMAFLDRVATEMSAAAPAEKQATPEAQT"
FT   CDS_pept        complement(11700..12611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0017"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains one ATP-grasp fold domain (IPR011761).;
FT                   Similar to ribosomal protein S6 modification protein in
FT                   Archaeoglobus fulgidus (O27981)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0017"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60089"
FT                   /db_xref="GOA:D1YUG7"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013651"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUG7"
FT                   /protein_id="BAI60089.1"
FT                   /translation="MKIGCFVEKYSFHTREEATALDRFKRAAEAKGHLFEYIFKRDMDR
FT                   IPEYDAVFIRATTDPMNTAYVVSRMADALGKVVIDDPHSIRVCSSKVVLDDLFRQNGIP
FT                   SPKSLLFAGDFGEENLRHVFEYLGFPLVLKAPYTKFSSHVEKAHDGAEFRLIAARYLKN
FT                   ATPIVLQEYMPSGFDWRVGMLDNKILYLCKYYMPRGGWKVRSLVDGKNQWGRVVPILRK
FT                   NAPKKLEELAVNVSKCVGDGLYGLDVKEIDGRFFCIEINDNPSFYADLEDGKDPDLYEK
FT                   IIDRLTSGRPVKPGTYRLNEES"
FT   CDS_pept        complement(12627..13274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0018"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0018"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60090"
FT                   /db_xref="InterPro:IPR025839"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUG8"
FT                   /protein_id="BAI60090.1"
FT                   /translation="MTIVVSEDDEDADYSPFAFLETTVKNDILNVSHDYRYQKMGYYVS
FT                   MHAELCGCNVTPRCSDILDTHRNPLLMIRASRAGIPCLPYRLVAGDERNMGCPALCFAV
FT                   NPYTCNSVTQVKTESQLYRTLKSLSVNNRYPVSVQPLVGEVKEAVQVFGETDVPEARSI
FT                   AKKFYETFRIPIGKLIVQMVDGEAKLCHFEPTTKKEVDWALVRDKVHAVKCH"
FT   CDS_pept        complement(13386..13652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0019"
FT                   /product="conserved hypothetical protein"
FT                   /note="Belongs to the Protein of unknown function UPF0147
FT                   family (IPR005354)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0019"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60091"
FT                   /db_xref="InterPro:IPR005354"
FT                   /db_xref="InterPro:IPR023130"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUG9"
FT                   /protein_id="BAI60091.1"
FT                   /translation="MSNVEAVIKQCVDVLSRIKDDDTVPRNIRRSADSVKNILLNTKES
FT                   PAVRAASSISILDEISNDPNIPLHTRTLIWNIASQLETISVDG"
FT   CDS_pept        complement(13933..14781)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0020"
FT                   /product="conserved hypothetical protein"
FT                   /note="Belongs to the Protein of unknown function DUF1119,
FT                   archaea family (IPR010545)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0020"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60092"
FT                   /db_xref="GOA:D1YUH0"
FT                   /db_xref="InterPro:IPR006639"
FT                   /db_xref="InterPro:IPR010545"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUH0"
FT                   /protein_id="BAI60092.1"
FT                   /translation="MISLLLVPPLQSYELDNVFGNPESVWNSVYYVVLLLLFTGALLLI
FT                   IKFKMNWIIQVIMGIAILSTLTYVFFGLAVLLAPSLDPLIVSGAAVVLSIVLTALLVLY
FT                   PEWYVIDTVGVMVAAGASALFGASLAILPTIVLLVLLAIYDYISVYKTKHMIRLAEGVM
FT                   DTKMPIMFVMPRRWGYSYVHAKGITSEGGEKEAYFMGLGDAVMPTILAVSANAFLSAPR
FT                   LLGFVSLPALGTMLGTLASYVVLMYIVVELKKPQAGLPFLCTGAIVGFMLGCLAAGINP
FT                   F"
FT   CDS_pept        complement(14901..15209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0021"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0021"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60093"
FT                   /db_xref="InterPro:IPR012025"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUH1"
FT                   /protein_id="BAI60093.1"
FT                   /translation="MDETWMIFILPETGLQACRMAALAGSAGLRTKQTCFGVLAEGEAG
FT                   AVRGFVGALRRDHDGIYVKRRGFSIEDTEICACTFRFEEGLPPWLARHMGQVKRYTS"
FT   CDS_pept        complement(15211..15567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0022"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0022"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60094"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUH2"
FT                   /protein_id="BAI60094.1"
FT                   /translation="MGWEFDKEELCFNCRSQAIQRIKVLSRELLTQCTNCGAEAHYALH
FT                   GAYQEKKMPELIGSDVGEALGAWCFCHEALCPNCSSETTNEVLIDTVMAMIACEKCLLT
FT                   RLYRFDAFDKSWRR"
FT   CDS_pept        15691..16329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0023"
FT                   /product="putative phosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0023"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60095"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUH3"
FT                   /protein_id="BAI60095.1"
FT                   /translation="MKILAISDIHGKFFRLEGIMRKSDPVDLVVVAGDLTQGGPPENAV
FT                   RSISELKHFCKNVLCVAGNWDTPEVKAAIGQYAVDLEETPRIYKNTEFMGLGGSNPTGN
FT                   NTPSEYTEEELEYKLDVLLSHNLPQRTVLVTHTPPQNTLDMTPHGAAGSPALRRALEKV
FT                   DVVICGHIHGARGKIKDGAWVINPGYAAEGQAAVIDLDTMDIIWIDSVV"
FT   CDS_pept        16389..17102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0024"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0024"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60096"
FT                   /db_xref="GOA:D1YUH4"
FT                   /db_xref="InterPro:IPR010624"
FT                   /db_xref="InterPro:IPR014774"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUH4"
FT                   /protein_id="BAI60096.1"
FT                   /translation="MAQHIDYVSTGVPGADTILNGGIYPGSAVLVSGPPGSGKSIFGMQ
FT                   FVYAGARDHGEGGLIVAIEETDRSLSEYAGSIGLEAWDSLVEKGAITMMTDDYFARTDL
FT                   PGSLEGIMEVLGRTEARRMVIDPMNLFKYYFPQDVDRRRYLLKFIRILKRRGITSLIIS
FT                   EAMGVFPNMPLTEEMYMTDGNISLFLSRSGNNVERCFWVTKMRRQAFSMKIVPMGIGRG
FT                   GIEVFPDAVPYSLGE"
FT   CDS_pept        17105..18079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0025"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0025"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60097"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUH5"
FT                   /protein_id="BAI60097.1"
FT                   /translation="MQATLDWLAGLARQHPEVFGGHPGEMAVLEASRSSSHESRVYGSG
FT                   GALVHVKFFRRTLGRTSVTYDPCREMKAEYDTLREFEKNGFASGRHRVVRTLGINESLD
FT                   CALATAYVPGDTLLSIIQRTLKGGDDGELLEALGLAAGFLRKVHGLMPQSPKVDAAETF
FT                   YSYMKPLFYLEEQGALDGFHRRVTKGLSRWYGHRPLFEQRGVTVHGDANPSNFKIHEGV
FT                   IYGLDLERSRPGRSPLLDVGTMVAELEHHCAYVAGDAGRAKPYVERFLRAYAPSPADRK
FT                   KIDELLPFYVSRGLLKIAMLGYWKHGYRRSLVEAGARRIEEGP"
FT   CDS_pept        18076..18897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0026"
FT                   /product="putative haloacid dehalogenase"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0026"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60098"
FT                   /db_xref="GOA:D1YUH6"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUH6"
FT                   /protein_id="BAI60098.1"
FT                   /translation="MITTILFDIYGTLIDISTDESDMATYNAMSKWLEYKYIYVSGDQL
FT                   KWLYHEEFARRLGSEEARSRAEADIFKSIIEEFEARIGEHRELFPDADVRDVFKSIVTK
FT                   FASRTPEELDHLSTDLSHLFRSATRRKMFIYPTVKPALDQMQKKYRLGIVSNAQEAFTM
FT                   PELGLYELARYFETIVLSSQAGVKKPNSRIFTRALGNLGVRPSEAVMVGNDMMADMMGA
FT                   SKLGMRTIFVSDRPARPIKGVAPDAVVQGINLFQVLELVDAWNQKQARENI"
FT   CDS_pept        18921..20243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0027"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains one Cobalamin vitamin B12-binding domain
FT                   (IPR006158).; Contains one Elongator protein 3/MiaB/NifB
FT                   domain (IPR006638).; Contains one Radical SAM domain
FT                   (IPR007197)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0027"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60099"
FT                   /db_xref="GOA:D1YUH7"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034466"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUH7"
FT                   /protein_id="BAI60099.1"
FT                   /translation="MKVLLVYTNRYRPMAPPPVGIAYLAGPLLREGHEVRVLDLMFSSD
FT                   PEGELWRALDEFRPDVAGLSIRNVDNQDMRHTQYFIDDAKKLAGIVHKAGVKTVLGGTA
FT                   FTTFPAETLQYLGGDYGIAGQGEESLPRLLASLASGRLDRGIPGLVWREGGRIMANPPD
FT                   LGGYRSAARWDLLHLNGYTKGFLAGSAVTKSGCPYRCAYCNVTTAFGGELRPRNVGDVV
FT                   EEIKALKAQGIRIVTLTDACFNVPSGYAKEVLNAIIDSGVRVYLNTTFVPVAGHFDDEL
FT                   MELFKRAGGIYASLGAETFSRKMLKSYHKPFTLDDVLACAGLLGRHHIPFMVQALFGGP
FT                   GEDASTLRESLDMLRHVPYAEFTYTMGIRLLPGTLLFETAKKEGLAGDASGLFRPRFYI
FT                   SKDLDVPWAERQIRRTMLRYSYRGLKMLPVAARCALAGVNW"
FT   CDS_pept        20290..20700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0028"
FT                   /product="glyoxalase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0028"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60100"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUH8"
FT                   /protein_id="BAI60100.1"
FT                   /translation="MIERLTHVTVLVRDSDEALKFYTEKLGFEKVEDSKMPTGDRWLTV
FT                   RPKGGDVQIVLQQPGAATFGEEGAKEMLRRVGQGTTWAFKVDDCQGTCDELVKKGVKIL
FT                   SSPQDFGFAVEAIFADLYGNAYILMQPPAGPK"
FT   CDS_pept        20752..22362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysS"
FT                   /locus_tag="MCP_0029"
FT                   /product="lysyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0029"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60101"
FT                   /db_xref="GOA:D1YUH9"
FT                   /db_xref="InterPro:IPR002904"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR023386"
FT                   /db_xref="InterPro:IPR042078"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUH9"
FT                   /protein_id="BAI60101.1"
FT                   /translation="MTYRVFWADSIADEVVERYGKGEVVVKCAASPSGGKHIGNINDIL
FT                   RGYFISESLKSLGVKTRHVHTSDDRDPLRKIPERMPDREGRWKVLSEKELKELGKYVGI
FT                   PYVHVPDPFGCCKSWAEHFNNVWLEGVEALGVHVEDYSNDALYAAGKFEPPMRTILSDI
FT                   PLAREVISRFQMNTPADYIPFNPICENCGRITAKATGVNLDDWTVDYVCESKSLAGEFE
FT                   VPGCGHQGTTSLNNGKLPWRFEWPSQWQIFDVKMEPFGKDHYEGSWPSGQEISKVILKR
FT                   QPPVYTVYEFFLINGAKMSTRHGNVFITQDMLDIMEPETFLYFYSLNPMKQKNLDVKNI
FT                   NFIVDAFDRFERIYYDEVETPDPEEKELAKRVYPMLPIDHRKVRIPYTFAAMVSVSKND
FT                   EHIIRTLKKTGHLPQDATKQQEQDALTRVYKAGTWARRYGPEEYNIEIKEKLEVPADMD
FT                   AAEKDALSELASYIEAKHTEEETQYEIFEMAKRRGVKPGKLFKTAYTLLLGKPRGPKLG
FT                   PFLLALDADFVAKRLRLEA"
FT   CDS_pept        22411..22920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0030"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0030"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60102"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUI0"
FT                   /protein_id="BAI60102.1"
FT                   /translation="MIIQHFSKPSIDPSAFVAETAVVAGSVRLEEESSVWYGAVLRGDE
FT                   ATITVSKKANVQDNAVVHSDRGEDVLIGEGVTVGHGAIIHGCTVGKYSMIGMGAIILSK
FT                   AQVGERCIIGAGAVVKEKDVIPDGSMVVGVPGKVIRQLTPEQMKYLEGNCEEYVRLARK
FT                   YREASK"
FT   CDS_pept        22917..23375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coaD"
FT                   /locus_tag="MCP_0031"
FT                   /product="phosphopantetheine adenylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0031"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60103"
FT                   /db_xref="GOA:D1YUI1"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUI1"
FT                   /protein_id="BAI60103.1"
FT                   /translation="MKVAIGGTFQPLHDGHKALLRKAYELSKNVDIGVTSDEMAHKGRV
FT                   RPVRPYRERVEALRDWIKQEIGVEAHIFRIDDPYGPTLNEDYDYIVVSAETYPMALKIN
FT                   AKRKELGKKPIEVYRVECILAEDGRPISATRVVMGEIDVHGNLLRRRK"
FT   CDS_pept        23372..23890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0032"
FT                   /product="conserved hypothetical protein"
FT                   /note="Belongs to the Protein of unknown function DUF84
FT                   family (IPR002786)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0032"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60104"
FT                   /db_xref="GOA:D1YUI2"
FT                   /db_xref="InterPro:IPR002786"
FT                   /db_xref="InterPro:IPR026533"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUI2"
FT                   /protein_id="BAI60104.1"
FT                   /translation="MKIAVGSRNPVKVKAVENIFSRLYGIVEVEGVAAHSGVPAQPFGE
FT                   ETVTGAINRAKGAFAPQKFDYGVGIEAGLFKVGDIMIDIQYCAIYDGSWLTLGCGSGFE
FT                   YPSIVLDEVTSGKEVGDVMSAVSGIENLGEKEGAIGFLSRGMLTRMRLTEQSVFMALIP
FT                   RLNPQLYGH"
FT   CDS_pept        complement(23887..24498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0033"
FT                   /product="putative 3-methyladenine DNA glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0033"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60105"
FT                   /db_xref="GOA:D1YUI3"
FT                   /db_xref="InterPro:IPR003180"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036995"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUI3"
FT                   /protein_id="BAI60105.1"
FT                   /translation="MKEPDVLPRSFYARDTIDVAKKLLGKVLVRDTPAGRISVRIVETE
FT                   AYCGPRDKACHASRGRTERNGVMFGEPGHAYVYFIYGMYHCLNFVTERDGYPAAVLVRA
FT                   GEPLEGVEAMRALRRKAKKPVDLTSGPGRLCMALGIDRALNGADVCRKGPLYVEDSEDA
FT                   VFEVVSSKRIGVDYAGEYRDKPWRFYIKGSPFVSVRADKN"
FT   tRNA            24762..24836
FT                   /locus_tag="MCP_t0001"
FT                   /product="tRNA-Pro"
FT   CDS_pept        25082..26992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0034"
FT                   /product="putative histidine kinase"
FT                   /note="Contains at least two PAS domains (IPR000014).;
FT                   Contains two PAS-associated, C-terminal domains
FT                   (IPR000700).; Contains one ATP-binding region, ATPase-like
FT                   domain (IPR003594).; Contains one histidine kinase A,
FT                   N-terminal domain (IPR003661).; Contains two PAC motif
FT                   repeats (IPR001610)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0034"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60106"
FT                   /db_xref="GOA:D1YUI4"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUI4"
FT                   /protein_id="BAI60106.1"
FT                   /translation="MSFKPAPSNPPDAGRTTEELLSELQALRARNAALEESEQRYREAV
FT                   ESANSIIIRWDMEGNLTFFNEFAEKLFGFSEDEVLGRNVVGTIVPPSESTGRDLAAMID
FT                   DVLAHPERYELNINENICKNGERVTIAWTNRAIRDEHGNAVEILSVGNDITERRRAEES
FT                   LQFERLQLLSIFDSIDEVIYISDPCTYEILYANKAMQDKFGKSLIGGICYREIQDRDAP
FT                   CDFCTNGIILNNKDEPCRWEFHNPTVNRDFGIVDRIIKWPDGRDVRFEIALDITERNQA
FT                   SESLRESEEDLRAAFEQAAVGMTHVSSDGRFLKVNQKFCDITGYTREELLKMSAQDITH
FT                   PTDMDEEARLIESLLSGRLSTFSSEKRYIRKDGAVVWVNLTVTPIFHNGALAYLMGITE
FT                   DITGRKQAEAALQEAKAQAELYVDLMGHDINNIHQAALGYLELARDMPGDREEHLDMAI
FT                   EALMRSTRLISNVRKLQKIPNAGHAHEVDLCEVLGEVYGEYARSPGKTVMLSLNGREHC
FT                   HVLADDLLRDVFSNLVGNAVKHTGKRASVLISLDEAQEGGKAHYRVSVEDDGPGIRDEL
FT                   KKTLFSRSLKGSPRAKGMGLGLYIVKTLVGNYGGIIRVEDRVRGDHAKGARFVILLPMI
FT                   K"
FT   CDS_pept        27075..27308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0035"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Putative general stress protein B in
FT                   uncultured methanogenic archaeon (Q0W564)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0035"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60107"
FT                   /db_xref="InterPro:IPR038956"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUI5"
FT                   /protein_id="BAI60107.1"
FT                   /translation="MPEKKGKKGEMTVEEAGHKGGEKTAKTHGREFYQEIGHKGGEEVK
FT                   EERGPEFYSQIGHKGGQKVKELVKKGEESEKK"
FT   CDS_pept        27321..27503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0036"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0036"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60108"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUI6"
FT                   /protein_id="BAI60108.1"
FT                   /translation="MRTAILFLVIVLLIAAPLPACEAAPGNIVHAADDGYGLGCPGCPG
FT                   CPDNPVRDPNAPACF"
FT   CDS_pept        complement(27508..28233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0037"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0037"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60109"
FT                   /db_xref="GOA:D1YUI7"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUI7"
FT                   /protein_id="BAI60109.1"
FT                   /translation="MKKTSILLLSLLISALLLSGWALAFMPSEKASYPHTVWTDRNIKG
FT                   TVSGKVVSSMDQSLGVEGAYVALVDAMSPGKEYANTTTSANGEFSMGGLGATYSSVRQI
FT                   GPDGSAGTLSQGMNMFMLYVNKTGGGEGYSSTFGIDTNHTTTPVGTVVIYAGVPEATAT
FT                   PEPTVLPTIVVSTPEPTAQPTVVPTSVPETVTPAPSGGLSGYLGPILVVALLLVLAAAS
FT                   AVVYFKFLRNRLFKRLGKK"
FT   CDS_pept        complement(28331..28759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0038"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0038"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60110"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUI8"
FT                   /protein_id="BAI60110.1"
FT                   /translation="MFGSPLGSPFGSLFGHSPLTGYGLGNYPYYSMPSTTSYSIFDDDV
FT                   FSGFGDAFSGSLFGQKDYGTPPEEAIKDTLVGSNLTYNGGFMSIPLQYRLDETDIGEIA
FT                   GTQYDGEDAWKVRVGQAGVYWDVILDETGTEVLKASQV"
FT   CDS_pept        29045..29383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trxA"
FT                   /locus_tag="MCP_0039"
FT                   /product="thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0039"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60111"
FT                   /db_xref="GOA:D1YUI9"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUI9"
FT                   /protein_id="BAI60111.1"
FT                   /translation="MAETTQFVKEVNDAGFDEAVKSNRVALVDCWAPWCGPCRILAPTI
FT                   EALAKDYGDKVKFFKLNTDENPRVTTQFRIRSIPTLFIFVDGKLADTIIGAVPRQYIEG
FT                   KLKALLPQ"
FT   CDS_pept        complement(29386..30519)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="top6A-1"
FT                   /locus_tag="MCP_0040"
FT                   /product="type II DNA topoisomerase VI subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0040"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60112"
FT                   /db_xref="GOA:D1YUJ0"
FT                   /db_xref="InterPro:IPR002815"
FT                   /db_xref="InterPro:IPR013049"
FT                   /db_xref="InterPro:IPR036078"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUJ0"
FT                   /protein_id="BAI60112.1"
FT                   /translation="MALARDILRDRRLTRDQEQAIMILSAYCLGSMVRVENALPYTFKA
FT                   LKVDRSSVEYDDVDGYNVTGDTVAMSTANIDQAATIAKLQFLVNHVIETVAANSVSTKR
FT                   DCYYMLKNQFQKYPWMDLSGQGESDRLIDTLERIIRMQRENLNIIADPKGLIYGDITLV
FT                   DEEGKEFNCHEREQGITGLAGQWEVKSHHVKAVIAIEKTGVFMDLKKLKVADELGIGLI
FT                   HLGGQPARGCRALINLLSEKGIPIGVLTDLSPWSGMIAKSVLSGSIAAAHLSGLHASKA
FT                   AFLGIESSDVDDWLKDVWKSVQEPLSGHDTARAQNNLSLPYMQDDYWKGENSWFVKSGK
FT                   KTELEALGTAAGSPLKRKEFYKKYLRAKLKEKLKVKV"
FT   CDS_pept        complement(30703..32346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="top6B-1"
FT                   /locus_tag="MCP_0041"
FT                   /product="type II DNA topoisomerase VI subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0041"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60113"
FT                   /db_xref="GOA:D1YUJ1"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005734"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR015320"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUJ1"
FT                   /protein_id="BAI60113.1"
FT                   /translation="MADRKTARELAKDMKEISFSEFIATNPHLVGFESSLKMIPMSIHE
FT                   ILTNSLDACESAGILPEVWIDLKSIDEKGRLKRYRLTVRDNGPGIMPKNIPPVFGKLLY
FT                   GSKFGVRKQSRGQQGIGVSAVVLISQIKTGEHAVVRSSTDGRNTHVYELTVDVNKNAAK
FT                   IHNACKEKSDGWRGVEVSVVLEAMFSSRIMEYLELTAAINPHMALHYDGVDEKDRLDVE
FT                   RRTDVLPRQPVETKPHPLGADYDLLSKMAARTKHRRLYDFLKGEFDRMRPDIVRNIVRS
FT                   CKDTVDVDRPPAELSRKELSGLVEAMRGVETLPPSPECLSPVGEDILIKGVVDRLRPKF
FT                   IAAVTRKPSAMRGQPFLVEIIMAYGCEADFGGSPDPITGVSVHRFVNRVPLLFSESSDV
FT                   ILKAVREAGLGRYEVVPESRSHVFVHVAGVNIPYTSESKEAVKAVDEYYEEIRLAVQDC
FT                   GRKISKHIRQVKRTEENLIKGKKKAVIHSLLLRELNRFAGKKLADLAYAESFGFDDSLA
FT                   EVVSQYHLDVWRTAPRKMKREEAKGAAVAA"
FT   CDS_pept        32465..33619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0042"
FT                   /product="putative glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0042"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60114"
FT                   /db_xref="GOA:D1YUJ2"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUJ2"
FT                   /protein_id="BAI60114.1"
FT                   /translation="MKIAVFTDTFYPQVNGVVNAVRNFDRMLSGRGHEVRVFTEGRKPG
FT                   VASMDGAEVHRYRAFTFLPYPEFEASVDVLGPVRDASRFGPEVVHAHTPFVLGYCAWRT
FT                   ARRLKVPLVGTFHTPVDEYVVYLSRHFKMSRRMLKGIARAYQNWFYGLCDVIIVPAKSA
FT                   ARYIDVKDRRIEVVSNGLDLKRYGREGRDAFREKFGLGESPVILHGGRLSFEKRIDGVI
FT                   KAMPLVLEAVPDAKLLIVGRGPARKSLDALVEELGLQKSVVFTGYVSDDDFPKAFAAAD
FT                   VLALNSPVETQSLIVLEAFATGVPVVGADAGAIPDAVLPGENGFLFDTDDTKAMAGRLI
FT                   QILSDKALREKLGRGALSTASEHSLEKSAEKLLAVYRSAIEKRT"
FT   CDS_pept        complement(33632..34081)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0043"
FT                   /product="conserved hypothetical protein"
FT                   /note="Belongs to the Sjogrens syndrome scleroderma
FT                   autoantigen 1family (IPR009563)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0043"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60115"
FT                   /db_xref="InterPro:IPR009563"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUJ3"
FT                   /protein_id="BAI60115.1"
FT                   /translation="MEDKDLEKVTKMLERGGTMLAKHCECGAPLFKYQGKVVCPICDAK
FT                   KEEHAQTQEQARLAVPVETRPAVSPQAMETVKSTPIMEIPERRMSVVVGSEELDDAAVE
FT                   AAVIAKINDIAVRLASETYPNKIQIYLDILERSLRVLKELHGISR"
FT   CDS_pept        complement(34329..35135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0044"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains at least one 4Fe-4S ferredoxin, iron-sulfur
FT                   binding domain (IPR001450)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0044"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60116"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUJ4"
FT                   /protein_id="BAI60116.1"
FT                   /translation="MSRSIWLVALIKKTFSGRFTLARTTGLPVIGGIVDHLFFRDDRMV
FT                   YLPMDRVVQINKKLEEPSQSFLPSAVAEHFVRSASRRWVMNECICRSASHCEDYPAGLG
FT                   CLFLGEAAAHIDPRLGRPVSEAEALEHLKKCRDAGLVHMIGRDRLDAVWLGVSPGHKLM
FT                   TICSCCPCCCLWKMLPVLSGDIGSRFVKMPGVSVSVRDSCIGCGKCERACFLSAIKVVD
FT                   GRAAIGGDCRGCGRCADVCPSKAIVVSVDDRMAEAIAMVTSSADIS"
FT   CDS_pept        complement(35141..36157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0045"
FT                   /product="GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0045"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60117"
FT                   /db_xref="GOA:D1YUJ5"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR010674"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR041623"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUJ5"
FT                   /protein_id="BAI60117.1"
FT                   /translation="MMFEKVRTVPTADELLDKAYSRAARAGRGKIKEVTDREELEESML
FT                   LTSSNIITDNLRNIAGDWPSLGRMSDFYKELTDIMVGIDRLKMSLGSLDWAASKVKEIS
FT                   RKYVGIMRKSQDPVLVRKQAYGRISSIVYDIDKDLRFLNDARNKLKDLPDVKEEPTIVV
FT                   AGYPNVGKSSFVSDITGARPEIAQYPFTTKSVTIGHFTFKRKRYQVIDTPGLLDRPLEE
FT                   RNDIERQAISALRHVGNVTLFIIDPSETCGYTLKEQYNLLKEVRDFIQMPVLVAANKVD
FT                   IRGGDEEVEADMRMSTLKGEGVVEVRDRLVEMIEARKPEEKPEEPGVELPPSRKKKK"
FT   CDS_pept        36303..36509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0046"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0046"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60118"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUJ6"
FT                   /protein_id="BAI60118.1"
FT                   /translation="MGGGWKMTIRMDVDKYGKSFIEIAKVRNDRRIGRFKLNPRYAKEL
FT                   GELLIDYSKEIEAEGIQSGEEEE"
FT   CDS_pept        complement(36515..37135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0047"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0047"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60119"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUJ7"
FT                   /protein_id="BAI60119.1"
FT                   /translation="MIFMANKMGAHRKVHIGGTIDRDVAEWLSKTKGGEKFSTHLNNIL
FT                   RDAMESGTPREITSISQFKSTVETLRQRVMSLQDRVESLESGRISRRGRPRKEQIVPEA
FT                   PGPEGYDVHADIDWFISRDKYKKIKPETMERAFGVVAREFDRGEELTVGTFKPGYNVEE
FT                   VGVPYPTFKLFYFPLIRDRMLMKGMIEKVEHAGKKGVYRKRQA"
FT   CDS_pept        37374..37940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0048"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0048"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60120"
FT                   /db_xref="GOA:D1YUJ8"
FT                   /db_xref="InterPro:IPR001733"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUJ8"
FT                   /protein_id="BAI60120.1"
FT                   /translation="MVKTPEFLKAFAEKYPGVYGLLQDVAFSLAVVAVIAAALYLYAGM
FT                   WPPMVSVNGISMYPNMENGDLVFIQGLGRGDVQTFENSTSTGYIMYNNYGDVIVYEPYG
FT                   DTSRPYVIHRAMKWVNKGDVMYTDSMGVEHIAQESGFMTLGDNNGGIYDQMAPTICYDQ
FT                   PVQKKWILGIARFKLPYLGYLRSLI"
FT   CDS_pept        complement(37941..38594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0049"
FT                   /product="putative iron-sulfur flavoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0049"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60121"
FT                   /db_xref="GOA:D1YUJ9"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUJ9"
FT                   /protein_id="BAI60121.1"
FT                   /translation="MRVIGLAGSPRAWNSATLRLVEAAAEGAAGAGADIEVIEAAHLNI
FT                   RRCRGCGRCFATGRCAQDDDFSYLAERLEAADGIIMGSPAYAGGVTAPVETIMERMCDA
FT                   AHCRRFEGKYGAAISISRDGDEGYVLEHIGRFLDGCGVAVAGGLAASFDGKGDALAMAE
FT                   ELGKELSLAINERRLYPEHEEAKERFLREFGETIVSNKERWAHDYRYWREKGWV"
FT   CDS_pept        complement(38643..39038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0050"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0050"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60122"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUK0"
FT                   /protein_id="BAI60122.1"
FT                   /translation="MLEFAKETKKVIMYYIPDRIREELGDDGRIIDRIKVVSFPDRQNT
FT                   RGVFLCTTRDDEIEEVSPTPMQACGLVTVLDGKFVLIHSEGETTLHFTNAKSEEEVIDE
FT                   VYLLSEKNGLAKGISAYKRMMPRLNAS"
FT   CDS_pept        39370..39618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0051"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0051"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60123"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUK1"
FT                   /protein_id="BAI60123.1"
FT                   /translation="MLANYIVDKHKELQFNVPDVTIKRDDDNKTREYILNMTPEHRNEL
FT                   GINKSTLWYIRKNPARVRRSNYTIRLRLKSQNNKYGN"
FT   CDS_pept        39739..42099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0052"
FT                   /product="putative histidine kinase"
FT                   /note="Contains four PAS domains (IPR000014).; Contains
FT                   four PAS-associated, C-terminal domains (IPR000700).;
FT                   Contains one ATP-binding region, ATPase-like domain
FT                   (IPR003594).; Contains four PAC motif repeats (IPR001610)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0052"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60124"
FT                   /db_xref="GOA:D1YUK2"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUK2"
FT                   /protein_id="BAI60124.1"
FT                   /translation="MGLKSESGKKSGSTSIVDSGDKDRIIAELKARNKELEEYKARAER
FT                   LEADLRNNEDTTRQLLEQKLYGVWVNVDGKIAYINEVGAKILGASSPGEVAGKSVLDEI
FT                   IHPNYRDIVRDRIKAMSHGGSAVPMIEEKYVRVDGQVVDVDVWAMRFVYKGEPAIFVAF
FT                   KDITERKRAEEALRESEEKYRFLVENSKDVIWKMDLQGRLTFISSNVERVTGYRPGEMV
FT                   GKPIWDFIAPECHGSIKEKLLKRMRGEDIPPYATWIINKAGDLIPIEVATTAITDRGGR
FT                   IVGVQGISRDITERKRAEEALRESERKFRVLTETSPVAIFLYQGEKYVYVNPMAEVLTG
FT                   YSRDELLTMDAWDWIHPEFKFMVKERSRKRQLGKKVPNQYEVKYRARDGREGWVDFATG
FT                   LIEYGGKPAGLAATFDVTKRKLAEEAVRTADVRFRSLIQNSSDIIRILDKEEHIIYESP
FT                   SSEKILGYPPGYTLGKSPFEFIHPDDRERVRNDLGEVYEGTNPGTPTEFRIRKADGSYL
FT                   EVESIGNNMIGIRGVDGIVITTRPITERKRAEKALKEAKAQAELYVDLMGHDINNMNQV
FT                   SLGFLELAHNIIELEGKLGEDNIVLLDKAMNSLKDSSMLIESVRKIQQEKMGLYEPQVL
FT                   DVGTVVGDAIKHFDRIPKRDIKINYSQDDHYFIKANSLLKDVFINLIGNAIKHSKGPLV
FT                   INIRACQVIAKGKRYCRVEVEDNGSGIPDSLKATLFDRLNLAATRAKGKGFGLCLIKIL
FT                   VDDYHGMFWVEDRVKGDHAQGARFVVLLPAIEK"
FT   CDS_pept        42433..43374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0053"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0053"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60125"
FT                   /db_xref="GOA:D1YUK3"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUK3"
FT                   /protein_id="BAI60125.1"
FT                   /translation="MKRVPDHPGTGLTGLTAAKIVLIYVFFGVIWILTSDLLVSRLSPN
FT                   STIYTTLSIAKGWMFILATSVLLYLLIRRYAAERNEIEARLQEARARAELYLDLMGHDI
FT                   TNMNQAGIGFLELAQEQLKLSDEDRQLIAIPQHSLRNSTRLIEYVRKLQRASAGGALRP
FT                   VDLGPALGSLATEYPAQDGRGITISYAGGSCHVMANDMLPDLFTGIIDSISRRSAGPAA
FT                   VDVRLERTEAGGVQYCRVVFEGSGWSCPPQAKEALAYDRLKGYGKTVDRDISMYLVREL
FT                   AENYRGSVYMEDRAADGQDGCRYVVLLPAIEK"
FT   CDS_pept        complement(43526..45574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0054"
FT                   /product="putative histidine kinase"
FT                   /note="Contains two PAS domains (IPR000014).; Contains two
FT                   PAS-associated, C-terminal domains (IPR000700).; Contains
FT                   one ATP-binding region, ATPase-like domain (IPR003594).;
FT                   Contains two PAC motif repeats (IPR001610)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0054"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60126"
FT                   /db_xref="GOA:D1YUK4"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUK4"
FT                   /protein_id="BAI60126.1"
FT                   /translation="MVSKPDLQKKDEDKDKKELLEELKALRGHYSRLKAAVDRYERVAG
FT                   KKELYRGLYDLEAERDRIKAQHDELREDEARRKVADAVEFERKLLFDVLENLPAFIYLQ
FT                   ARDHSIRFANQTFRKIFGEPENRPCYELIQRSDAPCPDCPTFRVFDTLLPQQWEWTDKM
FT                   GNIYQIYDYPFTDVDGTPLVLEMGIDITERKRAEEARRESEANLAKAQRITHLGNWEWD
FT                   VKEDKVFCSDEFYRVFGLDRRDYITFAEFIDTLYPGDKDRVNRAVEAALYKGEPYSIDY
FT                   CVIWPDGSEHIIHAEGEVTYGQGGAPIKMFGTVQDITERKQAEEELLASEEKFRALADT
FT                   SFVTIAVHRGGNLLYVNNATVELTGHSKDELLKMQFWEVFAEDERESIKKRASDRLAGK
FT                   SASTSYETRILTKDGQTKWVNLTGGVFTFEGKPTIITTLFDITGIKNAENELKESKTQA
FT                   ELYVDLMSHDIRNMNQVGIGFLELALKSPDIDKKDKELLLKSMGALENSTRLIDNVRKL
FT                   QKSQTGELKPYAVDACEAIMRVLGHYSNMPGVKATFNYKLPPGCTVMANDLLYEVFENL
FT                   VGNAIKHAGPEPTINVKFEIIVFNGRNYNKFIVEDDGPGIPDDLKPRIFTRRIHSGART
FT                   RGSGLGLFIVKSLVDSYGGRVWVEDRVKGDHTKGARFVVMLPAIKAE"
FT   tRNA            complement(45790..45861)
FT                   /locus_tag="MCP_t0002"
FT                   /product="tRNA-Arg"
FT   CDS_pept        complement(46028..46528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0055"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0055"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60127"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUK5"
FT                   /protein_id="BAI60127.1"
FT                   /translation="MDGAGPTVFERIEQKLSAMGVHVDNSDIAEALKQVDASLSSDPAD
FT                   MESKLARLELKVVELARMLDAALSAMDAGNGQTVIAPVGAAVDKREPAKPQGGHKIKKL
FT                   QQNPATGVIEEVEVEDNPADHFIVADGRGRYMGNAKGGDEPQHKKSVFIAARDDEPVKS
FT                   AKK"
FT   CDS_pept        46696..47553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0056"
FT                   /product="polyprenyl synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0056"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60128"
FT                   /db_xref="GOA:D1YUK6"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUK6"
FT                   /protein_id="BAI60128.1"
FT                   /translation="MQDWNEVKAVNAGIDRIISAVELPEIRMSIAHSLKTAGKRLRPVS
FT                   VLLLAEMNGGRADDATDAALAMECIHTASLIQDDIVDEGLKRRGEDTSHEKFGMFLAMV
FT                   SGDYLISRAMMLMSKYDEKTILAFSKAGLYMAEGELLDVKSRKYKPTEADYVECVRKKT
FT                   AIMFESSFEMGARIAGADEKHAELCRLMGMEFGIAYQIVDDLIEYTQIDDEHKKSALQS
FT                   FILPMVYAQTMSVQEAVDLCMRQVEERIAKIDRVLAGYPDSEAKQKLCEVVDLLRSYNG
FT                   VKIK"
FT   CDS_pept        47687..49969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0057"
FT                   /product="cell division control protein 48"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0057"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60129"
FT                   /db_xref="GOA:D1YUK7"
FT                   /db_xref="InterPro:IPR003338"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR004201"
FT                   /db_xref="InterPro:IPR005938"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029067"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUK7"
FT                   /protein_id="BAI60129.1"
FT                   /translation="MAVQKEDKARVRLKVAEADKREVGRGIARINERHIKEIGVSYGDI
FT                   VQISGRRSTAAIVGSAFPSDMHLDIVRIDGIVRHNAGTTLGDHVEVAKAKWTEAKKVVL
FT                   MPVQKGIRIYASPESLQASFLNRPVCQGDIVSTSTYTPPSQSYNSNLMFEEFFRDFFSS
FT                   PSFGLGEVKLAIASTVPAGVVKITEVTEIQLLPEATEVVKDEVPEVTYEDLGGIRDAIV
FT                   KIREMIELPLKYPELFQRLGIDPPRGVLILGPPGTGKTLLAKAVANESDAYFTSINGPE
FT                   IMSKYYGESEQHLRDVFKEAENNTPAIIFIDELDSIATKRAEVTGEVERRVVAQLLSLM
FT                   DGLKTRKNVIVIGATNRPEAIDNALRRPGRFDREIELRVPDKTGRKEIFQIHTRSMPLT
FT                   PDVDLDEMSDRTYGFVGADIAALCKEAAMNVLRRVLPNIDMTDKALPREIFERLRVTRH
FT                   DFEEALKIIQPSALREIMIEVPNVTWEDIGGLSQVKMLLREAVEWPLRYADSFRRVGVE
FT                   APKGVLLYGPPGTGKTLLAKAIANESQANFITAKGSDLLSKWYGESEKHISEVFKKARQ
FT                   VAPAIVFLDELDALAPVRGSAAGEPRVTERIVNQLLSELDGLEELRGVIVIGATNRPDI
FT                   IDPALLRPGRFDEIILVPVPDRGAKREIFKVHMKRMPVAEDVILNELVDRSDNYTGADI
FT                   ASVCKKAGRLALREDLNAVVVRRKHFMEALKMTEPSVTEEMIRYYQNIGGELKRKGTRE
FT                   IERSMYI"
FT   CDS_pept        49985..51061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0058"
FT                   /product="glucose 1-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0058"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60130"
FT                   /db_xref="GOA:D1YUK8"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR026583"
FT                   /db_xref="InterPro:IPR031640"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:D1YUK8"
FT                   /protein_id="BAI60130.1"
FT                   /translation="MKAVVCTPGQKDSVRVIDMERPRCGPGEVLVRVHSIGVDGTDEEI
FT                   NEGLYGEAPEGCDFLVIGHEAVGIVEESGAGVRCTRPGDVVVATVRRPCPERCLNCRNH
FT                   QPDFCLTGDYLERGIKGLHGFMAEYYTESMDYVIQLPRELLDTGSLLEPLSVVEKGIRE
FT                   SLRVQQRMLWEPRRALVLGAGPLGLLATFILRDMGLDVYTLATRERTSPKARVAEVSGA
FT                   RYIDVGEEPLDTLPEKHGPFDIIVEATGYSPYAFRAMELVNRNGVVCLAGLSPKKKDHA
FT                   LCTDCINMSMVLDNKAALGTVSASRRDFEKGVDRMLSIRNKWPGLLESLFTKKESLDSA
FT                   PRALRRTKEDIKAVVVAT"
FT   CDS_pept        complement(51096..51884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0059"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0059"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60131"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUK9"
FT                   /protein_id="BAI60131.1"
FT                   /translation="MIKKITVMFVTLVLLATIAPVSLADSGGQKHYSGLVGADSPLYGL
FT                   KVGFQNLDLALTFNNTEKLKKQMDLADERVAEYQDAVEEENIAAMDAAADQYSATLTAM
FT                   TETSEAPDVDQEVYSNLVTLLYHHKEVFYLTADQITDETPDDLTDNPKLLDLTYYVQNR
FT                   TVELTEQIIKMKNGMPFYYYNGEQYFVPPGQAKKLEAGVIGNTINNGSKVPPGLAKKSY
FT                   KTPTPTITNGSAVWPWDQIDYTSSTKGNGKGNGNGNNKNK"
FT   CDS_pept        52224..53735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0060"
FT                   /product="putative thymidine phosphorylase"
FT                   /note="Similar to AMP phosphorylase in Thermococcus
FT                   kodakaraensis (Q5JCX3, TK0352)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0060"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60132"
FT                   /db_xref="GOA:D1YUL0"
FT                   /db_xref="InterPro:IPR000053"
FT                   /db_xref="InterPro:IPR000312"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR013102"
FT                   /db_xref="InterPro:IPR013466"
FT                   /db_xref="InterPro:IPR017459"
FT                   /db_xref="InterPro:IPR017713"
FT                   /db_xref="InterPro:IPR035902"
FT                   /db_xref="InterPro:IPR036320"
FT                   /db_xref="InterPro:IPR036566"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUL0"
FT                   /protein_id="BAI60132.1"
FT                   /translation="MKLKAQPYDIEVGRYEIIVNALDADELGIHAGDRVQVKNRDTITA
FT                   VVETTDAIVPQGRLGIYREAWEALKAVPDEVVDVLPASKPSSVSSIKKKMDRQKLTNEE
FT                   LHDIIADIVDGNLTEVELTAFVTASYIYGMDADEIEWMTRAMVKTGDQISFDTHPVMDH
FT                   HSIGGVPGNKITLCVVPIIAAAGLLIPKTSSRAITGAGGSADLMEILAPVSFSAEDVKK
FT                   MTTKVGGCIVWGGATNIAPADDKIISVEYPLSIDPKSQLIASVMAKKYAVGADTMVLDI
FT                   PMGNESKIPTIQEARKLARDFIDLGDRLKMRVECAITYGGSPIGRTIGGGLEVREAMAM
FT                   LEKYEGPTSFMEKTIAISGMMLEMGGVSAKGEGQKMAAEIVKSGKALKKFKEIIEVQGG
FT                   DPNVTSEQVPVGDKVATVLSPQDGYVLEIYNKRLVAVCRIAGAPHDKGAGILIHKKKGE
FT                   YVKKGDGLFTIYADKEWKLDAAIKESLRDPIMFVEGMILEKVQVV"
FT   CDS_pept        complement(53768..54058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0061"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0061"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60133"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUL1"
FT                   /protein_id="BAI60133.1"
FT                   /translation="MYSIDSRVHMTYVDDDDIDDMEAGDTDEISRDEAGRCDECGLKVK
FT                   KEDALQCHMCSAVYHRWCAGAECNVCKTPMEVKAVTKAAPRSEKPRKRTKR"
FT   CDS_pept        54147..54428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0062"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0062"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60134"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUL2"
FT                   /protein_id="BAI60134.1"
FT                   /translation="MQTITMSEEKIDIQAEIDAAMKKGQYSDRKDAIAALQKQLVDYQK
FT                   GALKDALKGAPSVPAMEEAVWKEFLAKAGGDEDKAVQLYLDELKKLNL"
FT   CDS_pept        complement(54638..55066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0063"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0063"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60135"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUL3"
FT                   /protein_id="BAI60135.1"
FT                   /translation="MSIVKSRLRLYLNTDVILSLLTNESGKGENVAKLLYQAADGKYQV
FT                   LVSEHTAYELLRLGVPMEYVNQVLRPLLLLNGSDVLVANSDIMRSAERTMRQYEMPFMR
FT                   ALHVVFAQRNNSLVLTRDIDFTNSARALVGIMTPEDLL"
FT   CDS_pept        complement(55099..57573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0064"
FT                   /product="putative ATP-dependent helicase"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0064"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60136"
FT                   /db_xref="GOA:D1YUL4"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUL4"
FT                   /protein_id="BAI60136.1"
FT                   /translation="MSLIIVVTPYKRDDFKVYPIRDEGSPLFVGVLSLQRTDKGMRPLR
FT                   IRVVREKEDEYLPVPSFVDLLKAASAIMAASMDPAREAALDSMLEAYQLGSNKVNVCRF
FT                   CLLEDRITFKRPDMVRYKDELICMDCAKKELKREVSYKGRITKAGLDRLESLLVKTKDL
FT                   GRIIALLTPSNLPPELTRFDIIPASPDRVKAVRVGDLDLEPRLKQALSMDELLPVQAKS
FT                   VQAGLLKGESQLVVSATATGKTLIGEMAGVNNLLRGKGKMLFLVPLVALANQKYEQFKK
FT                   RYGQLAKVSIRVGTSRIALNSLKMNVNLGSDIIVGTYEALDFVLRKGERGPGVEPLKNI
FT                   GTVVIDEVHMLEDEERGHRLDGMIARLRACAPGAQFIFLSATIGNPKEIAKHLHARLVE
FT                   YEHRPVPLERHLIFAGAHEKNRLIEEYATREYSKTSSKGFHGQTIVFTNSRKKCHQISQ
FT                   SLRIQSAPYHAGLTYVQRKSVEDRFGKGELKVVVTTAALAAGVDFPASQVIFESLTMGR
FT                   EWLSVSEFQQMQGRAGRPDYHDLGRVVILADPEFDLSGETEEEVAFRILGGGAEHVNVL
FT                   YDEPEQMEECLANACIASTEADIRRTNEATLGISSDTKYLIDRCVDKGLMIRENGRVRN
FT                   TPLGRAIATHFLKVEDAFLIRDRVYKKARPLDIAVELEPFDAAYFRNAERLSRILGVNV
FT                   PSRAFSPASLDIVFSGESIAKMDRSLQAQFTDFAREFLDCVCEDAPFCGCPERKFSKKI
FT                   VEYRLQGKDPRGISRAIAADYDLSAFDGDILGYLDRLTRNLDAIGEIARILNKHEAARD
FT                   AKALAQQIEDAE"
FT   CDS_pept        57847..58407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0065"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0065"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60137"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUL5"
FT                   /protein_id="BAI60137.1"
FT                   /translation="MLRAVTNRDFPMLRESLKSLFGMELDVDPSLKPKGKNPIKRFFYG
FT                   QLSSDPRGRVRIIFVDTADVSYGWRKDVDVTGVNIPYKKLTFIGVPESVEPVDEECYGK
FT                   SSLDAYLLAVTLHELYELFTGDFGHCDNPGRCINSECGVYVVGTCSACMGALVDEKFPG
FT                   LKLEDLYCPEHLRKLKLALKKLD"
FT   CDS_pept        complement(58483..59256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0066"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0066"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60138"
FT                   /db_xref="GOA:D1YUL6"
FT                   /db_xref="InterPro:IPR012015"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUL6"
FT                   /protein_id="BAI60138.1"
FT                   /translation="MVLEKKSEITRFQILVETAASQPQIKQSEIAASLGITPQAVSEYI
FT                   KSLIEDGLITSSGRGRYKVTPLGVEAIISGAKELQDYSKYVLSNVVGQVSVWPAIAASD
FT                   LKKGSDVRLFMDGGVLYAGTGADGAVGVAVGDAREGEDVGVKDLKGLISLNRESVRILK
FT                   VPSVEGGGSRSCDIPRLKRELEGLVGAAGIEALAALHKAGVKPDVQFAAVEALAEAAVK
FT                   GVRGTLVITADMAPQAIQKLEAAGVAYTVADAGLR"
FT   CDS_pept        complement(59259..59774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0067"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0067"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60139"
FT                   /db_xref="InterPro:IPR014517"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUL7"
FT                   /protein_id="BAI60139.1"
FT                   /translation="MEPTVKRTKIINDPADLVPLLQVFNSKLHSQVFNEISAGWKTEEE
FT                   LQEITGKDVSKSLDALKQGGLIESRWRMPEPGESPVLEYRTSYNEVRANFQCTMKELSE
FT                   LIMIAFSMDESLRQMAEKMEKEIEGGNASLVNLSRIFERSPTFLKGVAKRSHNIVVKGQ
FT                   RLEITRER"
FT   CDS_pept        59897..62140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hypF"
FT                   /locus_tag="MCP_0068"
FT                   /product="carbamoyltransferase HypF"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0068"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60140"
FT                   /db_xref="GOA:D1YUL8"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR001792"
FT                   /db_xref="InterPro:IPR004421"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR011125"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR036046"
FT                   /db_xref="InterPro:IPR041440"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUL8"
FT                   /protein_id="BAI60140.1"
FT                   /translation="MKKVRILARGIVQGVGFRPFVHNLAVAHSLSGHVKNLGTSVEVVA
FT                   EGKDADVDAFVEGMRRGPKLSRIDSLDVSEEPYSGDYRDFRIEKSSASGFGGFIPPDTG
FT                   ICNNCLEDMRGESRFKDYWAASCVDCGPRYAIMDTLPYDRDNTTMTDFPFCEDCLRDYK
FT                   DPKNRRYHAQGFSCPKCGPRLYLYGEDRKPLAPPVEETIRLLNEGRILAIKGVGGFHLC
FT                   CKMDVTPLLRQRRNRPEQPFALMAPLPVIEKYAHVNEGERGLLDSMQRPIVLLRRKHGV
FT                   PESVAPGLHTVGFMTPYTGFHHLLFKDIGEPLIMTSANLPSEPMVKDNEEAFRRLKGIA
FT                   DYYLLHDRRILNRCDDSVLRYNDGMFFTRMARGYAPAMFPMKKSSPKAILAMGPELNSS
FT                   VSIYKDNLCYTSHHLGHINNPLALDFLRETVDRLLKMTKVTPEIVVTDMHPSFLSSRLG
FT                   RELAQQFKADVVTVQHHRAHIGSLVVEGVELEDVVGVAMDGVGYGEDGTVWGGEIFHGG
FT                   AHPAGLLPVPMPGGDLATKFPMRMVAGILYGSVDEGRLLRIMEANMGPTEAQVILKQVE
FT                   RKVNVAYSSSAGRVLDSVAALLGVCYRRTYEGEPAMKLESFAFPGDANKVDLPCDIIRM
FT                   DGRNVVDSRSLLRAVVDAMDEGKNRHDIAASAQVSLARAFAEQACRAAKKSGAPVVGLS
FT                   GGVAVNAAIGRTIEDYVKSEGLKFVTNHKLPCGDGGVSFGQAVLARDMISPTI"
FT   CDS_pept        complement(62133..62786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0069"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0069"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60141"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUL9"
FT                   /protein_id="BAI60141.1"
FT                   /translation="MASIRAHKDSNTLIIMKNSSYARPITHRINLILGMNARCMEQVAI
FT                   DGDLELGKNAQVTGSVRARNVILGPGSVVYGDVTAYGDLKALDNASVIGHVAVQGGAFV
FT                   RPGVRFGSLDVGGLIEIQGRPPSKHIQGKMVVNDDMDYPELKKMGAEAIKKAEPGKGHV
FT                   VQPPKSPGKAEPEKAADKVKPAAKGKQTQAQKKGKKKAPEEEKPKKKGFFGLFK"
FT   CDS_pept        63232..63795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0070"
FT                   /product="peroxiredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0070"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60142"
FT                   /db_xref="GOA:D1YUM0"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017559"
FT                   /db_xref="InterPro:IPR019479"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUM0"
FT                   /protein_id="BAI60142.1"
FT                   /translation="MLRINEKAPDFEAEAYQNDRIKKIKFSDYHGKWMVLVFYPGDFTF
FT                   VCPTELQELGELYDDFKKEGAQVLSVSKDTVFVHKAWHDNSPAISKIQYPMVADPSGKI
FT                   CREFGTLIEDEGLSLRGSFVIDPDGFLKCMEIQDNNIGRSMRELLRKLQAAKFVREHKG
FT                   RACPASWEPGEETLKPGLDLVGKI"
FT   tRNA            63880..63955
FT                   /locus_tag="MCP_t0003"
FT                   /product="tRNA-Thr"
FT   CDS_pept        64006..64596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0071"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0071"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60143"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUM1"
FT                   /protein_id="BAI60143.1"
FT                   /translation="MAPMDEDNILGAINIRGQGDGMTSKNKRVCKECGRSFTASAKWDY
FT                   ELCEDCSIVLYERMEKFWITEVLGLSEVLDRFLPSLPRKLFDIALKKYAPIGQYDIFDA
FT                   NSEKELQKELRGAAAVEKERLAKKVPFRTAKCKKCGTPYTVDGLWQYNICQKCAVQEVL
FT                   DWRAYWAKQVPGIGTARAGFDIPPIEVARYILD"
FT   CDS_pept        complement(64593..65237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0072"
FT                   /product="putative metal-dependent phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0072"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60144"
FT                   /db_xref="GOA:D1YUM2"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUM2"
FT                   /protein_id="BAI60144.1"
FT                   /translation="MLARARDISRSTHAGLAPSHDFSHAERVYRLAERIAMAEGADLFI
FT                   VRMAALLHDIGRAEESKNKDCEDIHEELSVRMAGPILDGLGIQPGKKDAILHAIASHRH
FT                   RRGGEPCTLEAKCLFDADKLDSLGAVGVARSYLWLGEHGRSVYYPPEQYAGIDPKNNSA
FT                   EVDSTQREWHIKLKHLKDKMYTETGRRIALERHDRMARIIDEIEKEVMGQY"
FT   CDS_pept        complement(65257..66090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0073"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains one Metallophosphoesterase domain
FT                   (IPR004843)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0073"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60145"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUM3"
FT                   /protein_id="BAI60145.1"
FT                   /translation="MESILLFSDIHADIGALDAILRLSQSGDFVDRYGPVSLTINMGDV
FT                   LERGHGPGQVVERLESISGLESILGNHDEAFLGRIPVSGSDAESERAHEEYRATGRYES
FT                   FFRGMGKYYVNTKERLYVVHGGPIDPCAITPEGAEGIEAWLYTQPWQRISFSGERYVDA
FT                   SGYHYLPEDAFDAVRPQLGTGFLIVCGHEHEEAAYVQKGGAVENVLGKLERSTVYLGGR
FT                   EVRETKLALEEDACYLARLGMAGPEGYGEYVDDRRYFGVYSTKGGRALYLLCFGR"
FT   CDS_pept        complement(66129..66572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0074"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0074"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60146"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUM4"
FT                   /protein_id="BAI60146.1"
FT                   /translation="MTDPTHASGLAFEEHVIGLFGREFEVKWIRDGATKEEVDFLPDLE
FT                   IRHTPSGDAFGVECKYRASHFLGRLPWAKEYQLKKYGRYREVTGRQLFIIIGLGGTPER
FT                   PDYMYCVPSWRAGATMLDADSLKRYRRDPRRKFRWDEKARQLV"
FT   CDS_pept        complement(66622..67572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0075"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains two Protein of unknown function DUF6,
FT                   transmembrane domains (IPR000620)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0075"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60147"
FT                   /db_xref="GOA:D1YUM5"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUM5"
FT                   /protein_id="BAI60147.1"
FT                   /translation="MLKNADLRDNAFFVMAGLILVNVFWGASSIAAREALLQLSSIEIV
FT                   TIRFTIALFIVFGMAIAMKKWDALRIHPKDIPTFILLSLSNVSIGFILQVESLNYTTVT
FT                   NFSLEFNLATFFIMLMGALLLGERLTRTKLAGAGIAFAGAFLIISGGRLDLSSAHLLGD
FT                   LMGVGSAIAFGIFTIASKKVSSKYSLTTILLYTFFFGVLELLPFYAFVTPMTPLASLSP
FT                   LSWSSLLFLAVLCSVFCFFVYTHGLSRLKASDVAMSIYVTPLAGILLAVLLLGETLTAV
FT                   TAVGAGLIMAGMYLTQRELEPDVPEKRYTPVALNE"
FT   CDS_pept        67755..68267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0076"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0076"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60148"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUM6"
FT                   /protein_id="BAI60148.1"
FT                   /translation="MKLRNIVVPVLIGLFLASAALLTASAQYARPASDQILVNQPYGSM
FT                   QDNILPPASFEQQQYPFAASPLAAPYGALEAPPVAPCAAPLAAPCAAPVATYGPFTSGF
FT                   TYSATRSSAFGPFAPPVAEATEQFYQYPGISPYGAYPGAGYAAASGVGFDPATGYYGPY
FT                   GAYTPLI"
FT   CDS_pept        complement(68294..68884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0077"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0077"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60149"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUM7"
FT                   /protein_id="BAI60149.1"
FT                   /translation="MEADINDNARSLESGGVTSLKPCLAQVDDSGIGSPVGGAAIGVLD
FT                   TGTGVFKYKLVGVEYFQDGYKNEYQDRVVEIIRELFAEMGITRDVYRIEICSGHIFDHV
FT                   RPWMDEAGYEWKSVKIIDPLQSLIENAFSDFLISLGVPERIRTIEVGRDQFMYLFNWVK
FT                   QDPERRVKYCKTNGSKWKTKWSHKLYDRQSRYH"
FT   CDS_pept        complement(68955..69623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0078"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0078"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60150"
FT                   /db_xref="GOA:D1YUM8"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUM8"
FT                   /protein_id="BAI60150.1"
FT                   /translation="MLSLVGDVTSTVTDIISNMGYLGVFILMTIESAGIPVPSEVIMTY
FT                   GGFMAAPGGVTHVVAVAVIGSLGTGLGSAIGYLVGAWGGKPFVDKYGKFFGVNSQKMLW
FT                   AEQWFCKYGESACIYTRLLPVVRTIVNVPAGLLNMDFKKFMAYSMIGAFPWCLVLAFIG
FT                   FVLGENWESIMGASHLLSYAVVAVVAVIAVAAVALYVLVKRGVIPKATVDKYLGFLMHV
FT                   "
FT   CDS_pept        69763..70689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0079"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains one Protein of unknown function DUF362
FT                   domain (IPR007160)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0079"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60151"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR007160"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUM9"
FT                   /protein_id="BAI60151.1"
FT                   /translation="MSRRSFLKAAVAAAAVAVTGCVSASEPSITPVPSIIPSPTSTATQ
FT                   SRLVVTTDPDPARLVDRALDAFGALPIKKDDRVFVKANFSFSRTVDQAASNHPQVLVRL
FT                   MERCREAGASEVIAFDHTIDSSKLCLERSGIKAAVEKAGFTAIAVNSSSEYEERQIDGP
FT                   TLKKTRIARILKDADVLINAPVVKSHGNTRLTAGMKNLMGVIDNRGAFHSSDLDGCIAD
FT                   LSYVIRPTLTVADAYRVLKSGGPNGGSPEDITHPQQLIVGYDPVAVDSYAATLLGLTGN
FT                   DIEHVVRAYQRGLGEIDLGKVNVQKVV"
FT   CDS_pept        70616..72001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0080"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains at least two 4Fe-4S ferredoxin, iron-sulfur
FT                   binding domains (IPR001450)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0080"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60152"
FT                   /db_xref="GOA:D1YUN0"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUN0"
FT                   /protein_id="BAI60152.1"
FT                   /translation="MWSGRISGAWARSTWARSTCKRWSEIKLSSLSPFRPLVQAAFLAS
FT                   FVALFLALEYPAAAPGLFLAADPLLALASSLYHTGAWMPVLFLAAAGMLAVAAIFGRIF
FT                   CGWACPVGFMADISDRVVRVFWRIKPTGRLGFIQYGLLAALLIFSLFSIDALSALDPMV
FT                   IFQRSVYLIWSLSGVPVVLLLIMAGSLLAPRLWCRICPMGAVLGLAALASPFGRGVNDS
FT                   CIKCMKCRRACPAGAISKENGFDTTACIKCLKCERACPENAISFAASRPALPTFEGRRT
FT                   VLAAVAGLGLLALAKVAVPGAGASYIRPPGSLVESKFNAACVRCESCVKACLGQVIRPA
FT                   GLDGGLERAFTPVLDFNKGKCERCGTCGSVCPTGAVISIPEANMKMGTARLDKNKCIAW
FT                   AQNKKCLICEEVCPVKAIKSTGRNRPVVSEDVCAGCGSCQLNCPVEGKAIVVSSEGERR
FT                   RDE"
FT   CDS_pept        71994..73700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0081"
FT                   /product="family X DNA polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0081"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60153"
FT                   /db_xref="GOA:D1YUN1"
FT                   /db_xref="InterPro:IPR002054"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR010996"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR022311"
FT                   /db_xref="InterPro:IPR027421"
FT                   /db_xref="InterPro:IPR029398"
FT                   /db_xref="InterPro:IPR037160"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUN1"
FT                   /protein_id="BAI60153.1"
FT                   /translation="MNNHEAAEVLAGIARILELEGEDAYRIRAYRKASRSIEALQDDIN
FT                   EYYREGRLQEIPGVGRSIGELLAELLETGRSSLYESLKKEIPPELFEIMGVPGIGRKTA
FT                   IKVHKALGVTTVEEFERAARMHRIRKLKGMGEKAERRVLDSIGRYRRRETGIPLYRAKG
FT                   VADEAAHYLEDCGFERIEAAGSVRRWAPMVSDVNLVAGPGPMDCFLNSPLVSAVQSNDR
FT                   GGARVMTRYRVEATLEEAGPDNRGLELLFATGSERHLEALTEYAAGRGISLSREGYVDA
FT                   VTLEQRKFAAEEDLYRALGLEFIPPELREGRGEVEAAAEGGLPRLVEMADIRGDLHVHS
FT                   DWSDGANTIQDIAIAARAMGYEYVAICDHSRSLAIANGLSVERLRDQMAEIDRLNDTLE
FT                   DFTILKGCEVDIKADGSLDMPDDILEELDVVVASIHSGMRQEAEEMTGRVISALQSPYV
FT                   TILGHPTARILGRREPTRLDIDRAIEAAVDNGKVLEVNAYPDRLDLSDVNVRKAVEAGA
FT                   HISIDTDAHSLFELGFMEYGVHNARRGWAPKESVLNALTYEGLLDFLSGRQ"
FT   CDS_pept        73742..74287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ligT"
FT                   /locus_tag="MCP_0082"
FT                   /product="2'-5' RNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0082"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60154"
FT                   /db_xref="GOA:D1YUN2"
FT                   /db_xref="InterPro:IPR004175"
FT                   /db_xref="InterPro:IPR009097"
FT                   /db_xref="InterPro:IPR014051"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUN2"
FT                   /protein_id="BAI60154.1"
FT                   /translation="MIRAFISVNLTPGIRQKIGEAERDFDMKGIKLVEPSLIHVTLKFL
FT                   GNIEEAKVGEIEAALKKVSVRPFKARMRSLGGFPNPRNPRVIWVGAEGDFAELNKQVEA
FT                   LMEEIGFPREGRFQPHVTIGRVKFPTPEQKQDLPGLFEKYKDFDAGEMTVDSIHLMKST
FT                   LSPKGPRYDVLKEIPLAR"
FT   CDS_pept        74277..75608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cca"
FT                   /locus_tag="MCP_0083"
FT                   /product="CCA-adding enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0083"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60155"
FT                   /db_xref="GOA:D1YUN3"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="InterPro:IPR008229"
FT                   /db_xref="InterPro:IPR011068"
FT                   /db_xref="InterPro:IPR015329"
FT                   /db_xref="InterPro:IPR042090"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUN3"
FT                   /protein_id="BAI60155.1"
FT                   /translation="MPDELYREVLERIKPSAVEDAHMRSVAHEVIDKLDSEAREHGLDV
FT                   YTIHVGSTARDTWLKGKKDIDIFLMFPPDTPLEKLKEDGLRLAREVSPRFEERYAEHPY
FT                   ITALYKGLDVDLVPCYHVEDAAHIQSAVDRSPFHNTYVLKHIDGLHDEVRLLKQFTRGV
FT                   GVYGSELRTQGFSGYLCELLVLKYGSFDGAVEHGAGFKRGRVIDIEGHMDKSVEHPDPL
FT                   IVIDPVDPKRNVAAALSGQKFCEFVDACRRFLKAPSIDFFFPPAAEPMKKGALEGLLAS
FT                   RGTKLLAITFKTPDIVEDTLYPQLRKAEDSLAKLLERHEFKAYRTDVWSNDRSAIVLEM
FT                   LVWELPAIERHLGPPLDEREHCEKFIEKYPGAYIMGCRYVVDIPRKYDTAVELINAQLK
FT                   SCGLGKHVCASIGQGFEILTNEKTLELGPEFARFLTKFLRAPET"
FT   CDS_pept        complement(75605..76585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0084"
FT                   /product="putative histone deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0084"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60156"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="InterPro:IPR023801"
FT                   /db_xref="InterPro:IPR037138"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUN4"
FT                   /protein_id="BAI60156.1"
FT                   /translation="MACILYSDDFLGHDLPGHVECKERLEAIMERLRPMGLEFREPRPA
FT                   SVPELEAVHAPWYVRNILGHGRGRLDLDTYMSEGSAMAALKAAGAAVEAVDLALSGQSL
FT                   AAGMVRPPGHHALPAQAMGFCLFNNAAVGAAHALKKVKKVLIVDWDVHHGNGTELMFYG
FT                   RPDVLYFSVHQYPHFPGTGAADDTGTGDGEGYNVNVPLPAGSGDADYVHAFESILVPVM
FT                   DAYRPELVIVSAGYDPHEADPLGDMRMTAPGFGALASLIKTAGSANVVMLLEGGYSLKY
FT                   LPLCVEASLRGFAGEDHGRISGERTAAATERIVEAAAIQKRYWRL"
FT   CDS_pept        76906..77289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0085"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0085"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60157"
FT                   /db_xref="InterPro:IPR017185"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUN5"
FT                   /protein_id="BAI60157.1"
FT                   /translation="MKKLTVPVLDEKDKEFVETLVNVGLKRNVAKTLVYLANVDETISR
FT                   DIELGADLRQPEVSIVMRELRDQGWVEEREIKKEGKGRPLKCYKLATSITDIISMLEER
FT                   KKEEAAVHLENIQKLRNLSDKLK"
FT   CDS_pept        complement(77336..78034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0086"
FT                   /product="conserved hypothetical protein"
FT                   /note="Belongs to the Predicted nucleotidyltransferase
FT                   family (IPR009185)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0086"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60158"
FT                   /db_xref="GOA:D1YUN6"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="InterPro:IPR009185"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUN6"
FT                   /protein_id="BAI60158.1"
FT                   /translation="MRRKTAEMGPRKEVAYGPETWEHLRRLRERAREVLTLLKKSEVDG
FT                   YVFGSVARGDVKPASDVDIFIPSMVSSMLVGLALDDRVRERSIVQATPRAMAKAHLVLQ
FT                   DDTNVIFPLIPPRETELEFYRFGGEVGLQGIEEGGRVCGVDKRLMFIEPTPEGHIETPL
FT                   SDLPPGWVAKKIGVGQAIVEERMRVLERRADVGRTGIYLHRTLAPEESFEQVLAEIAYS
FT                   DPALRRRMSK"
FT   CDS_pept        complement(78031..78348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0087"
FT                   /product="CutA homolog"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0087"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60159"
FT                   /db_xref="GOA:D1YUN7"
FT                   /db_xref="InterPro:IPR004323"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUN7"
FT                   /protein_id="BAI60159.1"
FT                   /translation="MFSVVYIISRDMEEAGRIADVLVAERLVACVNFGIISSVYRWEGR
FT                   IQRDTEVSMLCKTTTERVLDVIKRVKEIHSYELPCITSWKLEDGYGPYLEWVKAETEKG
FT                   R"
FT   CDS_pept        78408..80072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0088"
FT                   /product="peptidase M50 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0088"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60160"
FT                   /db_xref="GOA:D1YUN8"
FT                   /db_xref="InterPro:IPR001193"
FT                   /db_xref="InterPro:IPR008915"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUN8"
FT                   /protein_id="BAI60160.1"
FT                   /translation="MVELIWIAAFVAFALWWYIIADLEKAGILKKYNMTAIGPILMLRT
FT                   FRGQGFLDWLAKPKGLWRVVTLLGMPIVLGSMVLMLVLFIGMDFLMLANIESVPTPGPA
FT                   NAPQNIIAIPGLNQFIPFWWGWIALIVAMAVHEFGHAILAKVENIKVNSLGIILMPVPI
FT                   GAFAELDEEQMFGTKSEGKTADILGPMETKAPGEGKRKATSRQLTSILSAGVIANFFVA
FT                   FLAFALLFGPVLGSVAATTSDVIVYDVAPNSSAYDAGVRANFIVNSVGGMNVTSPEQFN
FT                   AALRSATGQSVAISGLLDNKPVSYVVPVNGTSGVYVSDIVNDDKYPAKAAGIAQNMRIV
FT                   AIDGTPIADRAAFTDYMNHTAPNQSIVLGMAYQNNTMVNTTVVLAQGPEGQSYIGIYTV
FT                   DNPLGISARSFASGYLGGLKNMPFSLTGWLRIFVLPVLQFSGDDPGFSIFQGQFSSLFH
FT                   PVGIAASFGSAVYSLSECLFWIGWLNLNVGLFNCLPMIPLDGGHVFREIVRRFLDPVIR
FT                   DPARKEKITGTIVNGFAVTLFAAILFMMLAPYIVHGI"
FT   CDS_pept        complement(80073..80720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0089"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0089"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60161"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUN9"
FT                   /protein_id="BAI60161.1"
FT                   /translation="MTRKYLVYVLMALAVALAGCVLLQGAAPAIKQVENGIAPLISLPD
FT                   DVPSSQSVPSGPAADMAPFDLGGTRWMEYRLTTADGGTGDVRLDYSSLDSGRMVSIRRT
FT                   QTSGDVSSMSSSDGGMSYSMRYSSSQSSMTSNTASADKIKADDPVLYSEGLAARAAGPD
FT                   SVTVPKGTYDCKKYLTSFKGSDATYWGAPGVPVPVKIYTACDGATLELVGWG"
FT   CDS_pept        80882..81994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0090"
FT                   /product="conserved hypothetical protein"
FT                   /note="Belongs to the Protein of unknown function UPF0004
FT                   family (IPR005839).; Contains one Cobalamin vitamin
FT                   B12-binding domain (IPR006158).; Contains one Elongator
FT                   protein 3/MiaB/NifB domain (IPR006638).; Contains one
FT                   Radical SAM domain (IPR007197)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0090"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60162"
FT                   /db_xref="GOA:D1YUP0"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR023980"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUP0"
FT                   /protein_id="BAI60162.1"
FT                   /translation="MARVHFRWNPKNRYSIAALGGVLDFDLVRKPEAGIMLYSFASPQA
FT                   RSVFREVGSASTDSVFIAGGPHPSGCPGETLEHFDYVVVGEGEETLPDLVSTLNHGGDV
FT                   SGVKGIAYKKDGKVIFTPKRGEADLDGHPPFKPPLFGPIEITRGCPWSCAYCQTPRLFG
FT                   HHMRHRSVEAICKYDKFYEDKRLVSPNAFAYGSDGITPDEAAVENLLKSLSGNIYFGTF
FT                   PSEVRPEFVTPRMLELVNAYCANREIHLGGQSGSDRMLKAIHRGHTAAQVLDAVELTHD
FT                   NGLTPVVDFIFGLPGEREEDQQLTVDCINAIIKEGGKVRAHYFMPLPGTELADTKPEKI
FT                   SPTIDKLLGKLALGGRLTGSWSDVKALKKQ"
FT   CDS_pept        complement(82182..82556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0091"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0091"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60163"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUP1"
FT                   /protein_id="BAI60163.1"
FT                   /translation="MTVPTSPLVEIFGQNSSAQLIVYLVFNHGNEFNIADVAERLKISK
FT                   PKVNKMKDGLLKYKVIHETRKVGKTSYYRYDRNSKMGKTLYDLVFNAGTSEHAMNMAHA
FT                   TATPTPKKNKDDCGGKIIIA"
FT   CDS_pept        complement(82630..83109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0092"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0092"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60164"
FT                   /db_xref="GOA:D1YUP2"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUP2"
FT                   /protein_id="BAI60164.1"
FT                   /translation="MNNKLVLIIGVVVIIGLIIGLCYYKFDNNFVTNNNSTINTITPIP
FT                   TENPVENDTLTILPNDYVINNINWTQYPNLQQGYIYKVYIAGPTDTVPYKFMEVQILTE
FT                   VKDTNDRELIRSQLSGVAYEVRKIYGPNSDIHILGTKNGAATWDISLYPNQNDAH"
FT   CDS_pept        complement(83133..84668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0093"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0093"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60165"
FT                   /db_xref="InterPro:IPR013373"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUP3"
FT                   /protein_id="BAI60165.1"
FT                   /translation="MIVLTRFRRSDRGISELQGSLVLLAVILVAALVLKSAIGDNIAAA
FT                   ALDFGGFKAWGARNDVSFEENAPIVAITEPADGSRFYADRYTSISGTVRTAPGRNASLV
FT                   YFRLNGGPWKKAELAGNSWTSSSRRYLEGSYHVEAVAYDDHGDRSPEASGTFETIFRPY
FT                   PDAVLVGDDVPDTMTAGDPYAVHITYSNTGYLPWNDTAGYTLSPNGSTIALPSIGMGGA
FT                   SVQPHQGHSFELTLTAPAAGDYTIGYRMYCPEFGRFGDEFSKPVRVVSSYHDASVVSLN
FT                   MPDEMTSGETRTVTITMRNTGTAAWFASGSDPVYLAMVDGTSGDAYHFNGTSDRILMTP
FT                   GTVVRNGNDYTFTFTIKAPAAGSYYTQYRMMWSNHYLFGQIAGHTITVKAVPTPTPTPT
FT                   PTPGPTSNPPGPVSPTPTPVAQYNAHGKMTLKYYTGEEYRGPLRYYYDGPLGNHFERSS
FT                   RGASDDSSPTWDWDIGGPNGHYSIYNDVDHYSGGLQFEMDNGGNKGKVIFYKN"
FT   CDS_pept        complement(84665..85270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0094"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains one PA14 domain (IPR011658)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0094"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60166"
FT                   /db_xref="GOA:D1YUP4"
FT                   /db_xref="InterPro:IPR011658"
FT                   /db_xref="InterPro:IPR037524"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUP4"
FT                   /protein_id="BAI60166.1"
FT                   /translation="MDDSGVADAFYTVLSIGIVLVAAIAVSAVVLSTTTKQGGEAAAQI
FT                   AGYGEQSLSKGLYCFYYEVDSAHSNIASGDPDDIVLQMLSLERIDSTIALDSTYAPDDA
FT                   PATMGMVLYSGYLYVPESGSYKLELDSAGQAWLWIDGTIVADNRVPVVSQSKTFTLSLT
FT                   KGNHPLKLKYFYPDIRAASCSLKWEQGGALVPVTSFSR"
FT   CDS_pept        complement(85270..85728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0095"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0095"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60167"
FT                   /db_xref="GOA:D1YUP5"
FT                   /db_xref="InterPro:IPR012859"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUP5"
FT                   /protein_id="BAI60167.1"
FT                   /translation="MKGKWKFMDDERGVENAVYSILMIAIVVIVALMIGSLVLSRGGQL
FT                   QVLAGTPKASLSGVLNGGASPSLLLNHESGDPLNVAQLSLSVFDDGGVQIGSITVPDTV
FT                   TPAAISSGMQTSAIQLTGMAITSGNRYTIKISDTQSKQQIGMMVLVAR"
FT   CDS_pept        85891..86520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0096"
FT                   /product="putative flavodoxin"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0096"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60168"
FT                   /db_xref="GOA:D1YUP6"
FT                   /db_xref="InterPro:IPR001226"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR026816"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUP6"
FT                   /protein_id="BAI60168.1"
FT                   /translation="MFLSMANKLALVIYDTKYGSTEQVAHWVAEGIGDADIRHVEDVTS
FT                   LFYDLIVIGSPVYNDAPSSHIMAFLDRYKENLANKRLAVFTVSLPYNMTPERAKSYTGV
FT                   HGLTELTGKIKGTVIDTKAFLGKVEEKELTALDRLSLRIQYFLKGYELKDANFMDRGAA
FT                   ITWGRKLFELATKAPEPVTKERKDRKIGGSTEVPGHKGNGQKEEKK"
FT   CDS_pept        complement(86521..87009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0097"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains one CMP/dCMP deaminase, zinc-binding domain
FT                   (IPR002125)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0097"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60169"
FT                   /db_xref="GOA:D1YUP7"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR015517"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR016473"
FT                   /db_xref="InterPro:IPR035105"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUP7"
FT                   /protein_id="BAI60169.1"
FT                   /translation="MNHERPTHDEYFMEIANVVAKRSTCLRIHVGAVIVKGGQILSTGY
FT                   NGAPHGFEHCLDIGCIREKENVAHGTRHELCRAVHAEQNAIIQAAIHGVSIEGATVYCT
FT                   HQPCILCTKMIINCKINRVVFQNGYPDEMSLKFLKQAGIDVLRMPSKEEPPEERPLSV"
FT   CDS_pept        complement(87014..88102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dys-1"
FT                   /locus_tag="MCP_0098"
FT                   /product="deoxyhypusine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0098"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60170"
FT                   /db_xref="GOA:D1YUP8"
FT                   /db_xref="InterPro:IPR002773"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR036982"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUP8"
FT                   /protein_id="BAI60170.1"
FT                   /translation="MAKTSKFLQRPTVPIAVTDKSVSELMDAMASTGFQGRKLGESVET
FT                   WAHMLKDSNLTIFMGLTGAMCPAGMRKIVAYFIQNRMIDCLVSTGANMFHDIHESLGGK
FT                   HYVGSHAANDEALFKEGVDRIYDVFAVEKQFRKTDHIIADFSETLEPDRPYSSREFMFL
FT                   LGKWLHEQGADHDSVVVSAYMHNVPIFVPALCDSSIGIGLMVARRGGRAINVDQMKDVD
FT                   DITQIIENSKKTGVIYVGGGVPKNFIQQTEVIASILGLPIEGHSYAIQYTTDAPHWGGL
FT                   SGCTFEEAVSWGKIAAVAPKVQVFADATIALPVVSHALAQKTSSYIKKRSAPRYDWSGK
FT                   KLKLKYAAVTPKQKAKPSKEKK"
FT   CDS_pept        complement(88159..88908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrpR-1"
FT                   /locus_tag="MCP_0099"
FT                   /product="NrpR transcriptional repressor"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0099"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60171"
FT                   /db_xref="InterPro:IPR002846"
FT                   /db_xref="InterPro:IPR036984"
FT                   /db_xref="InterPro:IPR038982"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUP9"
FT                   /protein_id="BAI60171.1"
FT                   /translation="MYESNEEMMFTNARIEEIMYNVTFNPKTRDGDIVVNLSVVDKNNL
FT                   DEVLELFRQVMYSGLSVCSYVKLFDEGETFSGYRVAPGKAGIATACSITIDGVFLKQGI
FT                   PVRPKFGGIVQVKDRQPIRFTDMIRYDSTTIDPLEVLMSQELTSVKEMTRTGSGKVLAN
FT                   FREVPMTAKDDVDHTINRLLTAGFYGILEVGEPNTPVLGVDVDRDHMGVIITGGTNPMA
FT                   AVQESGIPIVTKAIKGTLDFREMKKLA"
FT   CDS_pept        88982..90082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0100"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0100"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60172"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUQ0"
FT                   /protein_id="BAI60172.1"
FT                   /translation="MSNNLLNVIKEVFSTYNYTVSASQQGFDLLAEKPGYRVGIKLVDD
FT                   ASADDLKTFLDGLNGSGIKVLFITMAGFSEDVKKLGGQRELMMWDRAELARQIGNAVLS
FT                   GCEAPAQAKPAADISSLTSELYASRPAVQPKPEPAQPRAVKAPEPVIEAVEEEKPAKKK
FT                   AKPEPAVEAATEPAEGVSIPLHAIPIKVKDSDAIKISGAIGRAEDVELSIKFIPFWKYD
FT                   YKLDVQSRYRDLTVPLNSKGSRVINAINKQVDPAPQAAPVESVDLPDAPYDVQETVVSE
FT                   EEARAMAIKAIVEENTKTVRFKGTQGEAAIVEHKKFQPRPQDVEMDIELVYIPFWAVRS
FT                   HKGYMEINAYDGKPTRMPIDDGAEIL"
FT   CDS_pept        90155..90469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0101"
FT                   /product="conserved hypothetical protein"
FT                   /note="Belongs to the HesB/YadR/YfhF family (IPR000361)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0101"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60173"
FT                   /db_xref="GOA:D1YUQ1"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUQ1"
FT                   /protein_id="BAI60173.1"
FT                   /translation="MKVTDKAAEQLKTLLDKEQKKDSLIRIYFAGYSCSGPQYAPALDM
FT                   EKKEEDVVTNMNGINVVYDRNLEKDLELFELDYIQTPYGEGFIVRNPSASCGSDCSGCH
FT                   "
FT   CDS_pept        complement(90549..91310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0102"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0102"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60174"
FT                   /db_xref="InterPro:IPR021586"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUQ2"
FT                   /protein_id="BAI60174.1"
FT                   /translation="MITMERLEKILRDLGLDGALVEVFVYLAGKGKSSLEEIYEETTLS
FT                   RRAISLALGELESAGAVKRDGPDYAIEDARKALQALLPARLEELKAEIYSYRPVTKKEE
FT                   CPMVEAIRDEATVVPAFTAKHIDAALKSVDMVSRSLTWLDDQSLNAARAAVQRGVHVRV
FT                   ITYKHPELLPDARALTDAGVEVRSHEYSKDVRFMIVDGEFISFAIREPPKVTQPAYFGL
FT                   MIRDRGVCRNMLEYIFEPAWEDAEVVEKYRI"
FT   CDS_pept        complement(91357..92532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0103"
FT                   /product="mannose-1-phosphate guanyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0103"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60175"
FT                   /db_xref="GOA:D1YUQ3"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUQ3"
FT                   /protein_id="BAI60175.1"
FT                   /translation="MKACILCGGAGTRLRPLTFERPKPSIPILNKPSVGHLVEHLSKNG
FT                   FNEIVITLGYMGEVIEKYLGDGSLFGVDIKYVYEKEKLGTAGSVKNAEKYLDDGPFLVV
FT                   GGDHVLNLNLRELYDFHNHSGGLVTISVLSIDDPREFGIVDLDNNHIIHRFREKPGPGE
FT                   IFSNLASTGIYALSPEILDYIPKAKYDFAKDLFPKLLRENKKISGWLARGQWTDVGNPR
FT                   AYREAQRWMLENMPGTYIHGRLVNEGAKLNGPLNIGSNVSFGKHSVIVGPVYIGDNTSI
FT                   GDNVLVGPYTSIGDACHIGSDCRILSSYMYNGVKIGAGCSVSGAIMDNDITLGKNCTLE
FT                   NGVVIGPRAMIGNDVTVHSDVRIWPEVVVAANTSVSKDAMNEHFATDVNGS"
FT   CDS_pept        complement(92751..94322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0104"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains one Small GTP-binding protein domain
FT                   (IPR005225).; Belongs to the Roadblock/LC7 family
FT                   (IPR004942)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0104"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60176"
FT                   /db_xref="GOA:D1YUQ4"
FT                   /db_xref="InterPro:IPR004942"
FT                   /db_xref="InterPro:IPR006689"
FT                   /db_xref="InterPro:IPR014774"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUQ4"
FT                   /protein_id="BAI60176.1"
FT                   /translation="MINKNVKRTGIPTLDDCLKGGIPIGKTLLFYGKPLSESDVFIMQA
FT                   VYTNLADDEVCYYVASTYSPDVVRAGFKDYGWDTSKYARRFEIIDAYSPLVGASSGERF
FT                   SVKDPESIESYDETISGIIDMLSPGDMLVFSSLSALLDHCTCGGEEVLRYARKWNKMAV
FT                   IKGAIVIYNFVERDYDPGLMEHVKSGLCNAAVQVGGLGADMIYGHFFKTHACDWARRAD
FT                   RPTLFKVNRPGGITVHIPKLLVTGPQGSGKSTFVRTAATLSSGKCVSVDRMGTTIAGDH
FT                   AQLTIKGFSVDLFGTPGHRLFVKTLNAFAVDAMGIAVVIDSSEPDTEAALEILRTIRHE
FT                   GVPYIVVANKQDARDAMDVERIRRQLGLAEEEPVIGACSNNCHDVQRALEMLIGMVVES
FT                   PGSGREEKFGAIIDGLRRVRGVRAAAVVSTGGILKAAEIPGGIQGERVAFAASTILTTA
FT                   EAAAEDLGQGTLGRLLVDLDGRELMVMGADERNMLVLLAEHDGNPGPIYAEAVRAVDKI
FT                   KEIRGR"
FT   CDS_pept        complement(94319..94981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0105"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0105"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60177"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUQ5"
FT                   /protein_id="BAI60177.1"
FT                   /translation="MLLSGMHKYRLGLEELDAAVGGVSGGSGILVEGPPMGCKQAIVYS
FT                   LIKRGLEDGEGVILVPTMETGRNALAAYGDADNLRVIDCMSRPMGMAEAVSDNIKYVNG
FT                   PADLTGMGVWSGRLMDELKGRPVRLCVDSISTLLMYSHLQVIFRFIHLLNGRIQAAGGI
FT                   SIGVVDEGMHDEKTMASLRQLYRAALELKEADSYCCVRAVGLTPRPTPWARFEEVIE"
FT   ncRNA           complement(95105..95402)
FT                   /locus_tag="MCP_m0001"
FT                   /product="RNaseP"
FT                   /ncRNA_class="RNase_P_RNA"
FT   CDS_pept        95506..96126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0106"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains one AMMECR1 domain (IPR002733)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0106"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60178"
FT                   /db_xref="InterPro:IPR002733"
FT                   /db_xref="InterPro:IPR023472"
FT                   /db_xref="InterPro:IPR023473"
FT                   /db_xref="InterPro:IPR027485"
FT                   /db_xref="InterPro:IPR027623"
FT                   /db_xref="InterPro:IPR036071"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUQ6"
FT                   /protein_id="BAI60178.1"
FT                   /translation="MLSLEEGTLAVKTARRVIEEYVRTNKMPNVELPEAFKDLSGVFVT
FT                   LKQDGDLRGCIGYPYPDLPLSKALADAAVQAATQDPRFPRVRSAELDRISVEVTVLSEP
FT                   EPLKVKPVDRPGHLVIGRDGIIVERGLYRGLLLPQVPVEQGWGPEEYLEYGCLKAGLSP
FT                   DAWVDDVTKVYTFQGQIFQETSPKGEVVEEKIDTALDRCEVRK"
FT   CDS_pept        complement(96129..96815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0107"
FT                   /product="conserved hypothetical protein"
FT                   /note="Belongs to the Protein of unknown function DUF47
FT                   family (IPR002727)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0107"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60179"
FT                   /db_xref="InterPro:IPR002727"
FT                   /db_xref="InterPro:IPR018445"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUQ7"
FT                   /protein_id="BAI60179.1"
FT                   /translation="MSDPLHSMLDLFAKSPFKPLNEHAEKVKQTVLKMDGAVHAYVEGD
FT                   KAKVEGSYKQISELEHEADEVKHAIREHLPSSLMMPVDRTDILTFLKQQDDVANSAEMV
FT                   AQLLDMKMVAMPPAVKDILLKLEKEVLVTVEEHVDAAGKITTLLDSAFAGRHVKEVQAI
FT                   IDRVDGQKHNVDVLKLEAMKAIYEHEKELGPVGVFHLIELVQEMGWVAGHAESASDRLR
FT                   LIVAKR"
FT   CDS_pept        complement(96812..97816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0108"
FT                   /product="phosphate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0108"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60180"
FT                   /db_xref="GOA:D1YUQ8"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUQ8"
FT                   /protein_id="BAI60180.1"
FT                   /translation="MDPFLLMAIAIIVALLFDVMNGFHDTANAVATVIYTKALPPQVAI
FT                   GMCAIMNMVGPFLLGTAVAKVIATSIIPSEKLTIAIVVAGLMGAIIWDLVTWYYGLPVS
FT                   SSHALIGGLVGSGLAAIGLSGVKWGGLTNIVLALFISPVIGIVLGLVFMYLIGRFIISR
FT                   MGREQANAVFKKVQILSSAAVSLTHGSNDAQKTMGIIAMFVAVTYGTGTPVIEPWIIIA
FT                   CAAAIGLGTAFGGWRIIRTLGERIGKEELSPSQGFAAETATALTIAIGSHVGAPISTTH
FT                   VISSSIVGTVMAGGTGVLNKNVVLNILTAWLLTIPVAAIGAAISYFILTLVGI"
FT   CDS_pept        98076..99410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrC"
FT                   /locus_tag="MCP_0109"
FT                   /product="dihydroorotase"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0109"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60181"
FT                   /db_xref="GOA:D1YUQ9"
FT                   /db_xref="InterPro:IPR002195"
FT                   /db_xref="InterPro:IPR004722"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUQ9"
FT                   /protein_id="BAI60181.1"
FT                   /translation="MHELVVENARVPFGEDIVTCSIGIDEGRIARIAKILKGEQAYDAR
FT                   NMLVLPGVIDSHVHFRDMGQEEKEDWLSGSRAAIYGGVTAVVDMPNTDPPTFDEESFKI
FT                   KLTVAQNRSMIDFAINGGVSGNLKALPVLWRRGALAFGEIFMAKSTGGFSVDEQALKAA
FT                   LLEIKRLGATASIHAEDEALNAEKARELARDDSPDVYSQMRPPGSELNAVKAAVRLEHE
FT                   TGAAMHITHISTAKAVEALRGEPITCDVTPHHLLLNMRHWEKLKSYGKMNPPLRPLRDV
FT                   EALWKAARDGSIDVLASDHAPHTREEKAADIRSAPSGVPGVETMAPLILKEVADGRLPL
FT                   QRFIDMTTANPARIFGINNKGRIEEGYDADLIFVDMGARRVIRPYELHSKAGWTPYEGM
FT                   EAIFPHAVMQRGTLLLDGKEFLGRRGRGKFIRGRGYERKLPGRTS"
FT   CDS_pept        99760..100746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0110"
FT                   /product="putative cation efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0110"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60182"
FT                   /db_xref="GOA:D1YUR0"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR027470"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUR0"
FT                   /protein_id="BAI60182.1"
FT                   /translation="MLNSQGKEATIDRIERANQVKRSTARLSILSNTMLVIMKLAVGLA
FT                   IGSVSIISEAIHSAIDLVAAIIAFISVKKSSEPPDREHKFGHGKFEDFSGLIEAVLIFI
FT                   AAILIIREAALKLMGQGEELNTGLLIAGIAVMAISAAANWYVSNRLMKAAKATESIALE
FT                   ADAWHLRTDVYTSLGIFAGLVLIRLTGWKFLDPLFAIAVAVFIMKAAYDLTRRAASDLM
FT                   DTSLPASEEEKIKGIISDHYLQFASFHELRTRRSGSDRFMDLHLVVSKNLTVSEAHSLS
FT                   DHLEDDLRQAFPRSSITIHFEPCDEHCSKCECNSACRDSKCPEGTSE"
FT   CDS_pept        100790..101104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0111"
FT                   /product="conserved hypothetical protein"
FT                   /note="Belongs to the Protein of unknown function DUF167
FT                   family (IPR003746).; Belongs to the Conserved hypothetical
FT                   protein 251 family (IPR005228)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0111"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60183"
FT                   /db_xref="InterPro:IPR003746"
FT                   /db_xref="InterPro:IPR005228"
FT                   /db_xref="InterPro:IPR036591"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUR1"
FT                   /protein_id="BAI60183.1"
FT                   /translation="MAFQDAVRASSDGVLIDFEVSPGAKETRVPSGYNEWRRRIEARLK
FT                   APPERGRANEELIGELSALLGIPESRIEITSGARDSRKSVKVLGASREEVLRRLGGALQ
FT                   "
FT   CDS_pept        101149..101514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0112"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains one TOPRIM domain (IPR006171)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0112"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60184"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR022972"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUR2"
FT                   /protein_id="BAI60184.1"
FT                   /translation="MAARAEMGTTILVEGPRDRASMESLGITGNIVMTSQETLFNLAER
FT                   VSRQSADIIVLTDWDERGEEVARNAETYLKSNGSRPDMEPRKKLRILTKKEVKDIEGLH
FT                   GYIERLRLACAVKPQHY"
FT   CDS_pept        101940..103373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0113"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains one Toprim (topoisomerase-primase)
FT                   domain(IPR006171)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0113"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60185"
FT                   /db_xref="GOA:D1YUR3"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR020607"
FT                   /db_xref="InterPro:IPR034154"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUR3"
FT                   /protein_id="BAI60185.1"
FT                   /translation="MEESDTTKYVIHAHISAEGVVERPDVVGAVFGQTEGLLGADLDLR
FT                   ELQKTGRIGRIEVNITSKYGKSSGNILIPSSLDKIETSILAAALETIDRVGPCISKISV
FT                   TKIEDVRSSKRQQIIERAKHILTAMFDETVPESQELTDAVKSAVRVEEVTFIDNLPAGP
FT                   GVMESDAIIVVEGRADVLNLLKCGIKNAIAVEGTNVPQLVAEMSKKKTVTVFTDGDRGG
FT                   ELILKELLQVADVDYVARPPEGKSVEDLTQKEIIKALRSKVPVEQVVEVPPRRRNKQQQ
FT                   QQREENGKPEGRPEGRPEGRPEGRPEGRPEGRPEGRPEGREYPREQREGYQRPERQERG
FT                   ERGETPRRKSYRRMEERQERQERREPREQQPQEQQPEVKKAEPKEAGEFAEIMKDLAGT
FT                   LSAKLLDANKNVLQKVAVRDLANVLKETNGDVKSVVFDGVITQRMLDIAAEKNLEYLVG
FT                   VKMGSIVKQPAGVKVITTE"
FT   CDS_pept        complement(103412..103870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0114"
FT                   /product="putative acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0114"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60186"
FT                   /db_xref="GOA:D1YUR4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR006464"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUR4"
FT                   /protein_id="BAI60186.1"
FT                   /translation="MYFLITIRPFEFDDSRAVLDMEEAIFNEPNPLLYAMIESRPAEGF
FT                   IVAEEDGEVCGYLLGTLLMDEARILLIAVKDSRRRMGIGSRLVNEYIESVKGRASMIRL
FT                   EVRSSNLAAQTFYFKLGFRFIGMVSNYYRNGDNAYIMVRPMENFTLFL"
FT   CDS_pept        103913..104341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0115"
FT                   /product="conserved hypothetical protein"
FT                   /note="Belongs to the Protein of unknown function UPF0146
FT                   family (IPR005353)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0115"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60187"
FT                   /db_xref="InterPro:IPR005353"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUR5"
FT                   /protein_id="BAI60187.1"
FT                   /translation="MSIIGYEDIAGYIRARYPAGCKIVEVGIGGHPEVAELLQGDFDVV
FT                   CTDVGESGPEGVRYVRDDIFRPSMALYEGASLIYSIRPPIDMQDCIAEVAKSVGADLLI
FT                   RPFSSERTDLKKYFRNFRVVNYKSAVFFMYDNASPPGP"
FT   CDS_pept        complement(104307..105953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0116"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0116"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60188"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUR6"
FT                   /protein_id="BAI60188.1"
FT                   /translation="MPFHAREEAYGPPRAELYTREDIEEVFQCVSALCTCDRLSSPAKS
FT                   DPLFRPPFPAARARAFREGKEKSLISFHLRPDLRALYPVSTLAYYLSAPIVEDEDNYIA
FT                   FSPGETTDIPGAPELETWAGEALRRTFYLDCAVRYAAVSGGRLNGLDVEKLLRGRAEDI
FT                   FEMGPGERLMLYSGVRVVPGMPSWHMAAYLDPVPGSVEALPFLMRSLAAIYMPRAFPVN
FT                   ERAVVSMSVHEFLGKQKGPDTACPGGHVVLPSLREAGIQLWFSDGFPVDASKVSLRSIS
FT                   GKRRERKNKGTSIGIVCNEESMSGEVDAIIDALGDTEASVEILWDASVDKYAGAFARGF
FT                   DVLQVIGHCDERGLKCHDGFASVKDIEKNRTPMFFFNSCASYREAAQLVEWGSVCGVAT
FT                   LFRVLEEAAVDLCRDFYRMLGAGYTASVSLNAARECSALGKEYLLLGNGSFTCFEGDPL
FT                   KPFYRINSRPGGFSLGCTTGNVDKGYVVSSWSPGGRTMISDLGFETGPMKAEQLIAISE
FT                   KFQGYCIYGRRLYESVGDAALKALEDWRCRT"
FT   rRNA            106585..108054
FT                   /locus_tag="MCP_r0001"
FT                   /product="16S rRNA"
FT   tRNA            108223..108295
FT                   /locus_tag="MCP_t0004"
FT                   /product="tRNA-Ala"
FT   rRNA            108799..111677
FT                   /locus_tag="MCP_r0002"
FT                   /product="23S rRNA"
FT   rRNA            111852..111972
FT                   /locus_tag="MCP_r0003"
FT                   /product="5S rRNA"
FT   CDS_pept        112096..112569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0117"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0117"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60189"
FT                   /db_xref="GOA:D1YUR7"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUR7"
FT                   /protein_id="BAI60189.1"
FT                   /translation="MDLDDITKELDKAGKPGRLPERKPDFRVKQGMLKAYFLKLLAFVL
FT                   LIVVAGFGFLVVFNYRSLVMMLIVLVYLGLGIFLAFKLFVLTYTGWLYTLLLSAAGVFM
FT                   PVLALISRGFSNPTFTAGAFGIIALSLLSVLLLWWAKDLFGIKSYREIFVPYK"
FT   CDS_pept        complement(112582..114468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatE"
FT                   /locus_tag="MCP_0118"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase subunit E"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0118"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60190"
FT                   /db_xref="GOA:D1YUR8"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004115"
FT                   /db_xref="InterPro:IPR004414"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR029351"
FT                   /db_xref="InterPro:IPR042114"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUR8"
FT                   /protein_id="BAI60190.1"
FT                   /translation="MSLDYAKLGLKAGLEIHQQLATGHKLYCCCPPMDRDAKDSNFEFF
FT                   RYLRARESELGEVDRAAAEQAMARKKFLYKTYDTTCLVENDEEPPRPLNPQALDVALKA
FT                   SLMLNMMPVDEVFTMRKIVVDGSNTTGFQRTCFVSSGGFLETASGRVGVDTLCLEEDAA
FT                   SKVETKGDTVTYSLDRLGIPLIEIATAPDIHTPAQAREVALYIGTLLRSLSEVKRGLGT
FT                   IRQDVNVSIARGARVEIKGVQTLDLVEQAVESEALRQVNLLEIRDELLSRGARVDGEVF
FT                   DITDVLKDTASKVAKKALSSGGVALAVRLPGFRGLVGKEIQPGRRLGSEFSDRAKRAAG
FT                   VGGIFHIDELPNYGITQAEVDAVVQKLGLGPQDAFVMVADTKEKSGRAMDAVKIRAAEA
FT                   LKGIPEETRGALPTGSTEYMRPLPGRARMYPETDVPSVDVTPAHLEKLRGELPETLPEK
FT                   KARLMKEYGLNEELAGGVAYSAQSYGFEDVAKACGNPTLVARTMLGTTVELRREGVPVE
FT                   NLTEDQYKQLFKYVSESRIAKEAIPQVLAEMARGAPIDEAVTKLGLGGVDEADIRKIIK
FT                   EIVVSRKDFVREKGEASQGGLMGPVMAKLRGKADGKLISRILKEEIQAELKK"
FT   CDS_pept        complement(114465..115709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatD"
FT                   /locus_tag="MCP_0119"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase subunit D"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0119"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60191"
FT                   /db_xref="GOA:D1YUR9"
FT                   /db_xref="InterPro:IPR006033"
FT                   /db_xref="InterPro:IPR006034"
FT                   /db_xref="InterPro:IPR011878"
FT                   /db_xref="InterPro:IPR020827"
FT                   /db_xref="InterPro:IPR027473"
FT                   /db_xref="InterPro:IPR027474"
FT                   /db_xref="InterPro:IPR027475"
FT                   /db_xref="InterPro:IPR036152"
FT                   /db_xref="InterPro:IPR037152"
FT                   /db_xref="InterPro:IPR037222"
FT                   /db_xref="InterPro:IPR040918"
FT                   /db_xref="InterPro:IPR040919"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUR9"
FT                   /protein_id="BAI60191.1"
FT                   /translation="MADYKEGDMVRVSSKGREYSGIVMPSRSDKIVLKMKSGYNAGLSL
FT                   DGADVTVVERSPQPPKPARKAHPHNPGLPNISILSTGGTIASRVDYRTGAVSSQFTADD
FT                   ILDAIPELGDMANFNGRVLSMIFSEDMDASVWQNLARACHEEIKNGADGIIVTHGTDTL
FT                   SYTAAALSFMVRSPVPIVLVGAQRSSDRPSSDNAMNMICATAVSTSDIAGVTVVMHGET
FT                   SDDFCYVHRGTKVRKLHTSMRTAFQSVNVPPIARVDYATRKITPITGYVKRGEQELKLM
FT                   GDMETKCALVKFYPGMSPEIIDYYREKSFKGLVLEGTGLGHVSTKWLPAIEKAVSAGIT
FT                   IVMTSQCINGRICDRVYSTGIDLLKAGAIEGEDMLPEVALVKLMWALGQTNDMAQVKRI
FT                   MQHDYAGEIHWRSTV"
FT   CDS_pept        complement(115714..117201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argH"
FT                   /locus_tag="MCP_0120"
FT                   /product="argininosuccinate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0120"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60192"
FT                   /db_xref="GOA:D1YUS0"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR009049"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="InterPro:IPR029419"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUS0"
FT                   /protein_id="BAI60192.1"
FT                   /translation="MENKEDILRRGRLSAAKSEEINAFTSSLQADRWIFPSDIMVDKAH
FT                   TAMLARQGVIDKKDAAAILKALDSIGAGGVDAVDIPAFEDVHMAIESKLIKSVGENVGG
FT                   RMHSGRSRNDEVITCVRISARKELLGLMADLLELRKAIVGLASNNMDTVMPGFTHLQHA
FT                   QPTTLAHHLMAHASALDRDFERLLDAYKFININPLGSAAFASTGYPLDREYTTKLLGFD
FT                   RPMDNSMDGVSSRDFILTTISAIAILETDLSRLADELVLWSTPEFGFVELDDAYASTSS
FT                   IMPQKKNPDILELVRGRAGTVIGHMVAAFTIVKALPYSYNSDLQEVTPQLLRSFEISRS
FT                   SVRIMTGAVSTLKINNEEMARKSTMGFTTATEIADTIVRATGLPFRTAHGIVGRLARGD
FT                   GNPSLADVDRASMDMIGKKLSRMGLTEKALEEAKDPLKNVRRRSILGGPAKAAVTSKIA
FT                   AEKERLKADAKAASGLAKKLAKAEGGLAKAVSDIIKG"
FT   CDS_pept        117292..118470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0121"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains one Radical SAM domain (IPR007197)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0121"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60193"
FT                   /db_xref="GOA:D1YUS1"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR040088"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUS1"
FT                   /protein_id="BAI60193.1"
FT                   /translation="MLSMAVFSEVYDEDNDKVFVIRGTIEVRIPHNFYSQLKRKYSDEE
FT                   IVSMQEPKILRHHHTKRELVYVTKESGLPLIGHTAFGLIDRGTNLIQVRPVSGCNLNCI
FT                   FCSVDEGVSKSRRTDYIVDTDYLVEEFAKLAALKGDDVEAHIDGQGEPFIYPYMVELLE
FT                   KLRKVPHVKVISAQTNGMLLDPEKIRAMEGLLDRINLSISSMDPRRGRMLAGTNLYDVE
FT                   HVKEVARAVAASDIDLLLAPVWVPGFNDEDIPKLIEFGLEIGAGKRWPGFGIQNYVRYQ
FT                   FGKKVRGRPMKFSEFFKRLEEYGKQYGLNLKLTPADFGIHKAPGLPRAFRRGERVKLEL
FT                   VAPGRVFGEMLAVSRGRVIGVLTDRPAGSTVFAEITRTNDNVYVAVTAESRL"
FT   CDS_pept        complement(118448..119443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0122"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains one Protein kinasedomain (IPR000719)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0122"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60194"
FT                   /db_xref="GOA:D1YUS2"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUS2"
FT                   /protein_id="BAI60194.1"
FT                   /translation="MGEYGRAPDVLERAGHAVLNNFFVEAALVFLISVLYISAQGADRL
FT                   LGTGFRRTLLDWMQAVSRDRLNFLRKAQIRHVFKKKYGMKKIKIRLAGGSYWLSIPCIV
FT                   KGVCKKTRSERKFLAKVMNERSALKHKYMTLFRNIGVIAEGVDLKFDDYHCGLEMGQYE
FT                   RLCLEKLRNASVNAPKVYGLHKMGGADYMLVMEYIDGKPLSKAEMSGEIMDQLFLILKK
FT                   MRENGILHGDVKLDNFMLSNGRVYVFDCLKIDRSGIEEAAAFDLACLLCALSGRLPPGE
FT                   VVKNARKFYSPSDLGRAAGMVDMALYKADLNLSDDRKKELKESLKALTLP"
FT   CDS_pept        complement(119446..119580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0123"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0123"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60195"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUS3"
FT                   /protein_id="BAI60195.1"
FT                   /translation="MDPLKLSMDWTVGDLEKPQILVDDVWGDALPGSFEIHYGICPVR"
FT   CDS_pept        119753..119920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0124"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0124"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60196"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUS4"
FT                   /protein_id="BAI60196.1"
FT                   /translation="MGGMMSVITAEVLQELMSLKKSDREKFLDRLEELALSSMDVLLNY
FT                   KKFKEYPANI"
FT   CDS_pept        119927..120316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purE"
FT                   /locus_tag="MCP_0125"
FT                   /product="phosphoribosylaminoimidazole carboxylase
FT                   catalytic subunit"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0125"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60197"
FT                   /db_xref="GOA:D1YUS5"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR024694"
FT                   /db_xref="InterPro:IPR033747"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUS5"
FT                   /protein_id="BAI60197.1"
FT                   /translation="MADVAVILGSASDRAIADRAVEVLSKNNISFDLQVLSAHRNPDEL
FT                   DVYVKRSDAKVYITIAGLSAALPGVVASKTSRPVIGVPVSAKLGGLDALLSIVQMPKGV
FT                   PVACVGIDNGDNAAHLAIRILGVGQ"
FT   CDS_pept        120313..120513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0126"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0126"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60198"
FT                   /db_xref="GOA:D1YUS6"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUS6"
FT                   /protein_id="BAI60198.1"
FT                   /translation="MKAKDAKIAYIALAFLIALCAIVASYLRQYYIALGLIVMASAIML
FT                   GGAILVSYMYKMEKAEELKKI"
FT   CDS_pept        complement(120517..120750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0127"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0127"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60199"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUS7"
FT                   /protein_id="BAI60199.1"
FT                   /translation="MYTPIAIHKNELVVIDSMDTFSRYFCLAKKQKMTPLVTDEIVATP
FT                   EELEEERVGGFEEEEHAASVDGGSPDLDDDDI"
FT   CDS_pept        120934..121983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0128"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0128"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60200"
FT                   /db_xref="InterPro:IPR026935"
FT                   /db_xref="InterPro:IPR032369"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUS8"
FT                   /protein_id="BAI60200.1"
FT                   /translation="MKKILDGFVHRRGMHCDTTALRDVFEYSGHGLPEAALFGIGEGLG
FT                   FYYWKSRNLRHPAIGGRIKPLELDRRACRNLGVGLKINTSTSPKRAYRVMKAMLEGGRP
FT                   VMMRADIYYLEYRRTRHHCGAHNIVVAGLDEASDTVYVADRIADGLIELPVSRLIDARA
FT                   SLHKPFPPRNLWFEFAFPGSLSLDGSRVMGAIGMNAVEMLNSDVRSVGIGGIYYLASCI
FT                   HQWKADFNKRDLEIACNAAYGSIEANGTGGGLYRHMYAEFLEYARGLTGVQELESIAGG
FT                   YHQAGRMWTQAAKILKDVPCGCASLAEAAVAVEEIAAKEHELLTELLCVANLCCKNNGK
FT                   TSIKTLEKD"
FT   CDS_pept        122396..125197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0129"
FT                   /product="putative ATP-dependent helicase"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0129"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60201"
FT                   /db_xref="GOA:D1YUS9"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR013701"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR017170"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUS9"
FT                   /protein_id="BAI60201.1"
FT                   /translation="MKNCFELLDVRIRKALASMGFTEPTETQEKAIPAIMSGDDVLVIA
FT                   PTGTGKTETAMLPALHGVLNGEGGEGFKVLYITPLRALNRDMLKRLTQWSKELGVSIEV
FT                   RHGDTPMHERRKQALKPPDVLITTPETLQAIFMGLRMRNHLKTVKYVIVDEVHELASSK
FT                   RGTQLSIALERLAKYADFQRIGLSATVGAPEEVAHFLGGVDRKVRIVQVSIEKTLDFHV
FT                   TVPKVSEEDKKLARKLLTDPDIASQIREMIALIHRNRSTLMFVNTRQSAEAIGARFKRL
FT                   GESIAVHHGSLSKEARIEAEDAFKDGRVPALVCTSSMELGIDIGDIDHVIQYMSPREVC
FT                   RLVQRVGRAGHRVGETSTGTVIAINEDDAAEAWAITRRAAAGQIESVGLYERPYDALAN
FT                   QVCAMALEYGDVHSNRVYDLVRKAYPYRELSRKEFDLVLKQLVEERLIFVNEAGIISRK
FT                   GKTRTYMYENLSMIPDEKRYQIQDVISGRFVGTLDEAFVINMDLGAVFITKGDMWRIVE
FT                   ITEDRVRVEPVENPQAEVPSWTGEEIPVPFAVAMEVGAIRRAVEEMKDGPDQEIVDSLM
FT                   KRYPTDAYTARKLVEYVKRQIGDSYLVPTDKRVVVEDEQRTIIINACFGHKVNETLGRV
FT                   ITALLASRFGSGVAMEIDPYRIKLELPKRIRATDITKLIMDIDPLFVEPIIEKTLKNTM
FT                   LLKWKMVHVARKFGALSRDVDYERISMDKLLKIFEGTPMYEEAVREIFHDKLDVENARK
FT                   VLTMLRNGEISLAAGRLSFIGGSGFTGGRELMAPETADRSILMALKDRIMNDHVLLFCL
FT                   NCKQYSAKKRVEDVEDPPVCPVCGSKLIAALKPWERDEMELAKHPEKLKAEDDKIKVKR
FT                   VYRNANIVLSHGKKAVIALASRGLGPETASRVIAKLKEDEDDFYRDILRAERDYVRTRR
FT                   FWV"
FT   CDS_pept        complement(125232..125798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tbp-1"
FT                   /locus_tag="MCP_0130"
FT                   /product="TATA-box-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0130"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60202"
FT                   /db_xref="GOA:D1YUT0"
FT                   /db_xref="InterPro:IPR000814"
FT                   /db_xref="InterPro:IPR012295"
FT                   /db_xref="InterPro:IPR030491"
FT                   /db_xref="InterPro:IPR033711"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUT0"
FT                   /protein_id="BAI60202.1"
FT                   /translation="MSKAEEAKKTITIENVVASTAIGQEIDLKSVTLALEGADYDPEQF
FT                   PGLVYRTKDPKTAALIFRSGKIVCTGAKSIEDVDRGLKKVFKKMDSVGIKVDQNPEITV
FT                   QNIVASADLGSVLNLNAIAIGLGLENIEYEPEQFPGLVYRLDHPKVVVLLFGSGKLVVT
FT                   GGKKPKDAEEAVDRIVKELEGLALL"
FT   CDS_pept        complement(126014..126640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0131"
FT                   /product="putative small neutral amino acid transporter"
FT                   /note="Belongs to the Multiple antibiotic resistance
FT                   (MarC)-related proteins family (IPR002771)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0131"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60203"
FT                   /db_xref="GOA:D1YUT1"
FT                   /db_xref="InterPro:IPR002771"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUT1"
FT                   /protein_id="BAI60203.1"
FT                   /translation="MNFEFFISVVISIFVMADPFGNIPIFLGLTGGMSGTERRYVITKA
FT                   SVIGSIILFIFALVGKPFMDVLDISLNSLRIAGGILLLLIAFDMLLGSETRAKKTDGPH
FT                   EEEDFDSIAVTPMATPLIAGPGSMAVTMIYMNEAAGFDKLWILAAILIAMLASWIVVVN
FT                   SDLLYSFIHKDGARVLTKVMGIVLAAIATGMMITGIGGSFPALLG"
FT   CDS_pept        126783..128288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0132"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains one CBS domain (IPR000644).; Contains one
FT                   Protein of unknown function DUF39 domain (IPR002708)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0132"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60204"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002708"
FT                   /db_xref="InterPro:IPR016426"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUT2"
FT                   /protein_id="BAI60204.1"
FT                   /translation="MVRRTIEEINDKIRDGSVNVVTAEEMTTLAQELGVKEAAKQVDVV
FT                   TTGTFGAMCSSGVFFNFGHSDPPIKMQKVWMNDVEAYTGIAAVDAYLGATQLSETKGME
FT                   YGGSHVIEDLLQGKEIWLKATAYGTDCYPRKRIDTSITLDDMNTATMVNPRNAYQKYNS
FT                   ATNCSSKTIYTYMGTLLPNCGNVAYSGAGVLSPLSNDPGYRTIGIGTRIFLGGAQGYVV
FT                   SEGTQHSPSGGFGTLMVTGDLKKMSREYIRAAAFYKYGTTMYVGLGIPIPILDDEIAKA
FT                   TAVSDADITTTVYDYSTPRRNKPALRDVTYEELKSGMIDLNGKEVRTSSLSSFYKARQV
FT                   ASELKAQIKKGKFFLSLPAQTIQAQGSSKPMKQTLEMPLIKDVMAPVATITLGFSVHEA
FT                   AKKIIQDKFNHLPVVDENSRLVGIVTSWDVSKALALSKSDKLAPIMTRNVITVAPDDPA
FT                   DLAVRLLEKHNISALPVIDKDKKVLGIVTGEGLSKLISRGVQP"
FT   CDS_pept        128285..128674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0133"
FT                   /product="putative ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0133"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60205"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUT3"
FT                   /protein_id="BAI60205.1"
FT                   /translation="MKLLLRFNPEIIKKPIIAETVLETGILLDIERARVEGPKGEIVLN
FT                   VPDDNCRQVVDILKRKKVDVVRLDVPITKDEENCVHCGACVAVCPVGAIAFEYDWRVRM
FT                   DEKACVQCGNCVTACPVKVIRLSDN"
FT   CDS_pept        128676..129389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0134"
FT                   /product="conserved hypothetical protein"
FT                   /note="Belongs to the Protein of unknown function
FT                   DUF375family (IPR007183)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0134"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60206"
FT                   /db_xref="InterPro:IPR003374"
FT                   /db_xref="InterPro:IPR007183"
FT                   /db_xref="InterPro:IPR037456"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUT4"
FT                   /protein_id="BAI60206.1"
FT                   /translation="MLTRKYQVKETIVTVTADEQYHPVCLASIGRSRSDLERHILEDPF
FT                   FKVTFEPYECPPGAPEVVKRMVDAASRVGVGPMAAVAGTIAWLALEDMVKAGCTYGIID
FT                   NGGDIALINDRTVVVGIYAGESPIKGFGLEIGPRDHILGVCTSSATVGPSISLGNSDAA
FT                   LIISEDVSLADAAATALGNRIVDKESLATAFDFLKSIPEVSGAIGIIGDRMATYGRLPE
FT                   IVRADVDQGKITKGD"
FT   CDS_pept        complement(129386..130087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0135"
FT                   /product="putative glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0135"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60207"
FT                   /db_xref="GOA:D1YUT5"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUT5"
FT                   /protein_id="BAI60207.1"
FT                   /translation="MDISVIIPTYNEEKYIETCLKSLECQDFPGNYEVIVSDGSSTDGT
FT                   VDIAGRHADRVIVDRKDTIAYGRQAGAHAAKYSILAFTDADTYIPSDWLSNLAASLEDC
FT                   RVVGAHGKLLPLDGNRIENDFCNYVLPPYSQFMVNINKPSVPGSNFAVRRKAFNKVRGF
FT                   NTKLVTAEDVDLCNRIKKLGKFVYNPDAVVYVSTRRVREWGYLKMLSFYTSNTIKYHTK
FT                   GTAGKLFEPIR"
FT   CDS_pept        130252..131016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0136"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0136"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60208"
FT                   /db_xref="GOA:D1YUT6"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUT6"
FT                   /protein_id="BAI60208.1"
FT                   /translation="MERRSLYVHAAAAIVLLVLLIVSVVEYYDITSLDRQLGVYQKQQQ
FT                   ELSRVFAVEHALDMDAAQRAWIAANQQEYISLKNAGITVRADSVVTGSYALILDLRDPS
FT                   GTRVDSTPGDVSPGAAVVYLGQYYDENMTRVPGWEASYTVNTTTHAVSGLTPLLIQNIA
FT                   YEYYTSSLAPDIYLSLGVSAGSITGSTARSIDCSRLDTGDWMDVTEHKYSLKNVDIREY
FT                   LLIKTYVNATTQGVTGVDISKPYYDSVTGSNY"
FT   CDS_pept        complement(131025..133001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0137"
FT                   /product="conserved hypothetical protein"
FT                   /note="Belongs to the Protein of unknown function DUF460
FT                   family (IPR007408)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0137"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60209"
FT                   /db_xref="InterPro:IPR007408"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUT7"
FT                   /protein_id="BAI60209.1"
FT                   /translation="MAAQTTQTIFGVDIVKGSSRSREAPRYAVAVLNGSVEKYSSVSRF
FT                   KLLRLIRQYRPGILAVDSITELAENRKELVRFLKRLPPEVKLVQVTGNEHQEPLTKLGR
FT                   DNGITFNPVMPDEEAFAAACLASMGVGYIVSAFEDRTVIKVSRGRSLGRGGWSQNRYRR
FT                   KVQGKVREKVREIEAKLKDRVYDMTITEGFGGYVNGTFIVNARRSDLGIHSSREEDVQV
FT                   TVTSVEKEAIEFIPLQRRKRDYIIVGVDPGTTTAVAILDLNGRLVEVTSSRVSSIPDII
FT                   EHISEKGRPVVIATDVVPPPGAVEKIKRAFKAVLFTPNERIPVEEKVRLARPLGYSNDH
FT                   ERDALAAAVKAFNTYKNKFAQIDKKTPSHLDANDVKALAIEGKPIEMALDMLTAPPAPE
FT                   RPRGAILPETEPDAKLEELRARLKQKEEQVENLRSYMGDLRRDMKHLELRVSSQDRIIR
FT                   NLKSKGIDDVRRTREITIRDGEIARLKKESADLKRRNSELQSNMDRLKHIRAMEFRGDK
FT                   APVKVVESLSKEAVLNCDRKFGIKAGDVIFVRDAGGGAEAAAMLAERGVKAVIKGTPMS
FT                   HMAEERLFRAKVPVLPRDDVPLKFVDGYAVLDPGRLEAAIEKWKAYAAGVEKRGREEKL
FT                   LGIIDEYRAKRAREYRNDSKASD"
FT   CDS_pept        complement(133197..133976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0138"
FT                   /product="CpmA homolog"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0138"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60210"
FT                   /db_xref="GOA:D1YUT8"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="InterPro:IPR039476"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUT8"
FT                   /protein_id="BAI60210.1"
FT                   /translation="MTGMDAREVLEKLAAGEIGIDMAERLLRLDYVERIGNHTVFDMSR
FT                   ECRSGIPEVVYAEGKTPEKAGEIVERVIAKRGMLVLSRASEKYHDEVVRRIGEDGVMYR
FT                   PEARMIVIDRRGCVQEHIGKIGVLTAGTSDIPVAEEAATIAEVMGCTVIRGYDVGVAGI
FT                   HRLLDPLKDMIRQDVACVVVVAGMEGALPSVVAGMVGVPVIGVPTSIGYGLGAGGMGAL
FT                   TTMLQSCAPGLVVVNIDNGFNAGATAALIAKMKHGKK"
FT   CDS_pept        complement(134028..135056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0139"
FT                   /product="polyprenyl synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0139"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60211"
FT                   /db_xref="GOA:D1YUT9"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUT9"
FT                   /protein_id="BAI60211.1"
FT                   /translation="MVDTVTPILEEYSAYTDRQMRAVLNNRKRVGRLYDMMMYHLGWLD
FT                   EDFRECRAPRGKSLRSTMCLLACEAISGDSNKALPAAAAVELLHNFSLIHDDIEDGDVK
FT                   RRHRDTLWKLWGVPQAINTGDAMDIAANLSLLDLDGTVEPGMMVDIIRIFNQTVIELCE
FT                   GQYLDMDFQGRSDVSVGEYITMVSGKTAALIEASTAIGAMVATGDRDVISRFGTFGRKI
FT                   GIAFQIRDDILGIWGDPESTGKSAKNDIRNKKKSLPVLYAMEKSRHRAELKTIYAKEQL
FT                   TDGDIARVFEILTEAGALEYTQSEAQRYKDEAMAQFDGLKLHKGPMDKLRTIGRFLVER
FT                   DY"
FT   CDS_pept        135562..136377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0140"
FT                   /product="putative cell division ATPase MinD"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0140"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60212"
FT                   /db_xref="GOA:D1YUU0"
FT                   /db_xref="InterPro:IPR010224"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUU0"
FT                   /protein_id="BAI60212.1"
FT                   /translation="MPVKAPVEKAAKRAVVIAVGAGKGGTGKTTFSINLGVALAEMGRR
FT                   TILMDADASMSNLSTYMGIEPHTLKTTLHEVLAGEAEPDKAVYKAFNDNLRVVPSGLSI
FT                   EGFLKMDRSLLKDVIEYFSRDADFIVIDTPAGYNKELALSLAASDHLILVLNPDEGSMT
FT                   DGLKVQEMARILDVNILGIVLNRYDMKNPFFSRSQVEAHFGSPVIAMLPEEPGVRRKDK
FT                   VPSVLAAPSSRMAAEVYHVAELLAGQKAPSESTSFVSRLMLALFNTAAI"
FT   CDS_pept        136400..137260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0141"
FT                   /product="conserved hypothetical protein"
FT                   /note="Belongs to the Protein of unknown function DUF72
FT                   family (IPR002763)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0141"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60213"
FT                   /db_xref="InterPro:IPR002763"
FT                   /db_xref="InterPro:IPR036520"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUU1"
FT                   /protein_id="BAI60213.1"
FT                   /translation="MILVGTSGWSYDDWVGEFYPQGLGRDKWLEFYAKYFRTTEINSTY
FT                   YSFPSPAVVQSWIAKASKLEAFEYSLKMPGRVTHESLLLDTGHALEFEARVLAPMRDAG
FT                   CLGAVLLQLSPYLMLHDKGRKTEHPERLKALLERLDTGRFEYAAEFRHRSWLENGALAG
FT                   DTVDLLRERNVAACAVDGPSMPPVVENTAGHAYIRFHGHNDDIWYRKGPGDGRMNRYDY
FT                   NYRPEELQPWKKRMEPLQGGKVRAYFNNHPHANAARNAKLFESIMGVESVPLSIQKQSD
FT                   LSSFF"
FT   CDS_pept        complement(137264..137986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tatC-1"
FT                   /locus_tag="MCP_0142"
FT                   /product="putative sec-independent translocase protein
FT                   TatC"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0142"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60214"
FT                   /db_xref="GOA:D1YUU2"
FT                   /db_xref="InterPro:IPR002033"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUU2"
FT                   /protein_id="BAI60214.1"
FT                   /translation="MARFKKGILFLALYVLIIATISFPFTGMIIERMRDDLIINVVPDS
FT                   FHLIQTQPLELMMLELKLSFIIGILAALPIVFFYGYRYLSRLKLGQRFKINKLMVVLVA
FT                   GLAVVLFLVGCAYSYFLMLPLVFQYLINSATDAGVASNWRVSDFVNFAMLTTFVFGLVF
FT                   ELPLVMNALARSGLVPAEIFKKYRRHMWVIILIVAALVTSPDVITQVMVGVPLIIFYEI
FT                   SLFIMRFTVPKAKVAPQA"
FT   CDS_pept        complement(138059..139237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0143"
FT                   /product="putative glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0143"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60215"
FT                   /db_xref="GOA:D1YUU3"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUU3"
FT                   /protein_id="BAI60215.1"
FT                   /translation="MMRVCLVNALFHPFSGGIEKHMYELSRELVRQGVDVTVVTGRING
FT                   LPEREDIDGVDVRRVPCRAVRAPLIYPPPLVLSPLFYFRLGRLDDELGFDIIHLHNRFF
FT                   IDFNMASVYARLKNKPFVMTAHNPRPKHVASAAGTLGVAYDWLIGRWPFILADRVIAVS
FT                   DWTKHDIAKYGVDKSKIVTIHNGINVDSYRPRGGGRARERYGVRGNMLLFVGRMVPQKG
FT                   IGYLLEAMPCVLRTHPGTKLVLVGRGSLCDGLRRRARELGLDGNAVFSGYVEEDELKEA
FT                   YGACDLFILPSTVEPFGIVVAEAMASGKPVVCTDSGGVREIVDDGSSGFVVPPGSPEAL
FT                   AEKINTLLSDARLRADMGLKGREAAERRLDWKLIAEKTKRVYEDVLSRRANP"
FT   CDS_pept        complement(139256..140473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0144"
FT                   /product="putative glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0144"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60216"
FT                   /db_xref="GOA:D1YUU4"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUU4"
FT                   /protein_id="BAI60216.1"
FT                   /translation="MKVCLVNALFHPFSGGVEKHMLELSRELVKQDVDVTIVTARIEGT
FT                   PAYEEMDGVKVHRVPCLSVKVPGLYPPPFVMSPFFALYLKRLDDENGFDIIHLQNRFFV
FT                   DFDTAALYARLKKKPFMMTIHNARPLGISLPISVFGSAYDWAIGRWPFAMADRIIAVSE
FT                   WVKYDIARYRIDERKIVPVHNGINVGSFRPTAATNVRKQYGIDGPMLLFVGRMITQKGV
FT                   PYLIDAMPLVLEKHPDTKLLLVGRGNALESLKKKVGAMGLEKSVIFSGYMTEDMLKETY
FT                   GTCDMFVLPSVWEVLPIAILEAMSSSKPVVCTNAGGNAELVKDGYNGYVVPMRSPEALA
FT                   DRINDLLDDPEKMKSMGCAGRRRAEDEFDWKLIASKTKHVYEDLLMEKKNGGRKNNRYY
FT                   PHVNVT"
FT   CDS_pept        140565..141503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0145"
FT                   /product="GCN5-related N-acetyltransferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0145"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60217"
FT                   /db_xref="GOA:D1YUU5"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUU5"
FT                   /protein_id="BAI60217.1"
FT                   /translation="MASRMLKEGLKVARGMADDIGPVFAEAARSLPIADQAERSYISNL
FT                   IERARQGDLGIYTLLLGARSVGVICYKTLDGDAELVFGHAGGSEAYFLRSVAEGLFSEG
FT                   IHTVRSNFNWPAPRGFISAARDMGFVVTERMGMCLSPAPVKPAYDGFDILPWKDDYAGE
FT                   VCRIMYESQAPADIPVYPMLARPEGVRALMDSVMAGKHGRFLRGFSYVAWAGGRPVGFI
FT                   ISTMLSDGSILILDLGVDRGHRKRGIGGALLDRLSGDAYREGHGLIVLAVTSNNYDAIR
FT                   LYERKGFKVNGYFRQHVLSKIATPSGGTPSP"
FT   CDS_pept        complement(141472..143769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0146"
FT                   /product="putative ATP-dependent helicase"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0146"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60218"
FT                   /db_xref="GOA:D1YUU6"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002464"
FT                   /db_xref="InterPro:IPR006166"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039686"
FT                   /db_xref="InterPro:IPR041663"
FT                   /db_xref="InterPro:IPR041755"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUU6"
FT                   /protein_id="BAI60218.1"
FT                   /translation="MPEYVSHPLIKPDTVSSREYQLTLARTALERSSLIVLPTGLGKTI
FT                   IALFVMIERLGDGKKVLMLSPTKPLVEQHAAFLRRVLTIDPEQVAVFTGSVAPEQREEV
FT                   WKRSRVVVSTPQVIENDVLMKRFDLRDVSLIIFDEAHRATGDYAYVYIAKKYKEQSSDP
FT                   LVLGITASPGSTPEKINEVKQNLSIEHVELKTENDPDVSPYIYEKDVEWVKVDVPDKAA
FT                   EIKILLDSLMDDRLDRLRAMGVLYNTHLNKKELLMLQAKLQASISRGGSPESYKAVSIL
FT                   AEIMKIEHAVDLIQTQGVVPLKKYFDRLKEEAGSKGGSKATKRLMQDARLAGAIRVAGT
FT                   ADEVNPKTEKVKEIVVEQLKEKPSSRIIVFTNFRDTAEFVSRELAAVEGVKPVRFVGQA
FT                   SKLNDKGLSQKKQVEILDAFRAGEFNTLIATSVAEEGLDIPSTDLVIFYEPVPSEIRSI
FT                   QRRGRTGRNAVGRVIVLISKGTRDEGTYRVSQAKEKKMYRTMNDMKDGQRMSDMLENGG
FT                   APAKIPETTPPLPAQGQTSLGEFGPKAGAKEAIEIYVDMREMRSAVVKNLEDMKASLSI
FT                   RTLDVGDYVLSDRVCVERKTTDDFLDTLFGADRSLFEQIIAMKHAYMRPLLLIEGDGLY
FT                   TKRRISPNVIHGVLASIAVDYGVTVLFTANEAETASFLFSIARREQAERKRSVNPHAQK
FT                   ASHTLAERQEYLVSAISEVGPVISKNLLRHFGSVKNIVSASKEELMEVDKVGEKTAAKI
FT                   REVMDSEYRPRE"
FT   CDS_pept        complement(144197..144865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0147"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0147"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60219"
FT                   /db_xref="GOA:D1YUU7"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUU7"
FT                   /protein_id="BAI60219.1"
FT                   /translation="MSLDWGVLAKEASRKSVHMAGFLIPVAYYFFLSRELLLILLGAGV
FT                   LGAGILELIRLSGVPLFPKVLLRDHEKKGLVGGYFYALTSSFLAVLLFDKPVAVAAMLF
FT                   LTLGDGITGLAGAALTMLAGPKEADKRKYDTDGRTLPEELWYALTHPKSPILMAVMLVV
FT                   CGAAGLALYPSLSFEMIAAGAFGAMAADAFPWRIFGLTVDDNLSIPLVSGCLMSLAAIV
FT                   "
FT   CDS_pept        complement(144867..146609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyS"
FT                   /locus_tag="MCP_0148"
FT                   /product="glycyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0148"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60220"
FT                   /db_xref="GOA:D1YUU8"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002315"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR027031"
FT                   /db_xref="InterPro:IPR033731"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUU8"
FT                   /protein_id="BAI60220.1"
FT                   /translation="MDTYDKVFELAKNRGFIWPSFEIYGGASGFYDYGPMGATLKRKIE
FT                   DAWRRLYCVGEGFYEIEAPTIGVEAIFEASGHVGGFADPMTTCQKCKESFRADHIIKGV
FT                   MEIPDGLKKEQLTEIIKNKNIECPECGGPLGEVYDFNLMFNTWIGPGQKKKGYLRPETA
FT                   QGMFVDFPRLLRFYREKLPFGVTQIGKSYRNEISPRQGVIRLREFTQAEAEVFVNPKDK
FT                   NSHPNFAAVRDMVLSLYDEDCQLNNKPPVPMTVGDAVAKGTIANEYLAYYVALTNVFLA
FT                   TVGIDPKRLRFRQHMRTERAHYATDCWDAEVLLERFGWVEIVGIADRTNYDLTAHQKRS
FT                   EVDMSVFVPFEKPMKVTRTIVTPDMKVIGPKYKGKAGKIMAALKAMKQEELSKPEVVLN
FT                   IDGEDIVIPSSLFEHKTVEEDVSGENVLAHVVEPSYGVDRTLYSALEHAYGEEIVKGEE
FT                   RIVLRLARSVAPITAAVLPLLSKEPLAGKARAIALDLKEKGFFIEYDESGTIGKRYRRN
FT                   DEVGTPFSITIDFDTMEDDTVTIRDRDTMSQVRVPVKDLSSVLGELLASDRPLTDFGKK
FT                   VAAE"
FT   CDS_pept        complement(146788..147213)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0149"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0149"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60221"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUU9"
FT                   /protein_id="BAI60221.1"
FT                   /translation="MAKISPSEELVVNIRELCGDTIANDYVNMMNQVSQPRFSAIKNTF
FT                   KDSTSVFIMACANSNILYKDLREAGLKLGIASVETFSRRIYEMRRAGLIYTESMHNKGP
FT                   GRPKLRLRFNPNAFKEMFNMDPGTLLTAHPEEHKVVI"
FT   CDS_pept        147471..147833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0150"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0150"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60222"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUV0"
FT                   /protein_id="BAI60222.1"
FT                   /translation="MARKVDVKLFGYYPEAGCSECSNYSSCGGQAHRQDDGTVKALLDA
FT                   YGDRVEVSLVNVFSDVMKGYPEVADCIRKNGLRVPIVTVDGKLKLFGSEATLDAIRREV
FT                   DLELNWGPLSFLSRRP"
FT   CDS_pept        147914..148921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0151"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0151"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60223"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUV1"
FT                   /protein_id="BAI60223.1"
FT                   /translation="MDATRRLGDMGFTALRRKTSGGKCKPHLSLSFRAGGNDLTFGIDT
FT                   TRLSRNDDQHFLITHAHTDHYGKSAMLSKKSIASDKTAVALELRHDLRFEGTRFKVGDS
FT                   LDVGGVKVKTFNTYHSIGSTAFSWENEVGIKTLVTGDIKDYRDLPKCDLLVMEATYGNP
FT                   GDLSCIFQDDYDAFEAALGERRVGFGAYSFGKAQRAVSLIRELGDERPIEMDRSALTLT
FT                   RHLLGDEAGEIGRLGEFDGGLCITSPWSLDRLPYGMKKYVLTGQHYYDHPCICLSDHID
FT                   FNGLRELVEKVDPKFVIVYHPEMGNSISFAGFLNRNGREACTLADLSPVRQTTL"
FT   CDS_pept        149066..149893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0152"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains one Cna B-type domain (IPR008454)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0152"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60224"
FT                   /db_xref="GOA:D1YUV2"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR026371"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUV2"
FT                   /protein_id="BAI60224.1"
FT                   /translation="MKRIGLIVLAMVAIAFFVPAGMAQSTQVVNINGYVYSGALPMGGA
FT                   KVQLYSWDGKNMGNSPMKTVTTKDGSTGTGSFSFTNVPYDSSKTFNYVVKAELNDRTAY
FT                   ALVHIVPAQKAGEAAKAEAIVLDLAMDSWVTDLTGTVQSGNLLDRAIGVQGANVTIYER
FT                   NQTDGTVLPGVKATAVTDMNGKIEIKNLPYGLYQAVVTASVSGKNYQEKVDFTAYQQET
FT                   HINAIMSQLMLATPTPTPTPKPSGSGGLFGIPGFEAVLALVALSGTALFLRKR"
FT   CDS_pept        150010..150693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0153"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0153"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60225"
FT                   /db_xref="GOA:D1YUV3"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUV3"
FT                   /protein_id="BAI60225.1"
FT                   /translation="MADDEKFLVVPLGKKSKAITQTVSNDTAMEIMELLADGPMSTSGV
FT                   AERLSIPLTTAQYNIEKLMEAGLVRIARTKYSEKGREVKLYEAMNRAIIILPGKSGAGA
FT                   VMDALRRYIIVLPIVAVASVLVEYLVPLTQNSYSPVLDEASKSAGGTYLMNSAASPTAS
FT                   AVPVVAYPPPVPTAEVARSVWDQASQSVVPIVQHTGLWFFAGCLMVILLLVVLEYARYS
FT                   KKPKK"
FT   CDS_pept        complement(150887..152308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0154"
FT                   /product="putative phosphoesterase"
FT                   /note="Contains one TrkA-N domain (IPR003148)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0154"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60226"
FT                   /db_xref="GOA:D1YUV4"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUV4"
FT                   /protein_id="BAI60226.1"
FT                   /translation="MYIILGGGSIGVALARELTRSRKDFLMVDADPARVEALREQDYEA
FT                   VEGDIGSYRILQELPLKGVEGIFILSSSQAANVKALEFVKSQSPAPFVMARAVDLLTID
FT                   ELYRAGADIVLHPPTIVADEALNELQKMELRGAAWQLMSYIKTLDPDQRIGIVVHDNPD
FT                   SDAFASALCLRTMAESLGRSADILYYGTIGHHETRAFVNLLDIPLIHITNGIPDRYSVI
FT                   ALVDCNTPGKNNSLPRGTRVNVIIDHHPPPDGIEPGADFVDIRPDVGASSTMMTRYLQE
FT                   LDFELTSNLATALLYGIRTDTNEFKRNTSAADLNAAAYLYGFVDKDLLSQIETPSMSPE
FT                   AMDVLGVAIRNKKIEGSYLISNVGFIHDRDTLPQAADYLLKLEGISTVLVFGITEDRIF
FT                   ISARSKDIRINIGDAVQKAFGEIGSAGGHQKTAAAQIPLGVFSGVKDRAILMKLTEEAV
FT                   TRRFLAAVGMEGQGE"
FT   tRNA            152548..152624
FT                   /locus_tag="MCP_t0005"
FT                   /product="tRNA-Lys"
FT   CDS_pept        152797..153180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0155"
FT                   /product="putative universal stress protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0155"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60227"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUV5"
FT                   /protein_id="BAI60227.1"
FT                   /translation="MKVLLATDGMPHTDRAIDYAIDYASRYRAALFVVYALSPGRDQKA
FT                   AYAEGKETVQGIKQKALSREVGITTMLEAGEPAEAIVRTADKIGADAVILGASGKCEGR
FT                   KRPLGSVSARVVQDACCSVFIIR"
FT   CDS_pept        153244..153507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0156"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0156"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60228"
FT                   /db_xref="GOA:D1YUV6"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUV6"
FT                   /protein_id="BAI60228.1"
FT                   /translation="MNLLHKALLSIHLLYYCEYTMRLGVVTASTASLIFVVLIIALAAV
FT                   AASYAGHIGDITLPEINPQAGAFLLLGFGLLASLVVMYRAHV"
FT   CDS_pept        153551..154183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0157"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0157"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60229"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUV7"
FT                   /protein_id="BAI60229.1"
FT                   /translation="MVSMVSEDLLRFFNDNPLLYGRAGREDLDQLSRICELFPDSARLL
FT                   GDREAVELPEFECLRCGRCCSSIRFISVCHGDVKRWVGQKRADILERLVVDRRRTPLLA
FT                   MRRDAVEAAKEEARSFLSGAGVDDERFFELLYVTGLLECAVYVKRKDRGCTFLQYVEGR
FT                   AACAIQDTKPRVCEKFPYYIGKYTDSRLLKEDSFCPSLGEIAKKRTK"
FT   CDS_pept        complement(154189..154857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0158"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0158"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60230"
FT                   /db_xref="InterPro:IPR025874"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUV8"
FT                   /protein_id="BAI60230.1"
FT                   /translation="MVEFQSFTKNYEDLCTEAGFQFIFKCDICGDGYKSKFIESKTYKK
FT                   ANLFNMFGKAVQIGADLAGASRIGNAASRGADLMHNRHSGMTPEWHKEYEVAFEEAQNE
FT                   AKGHFHRCPKCRQYVCDADWNEDDGMCVEDAPRENVEVTAARAERMKQEIQEKAQKASV
FT                   FHGEIERRTTTCPACGKPAGEGKFCNNCGAPLGMAVCPKCGNKVALGTRFCGECGMKMP
FT                   "
FT   CDS_pept        complement(154873..155199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0159"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0159"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60231"
FT                   /db_xref="InterPro:IPR025874"
FT                   /db_xref="InterPro:IPR029038"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUV9"
FT                   /protein_id="BAI60231.1"
FT                   /translation="MAGYKQPCRYCGKLVPPDARICPYCGKGTPIGSLKCPRCRDNIEK
FT                   DYAVCPHCGLSLQTACPVCGKQTFFGDNCEVCGASLKVTCPKCGTVQPAVGPNCSKCGK
FT                   PLKK"
FT   CDS_pept        complement(155246..156598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0160"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0160"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60232"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUW0"
FT                   /protein_id="BAI60232.1"
FT                   /translation="MSDEATKLIECPLEYSLSDDGGAISSGAAVGRIDEENVSIVPKLG
FT                   EAILFSPREILEFAEGDYSINLLLTSKEKLAITKLGINFENFSRILSKARNDVVMKDML
FT                   MQESLVLGGLKGFYEYEGRSGGCELRLFEAGLVLAVERGEPLRFQYSNIAGIAEGDYSL
FT                   TLTMESGEKLTISRMGGRHEPFKKALNDAMNTLTLKTQELIKGFTPGIDSSSLRRAARL
FT                   MRDGKAARKADLDAISPAIWRGLEKKIEEVGILEEYKFIGTLAQKDRMCAGFKRGLMGD
FT                   VTGDYVWILAPVPASNAMILEAVTVGEGETVEPLQSAAEGEATEEEPKDEEVNKSGGRW
FT                   ATYVFSIVPRSQYPAADMDAAADAFIRSLNDCMLSINFRREPIFTSDEDLELPRNIKYW
FT                   YSVQKLPLLRELRSHFVGRAIHVNKAQWQKAVRAVLEFNVKSKDDRAKYTK"
FT   CDS_pept        complement(156671..157966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0161"
FT                   /product="putative protein-export membrane protein SecD"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0161"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60233"
FT                   /db_xref="GOA:D1YUW1"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="InterPro:IPR024912"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUW1"
FT                   /protein_id="BAI60233.1"
FT                   /translation="MPEKPQGTWTKLLTDYRVILLVIALLLSIIFLGPSYSNGQLTTNL
FT                   KFGLDFEGGSFVKLKLVNNTTPTISDKTLEDTKAILENKINSYGLKNTPVNTVRDDSGN
FT                   AYVLIDFAGIPYEEAMSIVGKQGKFEMRIQTQGNESAFILDGSEVQGVSDPTSELSGTE
FT                   TAWGVTFSLTKAGAEKFQQAAIQYGATTAPEEHYIMMILDGKVFYSRPLSSELANSLKT
FT                   KQVDQMVAMTGTGDEGKAIAKEVAVHMKGGSLPVSVQVVSSGQVPAEQGATFKTMVIIG
FT                   MILAQAAIGLIMYLRYREPRIILPMFLTSIFEVVILLGVAAFINWEIDLPSVAGIIAVI
FT                   GTGIDQLIIITDEVMATGRAPTTKKILQKLSSAFKIIVSSAATVVVAMIPLWYMGFGAL
FT                   KGFAITTILGVFIGILITRPAYGRIIGDILSK"
FT   CDS_pept        complement(157959..158933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0162"
FT                   /product="putative protein-export membrane protein SecF"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0162"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60234"
FT                   /db_xref="GOA:D1YUW2"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="InterPro:IPR024921"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUW2"
FT                   /protein_id="BAI60234.1"
FT                   /translation="MKKADESKKQKAPAKTEDNKGSPEEPESNLGPFEKLKWPELPTKQ
FT                   AIGIPLAVLAIALLITGFTYFTVGSPLHLGLDFQGGTLVTLKTDKTDAALQGEFSQYPL
FT                   SLITRDPSGTVSIRFSSMEQAQLDSLTAYLANAYPDASLEHTGSTFSATNQSQAVIAIV
FT                   AAFILMALVIFIIFRDFVPSIAVITSAFSDIMIAVALMNIFGIELTFGTFAALLMLIGY
FT                   SVDTDILLTTKVLGERKYLDKKITSCRATGLTMTGAAIVAFLVLHIVASYGYLVGFSTI
FT                   PVLANISTVMIFGLIADLMNTWFLNAGLLKWYMESPQGRAKYA"
FT   CDS_pept        159155..159403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0163"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0163"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60235"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUW3"
FT                   /protein_id="BAI60235.1"
FT                   /translation="MLKKLQLKDKYNHSQEVIIEYLKNGLKEGKQFFKSKYIARDLGMS
FT                   PKEVGTNMKILSDECKDLLIEKWSYSKSTTWRVETAA"
FT   CDS_pept        159524..160672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0164"
FT                   /product="conserved hypothetical protein"
FT                   /note="Belongs to the Protein of unknown function DUF362
FT                   family (IPR007160).; Contains at least one 4Fe-4S
FT                   ferredoxin, iron-sulfur binding domain (IPR001450)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0164"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60236"
FT                   /db_xref="InterPro:IPR007160"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUW4"
FT                   /protein_id="BAI60236.1"
FT                   /translation="MTFVSLVKNSDPSKAVSDAVQLAGGLEVSGTVLIKPNLSCAKPSG
FT                   SGLVTNVDVVVALVKMVAEQGAKPLVGDLPILGWDPKTVFDASGIRAIEQAGGELVDWS
FT                   AGHIEISLPGAKTLKRVPIARPALEVDAIINVPVLKHHFLTHLSGGMKNLFGLVQPEFR
FT                   PKVHVLGLDGPLVDFYEFLKPRIVLNVMDATSIAQSVRPAGPYYGPSEAKSAYQANMIL
FT                   ASKDAVALDAVAARVIGIEPDDVEMVRIAASRRLGDVNPRTVGNARGASVKIKSSLLGK
FT                   VMPYMEDAWTSQRLNRIAHPLAKRIYGQDIVSLKEVRREMNAIDPSRIVLAGNCTQCGL
FT                   CVNACPTKNIALGSKPAFGSKCIKCFICVEICPGGVLAIQRK"
FT   CDS_pept        160677..161417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0165"
FT                   /product="phosphatidate cytidylyltransferase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0165"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60237"
FT                   /db_xref="GOA:D1YUW5"
FT                   /db_xref="InterPro:IPR039606"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUW5"
FT                   /protein_id="BAI60237.1"
FT                   /translation="MLGFSLHDVLGGVLVYVYIILIFLAVEKLWKGDRAVGRKILHIAM
FT                   GNIVFILAFFDNWYAEVLIAGSALLFSLLITQRMQLYFLNKLTVVPGEESFFRKAYRKV
FT                   IRKLSLISASDAGNEWGLVYYCLMFTVLAGLFAKSPVVVAVGMLPLAYGDGLGAVIGRK
FT                   FGRHPYRIIDKKSIEGSLAVFAGTALSLVGGMVYYGVPLQDAAWMSAAIGLVIMVVEGV
FT                   TPKGLDNLAIPLSAVVLFLLFGAV"
FT   CDS_pept        161417..161977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0166"
FT                   /product="putative thymidylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0166"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60238"
FT                   /db_xref="GOA:D1YUW6"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUW6"
FT                   /protein_id="BAI60238.1"
FT                   /translation="MRFYVIDGLDGSGKDTQAYKLKEYLSKSGREVALRIHPASDNAFG
FT                   HIAKRSLVKSGAFWRLVATFFYGLDVVRSIILYCRGDRDVIFVRYTLACAYLPRAIIRP
FT                   VYAVVNFLLPKSPHMFFLDVSPEEALRRIKKRGDSEEMFETLPHLQKNRSRALLILGNW
FT                   KVVDGNVAPDKVFEQIVGSLSDQ"
FT   CDS_pept        162046..162852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroE"
FT                   /locus_tag="MCP_0167"
FT                   /product="shikimate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0167"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60239"
FT                   /db_xref="GOA:D1YUW7"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR011342"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041121"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUW7"
FT                   /protein_id="BAI60239.1"
FT                   /translation="MITLYGVIGDPVAHSLSPAMHNAAFKALGMDCYYAPFHVKGRYLY
FT                   EAVNGARALGFGGLNVTVPHKEAVIRFVEADQAVRDIGAANTIDFHTNKAYNTDAPGAI
FT                   ASLRDSGVRVKGRNVLVMGAGGAARAVTYGLLKEGATVTIANRTAPKAADLAAYMREYG
FT                   DVFGTGMDSLAEKVAISDVIVNTTTVGMGEDRTLVTAAMLGPEQAVFDLVYKPVETQLL
FT                   KEAKAAGAKAIDGITMLARQGALSFEIWTGVKPPLDVMERSARDAV"
FT   CDS_pept        162842..164113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0168"
FT                   /product="prephenate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0168"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60240"
FT                   /db_xref="GOA:D1YUW8"
FT                   /db_xref="InterPro:IPR003099"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUW8"
FT                   /protein_id="BAI60240.1"
FT                   /translation="MPFKVLVVGGAGGMGRWCTSLFKNSGMEVSISSRRDASDVARSLG
FT                   VGLSSPGDAGSFDIVVLSVPIDAVEHVASGVAPKMRQGSLLMDMSSLKVKPVESMLRHS
FT                   PPGVEVIGAHPLFGPGSDGRGMSIALVPTERSERWFSIIRDLFEDAGYGVLVTTAERHD
FT                   RDMAVVQGLTHFMYVAMGRALERSNADLNEASAFRTPVYGITKELLGRVLSQSPGLYAL
FT                   IQSSGPAGELRRAFVGACEELSSELDAGDLEGFARDFGSAARYYGDTEGARKRSERIVR
FT                   DYMEPRLRAMDAVGKERAFELDGRVVYGVVKHAGPDDFTLETSDGTIILKYEDVSDASD
FT                   RACQEPLVSRDILVKLPIGADPSILQWALSNIDGVKRAGFETADALGPDFVACRFTVSV
FT                   PAGRSDEVLQKVLKTIWGLGLEVK"
FT   CDS_pept        complement(164584..164868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0169"
FT                   /product="putative chorismate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0169"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60241"
FT                   /db_xref="GOA:D1YUW9"
FT                   /db_xref="InterPro:IPR002701"
FT                   /db_xref="InterPro:IPR010950"
FT                   /db_xref="InterPro:IPR036263"
FT                   /db_xref="InterPro:IPR036979"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUW9"
FT                   /protein_id="BAI60241.1"
FT                   /translation="MSLEEVREEVKKVDLEILRLLAKRMQLAGRIVEIKKKEGIAINDD
FT                   KQNELVVKRAMEKALELGLDTGAVKELFKVIIDMSISRQHELSGEGRLP"
FT   CDS_pept        complement(164877..165719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroK"
FT                   /locus_tag="MCP_0170"
FT                   /product="shikimate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0170"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60242"
FT                   /db_xref="GOA:D1YUX0"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR010189"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUX0"
FT                   /protein_id="BAI60242.1"
FT                   /translation="MRGHGIAFGAGTVINAIATYKGSAFGITLKTEAEVTLRGDLVEGE
FT                   IEGGGDTRLIERACELVLEEFDVDSGAKIRTKSQVPQASGLKSSSAAANATVLATLRAI
FT                   GRDMEPLDMVRLGVRAALDTGVSITGAFDDACASMLGGIVVTDNRNNELLKREPVESDV
FT                   IIYAPDKKAFSSQTNVARSRAIGPWVDAAFDMAMRGEYRRAMTLNGFLYTAALGYSPEP
FT                   MMAALELGVDAVSLSGTGPSYVALASGEKLEELRAAWSSYPGKVMITRTNNTGAHTLR"
FT   CDS_pept        165835..166785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0171"
FT                   /product="putative nucleotidyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0171"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60243"
FT                   /db_xref="GOA:D1YUX1"
FT                   /db_xref="InterPro:IPR001937"
FT                   /db_xref="InterPro:IPR005849"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUX1"
FT                   /protein_id="BAI60243.1"
FT                   /translation="MNELRRDYFLDRWVIIATDRARRPSDFIKARDPPAGAQGCSFCPG
FT                   CEDKTPPSKASYFDDSHRPDEPGKPPLTGWTVRVIPNLYPAVKQEGVMLMDGRGMTASG
FT                   VHEVIVESPLHDHHPQFMSDGEVKRLFRVYKDRYAEIAGIPYIRYISLFRNYGREAGAS
FT                   LAHAHSQLIALPIVPENIKEQGGLDYGRVIAEESGSPRAILDTAHTLAIAPYASCYTYE
FT                   AWVIPKRKRRNLAEMTDEERDDFAVTARNVLARLSKLLSDPPYNYAFVQSVDDDVHMHL
FT                   RIYPKLGIEAGFELNTRVHINSVTPESAAKSLREI"
FT   CDS_pept        166836..168086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0172"
FT                   /product="putative glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0172"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60244"
FT                   /db_xref="GOA:D1YUX2"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUX2"
FT                   /protein_id="BAI60244.1"
FT                   /translation="MRIAFFAWEYPPRLVGGLGTYAEYITREYVRLGHDVAVFTMNNGG
FT                   LKTSEVVHGVSVHRPLGVDFSDLLKVISDGELRSWGGQLRFFSSIMVNDILCCAKLANQ
FT                   LTRAEGVKFDMACVHDWMGAMAAPTLKGELSLPVVFHVHSTEWGRSGGRGSKAVGDIEY
FT                   LGATTADDIVTVSYAMKEDLAGHGWPAEKIHVVWNGIDPDTYGPSKAVPREVEALRKRY
FT                   GIADGQKMILFVGRLNWVKGIMNLVQAMPAVLKEHPEAKLVILGTGGEENDIRSLVSRL
FT                   GLEKSVACRFEFVSEKERILHYAASDLCVFPSLYEPFGIVSLEAMAMEKPIVVGASGVS
FT                   GLKEQVVNSGPERTGVHVDGNSPADIAWGILEALRDEGRMKAWGQAARKRVLEYFTWDK
FT                   AARETLSIYEGLLHGRR"
FT   CDS_pept        168073..168339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0173"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0173"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60245"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUX3"
FT                   /protein_id="BAI60245.1"
FT                   /translation="MADGDKHDMARGLFRPEGKSPYIFNGKPLNNFNDLKDYLVAFTGA
FT                   EALWVASWLEYLGDAETADRIRRRPRDFKDIVLKRYRELKPYI"
FT   CDS_pept        complement(168330..168890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0174"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains one ThiJ/PfpI domain (IPR002818)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0174"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60246"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUX4"
FT                   /protein_id="BAI60246.1"
FT                   /translation="MEFSLDNTEIVLVAAPEGFRDEELFVPEDVFSGVGAFVLTASTTK
FT                   KPIYGSQGGSTLPDLHIEDIKVDSLNALVIAGGKGAREHLWHNEALLRKVREANEKGKV
FT                   IGAICISGAIPAIAGIMRGRRGTVYPDTGALEVLKENGETYVNEGVVVDGNVVTGAGPT
FT                   YAKEFAETILALLKERLPAAAQM"
FT   CDS_pept        168987..169778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0175"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains one Xylose isomerase-like TIM barrel domain
FT                   (IPR012307)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0175"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60247"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUX5"
FT                   /protein_id="BAI60247.1"
FT                   /translation="MYYGTLADPKGDSDILQEINYAKDAGFDFLEISAEGPKFTTSKLL
FT                   SRAGEIKKARDEAGIFFTCHTPWGWNVGNPYKPIRDATLSEVIGVIGFAEEVEARLVTV
FT                   HMHTRFGLYHRDEMIRHMAEGLSVLCDRAEKSGMPVTVENVDQSVDDFKKLFELEPRAK
FT                   FHLDVGHANISCKGGANIADFIDTFKDRLYHVHVHDNKGGHGVDGDLHLALGMGNIDWH
FT                   KVVNALKAAKYDKTVTFEVFSKNRQYLETSLDVFRGLAGGR"
FT   CDS_pept        complement(169797..170399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0176"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0176"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60248"
FT                   /db_xref="GOA:D1YUX6"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUX6"
FT                   /protein_id="BAI60248.1"
FT                   /translation="MARECSFHKRSQVGSNTRKALAIVMVTLLAAIMMASSGCVYIQDI
FT                   INPGPTTTPVVVTLTPTPKPPTVTPAPTVVARQMSTDVKVLPVGEKGLESFNFTKDSDY
FT                   QKEYITIELANDGNTTAKKVTVTLKIIDAHGGNELIEQPFVIGDMARGDRKVVSLETDK
FT                   HDLAPSVLITIERIEWGDDGEYYNDIKYLNVARSIWT"
FT   CDS_pept        170491..171240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0177"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0177"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60249"
FT                   /db_xref="GOA:D1YUX7"
FT                   /db_xref="InterPro:IPR010624"
FT                   /db_xref="InterPro:IPR014774"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUX7"
FT                   /protein_id="BAI60249.1"
FT                   /translation="MTEIKNRARFGIQDLDNALDGGLPRGSLVLIEEDTGAKSQILQSK
FT                   FIADGLLNNEYCYIFNMEHPPQAIVNSLNVFGLEPEENINSDQLMIIDGFTDAFGWGEF
FT                   VSKWKYVCHDLASITEVHDVVKQATAEIKPYNNLRGVVDSLTTLILASDSERSILNYIH
FT                   HQMAIQKNYGTTTLYTIHMGAHRPELIKALEHIVDGVIWISKVEVDDEPRDVIQIKKLR
FT                   DSKYSSRKYFFNADEEGAALEVMKKHP"
FT   CDS_pept        171397..172518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0178"
FT                   /product="hypothetical protein"
FT                   /note="Contains at least one Tetratricopeptide region
FT                   domain (IPR013026).; Contains at least four
FT                   Tetratricopeptide TPR_1 repeats (IPR001440).; Contains at
FT                   least three Tetratricopeptide TPR_2 repeats (IPR013105)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0178"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60250"
FT                   /db_xref="GOA:D1YUX8"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR037919"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUX8"
FT                   /protein_id="BAI60250.1"
FT                   /translation="MRNAWHKKKWGIMKDIVRALGLITKGLLVDGRAEEPGAEKARAYL
FT                   GRRDYAHAAEELKKAISSHPDDPEAHYDLGVALVRAGKLDDAMGSFVAAIKLDPGFAEA
FT                   HYNLGVVFAKKGMLDDAIREYNRAARLRPDYAKAHFNLALALTNKGLHDHAKSELMAVG
FT                   GIRRRQALEHYNRGVELAGRDEAILSMAEFREALRLDPGLYQAYNNIGAMLAHNGMIDR
FT                   AVAEYGRGLSINPDDPELHFNMALALSAREDHGAALKELGEAVRLSPNFAEAHYSLGKT
FT                   LAALDKLDWAVSEYKEALSLDPGLSMAYLDMGVALEESGDLEAAAGAYRDFIKSWKFEY
FT                   GALWEFADRRLNDLEKAPASPPGPRSIYPTAAK"
FT   CDS_pept        172524..173249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0179"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains one Beta-lactamase-like domain
FT                   (IPR001279)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0179"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60251"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUX9"
FT                   /protein_id="BAI60251.1"
FT                   /translation="MKVTFLGTNGWFDSETGNTICTLLEADGRHVVLDAGNGIHKLGRY
FT                   IKNKPVDLFLSHYHFDHIEGLHTIVMLPLESLRIFGMEGTEKALRAIIKKPYTVPLGEG
FT                   PFPVEVYELPRDRAKAPYLEDFGLLMHSDPCMGYRFRLGGLTIAYCTDTGLCDNLIRLG
FT                   RDADLLITECSELPGRHSDRWPHLNPEDALAAAEKSGAKKLALTHFNAHLYDTPGARKE
FT                   IERSNNGLIAAYDGLELEL"
FT   CDS_pept        complement(173259..173603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0180"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0180"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60252"
FT                   /db_xref="GOA:D1YUY0"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUY0"
FT                   /protein_id="BAI60252.1"
FT                   /translation="MLMDVSSALISTGTMFVIGSVVLFLIYYFTSPLYTEYGDKRSRLY
FT                   YSLFNALYFSIVLAILFLILPSLSESSGMLISLAIGLVIILASTLVHVYAINVLVRRGI
FT                   IKIKQKRRIR"
FT   CDS_pept        complement(173641..174489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0181"
FT                   /product="putative flavodoxin"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0181"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60253"
FT                   /db_xref="GOA:D1YUY1"
FT                   /db_xref="InterPro:IPR001226"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUY1"
FT                   /protein_id="BAI60253.1"
FT                   /translation="MVSACILYFSQTGNTEKVAYTIAGRFQGEGVDNVTLHLEDAADFP
FT                   EAYEDSDIVGVGFPTFFGYPPPHVMKFIRRLKGKGRSAFVFTTYGGTTAGDSLFDAAMA
FT                   LSKRGFRVLGGLKVEAFDNYPQSIWLKINEGRPNEIDLARSEEFAARILKAHSERQGIE
FT                   PEALASTNPFFIKNRGKPRKKTVGALREKVEGKVIFNKELCLFCETCKKSCPTKSITSG
FT                   EAHPEFSWKCIDGMRCYQCVRVCPGKALLYEQPISDKEYKKLLKGIADTPEEKARAYIV
FT                   P"
FT   CDS_pept        174580..175836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0182"
FT                   /product="putative surface layer protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0182"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60254"
FT                   /db_xref="InterPro:IPR000601"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR007742"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR022409"
FT                   /db_xref="InterPro:IPR022441"
FT                   /db_xref="InterPro:IPR035986"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUY2"
FT                   /protein_id="BAI60254.1"
FT                   /translation="MLTRPLMTALALLAALMLLPTAWAATYSVPGDYPTIGAAVANSSS
FT                   GDIISVDSGTYHENVVITKDITLVGGGSGAGMPTIDVDSGAGITIAADNAVVQRFRVTG
FT                   GSTGIVVRDCGSVKVMECIVTGNGNGILVSGAHGCAVMNNTVAGNDNVGINVPDSSGNA
FT                   IYLNIVTDNQYGIAVTGSSASNTIYMNVLRDNPGSNGLGNGIWNHWNSSMPLTYGYGGR
FT                   QFSGYLGNYWGGLDGTDANGDGVVDTAVMLAENNGDHAPLVDPMPEHPAADFTSDATSG
FT                   TSPLPVQFTDASTGYPVSWLWDFGDGTTSNMQSPPHIYQNSGSYTVTLTVKNVRGEGKL
FT                   VRSNYIVAGAAATPTPTATPTPTATPEPWPSATLTPSPTEKPAGTPTSTATPKPSPGME
FT                   WLIGASALAAATLLSKKKQ"
FT   CDS_pept        175963..177705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pycB"
FT                   /locus_tag="MCP_0183"
FT                   /product="pyruvate carboxylase subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0183"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60255"
FT                   /db_xref="GOA:D1YUY3"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR003379"
FT                   /db_xref="InterPro:IPR005776"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUY3"
FT                   /protein_id="BAI60255.1"
FT                   /translation="MVRITETILRDAHQSLAATRMRTADMVPIIEKLDQVGFYSLEAWG
FT                   GATFDTCIRYLNEDPWERLRIIKKAAKTTPIQMLLRGQNLVGYRHYSDDVVEKFVTLAS
FT                   KNGVDIFRVFDAVNDIRNMEASIKAARKCGARVQGTICYTLSPVHSNDKFVEMAKELAA
FT                   LDCDSICIKDMAGLIMPEPAADLVSRLKKEVGLPVDLHCHCTNGIAPMSYYAAAGSGVD
FT                   ILDTAMSPFGFGTSQPATESIVGALQGTPYDTGLDLKLLAEIAEYFWKVKEKYGAIIDP
FT                   ILERIDVNVLVYQIPGGMLSNLVSQLKQQNKMELYDAVLKEVPVVRRELGYPPLVTPTS
FT                   QIVGTQAVLNVVMGERYKVVPKEVKDYVKGFYGRSPAPVDPEIQKKVIGDEQPITVRPA
FT                   DLLKPEMPGVIAAVNGLGLKNVKDEDYITYALYPPVAEKFLKGEIKPEALEPKAAPAKK
FT                   SKLGPSARRFLIEMDGQVKEIRIEALDAPLPPIGVAVTAQPQAEAVVEEASSNGAVTSP
FT                   MQGTILKVNVKVGDSVKKGDVIAVLEAMKMENDIVAHSSGTVKAVYAQKGKNVDANAVL
FT                   AVIE"
FT   CDS_pept        177711..179882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pycA"
FT                   /locus_tag="MCP_0184"
FT                   /product="putative pyruvate carboxylase subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0184"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60256"
FT                   /db_xref="GOA:D1YUY4"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004408"
FT                   /db_xref="InterPro:IPR004549"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR030855"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUY4"
FT                   /protein_id="BAI60256.1"
FT                   /translation="MFNKVLIANRGEIALRIERACKELGISTVAVYSEADAKSLHVKYA
FT                   DEAYSIGPPPVKSSYLNVDALLEVAADSGCDAVHPGYGFLSENAPFAESVRKAGATFIG
FT                   PPPSVIKKLGDKTVARSTMKKAGLPLIPGSTGTLRSADEAIELANRFGYPCIIKAAGGG
FT                   GGRGMRLVFSDAEVPDALESAKREAEAFFSNGDVYIEKYLEDPRHIEFQILADKSGNVI
FT                   HLGERDCSIQRRHQKLLEEAPSPRMTPVLRETMGNAAVQGAKAVKYENAGTFEFLLDKY
FT                   GNFYFMEVNTRIQVEHPVTELVTGMDLVKEQLRIAAGEELPYRQSDIKINGHAIECRIN
FT                   AEDPQENFFPSPGKITQYMAPGGPGVRIDGCSYPGYEIPPYYDSMVAKLIVWDSNRAGA
FT                   INRMRRALDEYVVEGVKTTIPFHKMILFNAYFRKGDYSTSFITKNILNEDKLIPKEIKK
FT                   GLKTKVLGQKIHYFEEVASTNRIAKEMAAAGAAEGTMVLAETQSGGVKGRIGREWISPF
FT                   GGVCFSLVLRPKCQPRHATKITLAAASAVCKTIRDLYGLDAKINWPNDILIGGRKVCGI
FT                   LTDMAMDVNSIKYIVLGFGVNVNVERLSFPQKIQKTATSIKEELGKTVSRKDFIDALLV
FT                   EFERQYQNFNDGQYGVILDEYKSLAYPLGGHIIVKDQDKLYEGQSVDISEDGALVMKTK
FT                   EGTVMTFVTGDVHAHPDEVLKKDEVRHEA"
FT   CDS_pept        complement(179887..180420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0185"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0185"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60257"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUY5"
FT                   /protein_id="BAI60257.1"
FT                   /translation="MPAALTQESRSVIDGTTPKGVMRDLKAAIRHYGRDASRPITPEER
FT                   RRLELRLHKMLVWVGVLTPFEFELGGRVVPLHDMVWDLLAKDCLTDEEKEYVRKLINKL
FT                   QKHENFDEEVLHNSQLTVAEADVIFREASGLLRAILSLKSLVGRKDTCALKTRTSQRRL
FT                   EEAKYWLGFLKQIT"
FT   CDS_pept        complement(180628..182109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0186"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0186"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60258"
FT                   /db_xref="GOA:D1YUY6"
FT                   /db_xref="InterPro:IPR026898"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUY6"
FT                   /protein_id="BAI60258.1"
FT                   /translation="MKAKSSALIVILLFLFISPALAQSSTDVPASAFQEKDLSISVAQS
FT                   NFSFDRSPSSQTLSIVVSNPTNSPMDVYLAVYQNQQWNVLEKLGSVAAGAQKTFDYPVN
FT                   FTYSGKSEEVDRFGVVGRTYAGYVGSVFSINENWTVYEDSLKSTLSIFGAASAAVLMLI
FT                   LIIVLAGVVSKALHTNYGNDGEYTLRTLFFPITKMRPWAERIANIIINPFFWVIEIALG
FT                   ALLVALILWFTLNETRPDIGWLVFLIGGVAAVFMPVIFLIIGWLADYYEREPFRFTVGM
FT                   FMWGVMATFFAFFINTTFSLVAGLILSAGAAQIILAVLVAPVVEETAKGTGLLILSGHH
FT                   DFDNVFDGIVFGFAIGMGFAFIENWLYFATNASPVAVGGLTEWTYNILYRSFLCSLAHG
FT                   CFTAATGAAIGFFKGRMKSAGFAIAGFFLGLPVAILLHGVFNLTAVFDSIMQTAFGVPL
FT                   PVFDPLLTIVITVIYIILGAYLQLKMKNNNKAVNR"
FT   CDS_pept        182211..182648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0187"
FT                   /product="peptidyl-prolyl cis-trans isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0187"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60259"
FT                   /db_xref="GOA:D1YUY7"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUY7"
FT                   /protein_id="BAI60259.1"
FT                   /translation="MKKAIIETDKGNIEIVLFDKDAPNTVKNFEKLANSGFYNGLKFHR
FT                   VIPGFVIQGGDPKGDGTGGPGYTIKCECYQPNAHKHTKGALSMAHAGKDTGGSQFFITH
FT                   APQPHLDGKHTVFGQVEKGMDIVLKIKQGDKMKSVKVIEAP"
FT   CDS_pept        182719..183066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0188"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0188"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60260"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUY8"
FT                   /protein_id="BAI60260.1"
FT                   /translation="MKIEREAYETATAAGMESEVPLLLVGDKGIITDILVVPCMDSADY
FT                   SMTRLRYITPMGMHVYGKVITKNDTKLGPGLNLIQEDGRWKFIDLDKNEVEVETVEGPP
FT                   RKEENIEESLP"
FT   CDS_pept        complement(183071..184108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="egsA"
FT                   /locus_tag="MCP_0189"
FT                   /product="glycerol-1-phosphate dehydrogenase [NAD(P)]"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0189"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60261"
FT                   /db_xref="GOA:D1YUY9"
FT                   /db_xref="InterPro:IPR016205"
FT                   /db_xref="InterPro:IPR023002"
FT                   /db_xref="InterPro:IPR032837"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUY9"
FT                   /protein_id="BAI60261.1"
FT                   /translation="MQLPRNVIAGPGALESVGPICRSMRLKGRALIVTGRNTKGIAGDA
FT                   VAESLSKNGYDADFLIVESATMENVEKAKRAARDTNAEFLLGVGGGKAIDIAKLASSQL
FT                   DMYFISVPTAASHDGIASSRASIIQGGKSVSNQAEAPLCVIADTGIIMKSPYRLLAAGC
FT                   GDIISNYTAVLDWRLAARLRNVYISEYSVALSEMTARMVLDYAHDIKPGLEESVRLVVK
FT                   ALISSSVAMSIAGSSAPASGSEHKFAHMLDQIAPKPALHGEQCGVGTIMMMYLHGGDWQ
FT                   RIRDALKTIGAPTTAKDLGIEDKYIVEALIKAHTIRPERYTILGDKDLPHEAAVNIART
FT                   TKVIE"
FT   CDS_pept        184175..185008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0190"
FT                   /product="conserved hypothetical protein"
FT                   /note="Belongs to the Protein of unknown function DUF63
FT                   family (IPR002749)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0190"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60262"
FT                   /db_xref="GOA:D1YUZ0"
FT                   /db_xref="InterPro:IPR002749"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUZ0"
FT                   /protein_id="BAI60262.1"
FT                   /translation="MDIGSFIAKYYIDPIIYNEGYNVVNTLTYAIILAISLFAILKLMA
FT                   LLRLKIDERLIMAVAPFIILGASLRNLEDVHLLSPPLSYMFITPLVYVLAFLITLAVLL
FT                   ICVYLERAGRVGDYSKPLFWTGVAGVIVVWGTLLLTQPIRVWWAPIVVFALAFTFTGVV
FT                   YLIARYLKLGFLTMPLNVAILGAHMFDASSTFTAIDIVTGFAEKHVVPVFFIDIFGSAF
FT                   VMYALKLAVFIPVIYLIEKYFIEDKDLYYVLKFVLLVLGFGPGIRNTLELVFIHG"
FT   CDS_pept        185001..185609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0191"
FT                   /product="conserved hypothetical protein"
FT                   /note="Belongs to the Protein of unknown function DUF95,
FT                   transmembrane family (IPR002798)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0191"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60263"
FT                   /db_xref="GOA:D1YUZ1"
FT                   /db_xref="InterPro:IPR002798"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUZ1"
FT                   /protein_id="BAI60263.1"
FT                   /translation="MVNIPGPSRFVRYLGELRAFIAIIVALFCLSAALGYVIPGMYPEL
FT                   VDALLSGLQDKADQLTGQQPLLMMLGIFWNNALASLLALIFGLVAGLFPLFFVMANGLA
FT                   IGIVLEMVVAKMGAVGGILLFLAGILPHGVLELPAVLISAAIGLKLGYLALLSLIKRQD
FT                   VVTGELMAGLMVFVFWIVPMLFVAAFIETFITSALLGSV"
FT   CDS_pept        185684..186301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0192"
FT                   /product="conserved hypothetical protein"
FT                   /note="Belongs to the Protein of unknown function DUF95,
FT                   transmembrane family (IPR002798)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0192"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60264"
FT                   /db_xref="GOA:D1YUZ2"
FT                   /db_xref="InterPro:IPR002798"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUZ2"
FT                   /protein_id="BAI60264.1"
FT                   /translation="MPLNLRIPGPKAFLRYVWDLRLYILAAIAVFTVFYILGYAAAVSI
FT                   PEVRDTIMSSVSEEVSPLKELSPLSLMLGIFVNNAVKCLLVIVLGMAFGIVPAFFMMAN
FT                   GLILGIVIGVTMSRTSLLYVLAGTLPHGVIELPMVFISAAIGLKLGVLALKALFGKKEG
FT                   LLDKVKEALLIYFIWIFPLLFLAAFLETFVTSTVLYLLFGSG"
FT   CDS_pept        186417..187319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadA"
FT                   /locus_tag="MCP_0193"
FT                   /product="quinolinate synthetase A"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0193"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60265"
FT                   /db_xref="GOA:D1YUZ3"
FT                   /db_xref="InterPro:IPR003473"
FT                   /db_xref="InterPro:IPR023066"
FT                   /db_xref="InterPro:IPR036094"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUZ3"
FT                   /protein_id="BAI60265.1"
FT                   /translation="MTQIVDEIKKLKEARRAVILAHNYQRGEVQDIADYVGDSFGLSQK
FT                   AVEADAEVIVFCGVDFMAESAAILNPGRAVLNPAPEAGCPMARMITAADVRKLKEQHPG
FT                   AEVVCYVNSSAEVKAESDVCCTSSNAIKVVNSLKGAEAVFVPDMNLAAYAQKFTSKKII
FT                   PWHGYCPTHHLITAGDVLVAKMEHPGAQVLVHPECRPEVVDLADGVFSTDGMIKYAREA
FT                   TADLIIGTESGLIHRLKKENPRIRYYPLSTYAVCPNMKMTSLVSVRDSLRDMKTQIRVP
FT                   ENIRIRAKKALDRMLEVGR"
FT   CDS_pept        187321..188376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hypD"
FT                   /locus_tag="MCP_0194"
FT                   /product="hydrogenase expression/formation protein HypD"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0194"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60266"
FT                   /db_xref="GOA:D1YUZ4"
FT                   /db_xref="InterPro:IPR002780"
FT                   /db_xref="InterPro:IPR042243"
FT                   /db_xref="InterPro:IPR042244"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUZ4"
FT                   /protein_id="BAI60266.1"
FT                   /translation="MQEEQIAKGLAKKIEKLAAGREIKIMHVCGTHEYTITKSGIRSLL
FT                   PKNVKVVMGPGCPVCVTPQAEIDAIVELAEQGKVICTYGDLLRVPGSRTSLYDSVGEIH
FT                   IVQSISQAVDFAREHPDKEVVFMAVGFETTAPTTAAVMLANPPDNFSILVSHRLVPPAM
FT                   KWLMQQGEANLSGFLLPGHVCAISGIEEYEQFPVPQVIAGFEPLQVMYGLYKLVRQIVE
FT                   NRAEVENAYMSVVKREGNVKAKHMMAEVFDVCDIMWRGFPVIPDSGLRLKPQFEKYDAL
FT                   KKYGITLKPGMETKGCLCNQLLRGIKEPTDCKLFGRACTPLKPVGACMVSTEGACRIWY
FT                   TYGRGAKLVKD"
FT   CDS_pept        complement(188398..189414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0195"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0195"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60267"
FT                   /db_xref="GOA:D1YUZ5"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUZ5"
FT                   /protein_id="BAI60267.1"
FT                   /translation="MAKDKGTKGASKKSKKEPRNWAKTIIPLFLVFIMLGTAVAYVWGS
FT                   NWGSKTDGGKGSSTKNAFGSVSDALRLIPADAGYARYIDLRNDTLLSNATNSYSWLKGS
FT                   LPPSSIFKADPKIDLFAIYPSGYFSDYNGQFVSLTDFGTAYNKSWPDSTGSDYYHELLS
FT                   YYNIAAKKVNDNYYYTPSTYPVVSGMLENMAPTAYVMSSGNTSLSAYGDYSDLFTELKY
FT                   KQIPIEGMTLEMVGLSSNLSYSDRYYAAIGPVDPSNQSQDRLYSYVVIMHVNNTTLLDS
FT                   ERGNLALLQGMMEKSGFESYNTQVYGDYIVIEAKGTMALCLEDMYYRWGFIKYQAAL"
FT   tRNA            complement(189511..189582)
FT                   /locus_tag="MCP_t0006"
FT                   /product="tRNA-Ala"
FT   CDS_pept        complement(190287..190553)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ef1b"
FT                   /locus_tag="MCP_0196"
FT                   /product="elongation factor 1-beta"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0196"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60268"
FT                   /db_xref="GOA:D1YUZ6"
FT                   /db_xref="InterPro:IPR004542"
FT                   /db_xref="InterPro:IPR014038"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR036219"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUZ6"
FT                   /protein_id="BAI60268.1"
FT                   /translation="MGKVMAVIKVMPDSADRDVNKLMDELKNALPKSAEFKGMQVKPIA
FT                   FGLKAILVAFVVSDSEGGTEPVEAAFAKVPGVESVTVENVDLV"
FT   CDS_pept        complement(190556..190723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0197"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains two Protein of unknown function DUF1610
FT                   domains (IPR011668)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0197"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60269"
FT                   /db_xref="InterPro:IPR011668"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUZ7"
FT                   /protein_id="BAI60269.1"
FT                   /translation="MAERIEHCISCGVRLEGAGAVRFKCPSCGAELGRCGKCRKQSNAY
FT                   VCPSCGFKGP"
FT   CDS_pept        complement(190767..191948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argG"
FT                   /locus_tag="MCP_0198"
FT                   /product="argininosuccinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0198"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60270"
FT                   /db_xref="GOA:D1YUZ8"
FT                   /db_xref="InterPro:IPR001518"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018223"
FT                   /db_xref="InterPro:IPR023434"
FT                   /db_xref="InterPro:IPR024074"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUZ8"
FT                   /protein_id="BAI60270.1"
FT                   /translation="MKKVVLAYSGGLDTSVCIPILKENYGFDKVITVTVDVGQPAGEIE
FT                   TASKKAKLIADKHYTMDAKDEFVRDYIFPAIKANAMYEGYVIGTSLARPLIAKKCVDVA
FT                   LKEKADALAHGCTGRGNDQLRFEAVFRTTDLPVIAPMRDMNLSRSWEIEYAKKHKIPVP
FT                   VTKAKPWSVDENIWSRSIEGGKLEDPAFVPPEEIYQWTRDPLKAPDKPEIASIGFEAGV
FT                   PVSLNGKKMKGVDLIMALHKLAGKHGVGRTDMMEDRVLGLKARENYEHPAATVLLTAHK
FT                   DLEKLCLSRAELKFKAGVDEAWAELGYMGLVDEPLYADLNAFIDKTQERINGTVKVKLF
FT                   KGCCMVVGRESPTALYSEELVSFDGKTMDQKDAEGFAKFHGFQARLYKKLINQ"
FT   CDS_pept        complement(193047..193253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0199"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0199"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60271"
FT                   /db_xref="GOA:D1YUZ9"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUZ9"
FT                   /protein_id="BAI60271.1"
FT                   /translation="MFIMDTKTYELMRIPFATILFVGSVYALTEYINKLDYVTGTLLGL
FT                   VCIGVLVYSIVLFSRLDVPAYKH"
FT   CDS_pept        complement(193357..196611)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="carB"
FT                   /locus_tag="MCP_0200"
FT                   /product="carbamoyl-phosphate synthase large chain"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0200"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60272"
FT                   /db_xref="GOA:D1YV00"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005480"
FT                   /db_xref="InterPro:IPR005483"
FT                   /db_xref="InterPro:IPR006275"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR033937"
FT                   /db_xref="InterPro:IPR036897"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:D1YV00"
FT                   /protein_id="BAI60272.1"
FT                   /translation="MPKRTDVRKVLLIGSGPILIGQAAEFDFSGSQACRSLREEGIEVV
FT                   LVNSNPATIMTDPEMADAVYIEPITPDVVAQIIERERPDGILAGLGGQTGLNITSELAE
FT                   MGVLEKYGVKILGTPLKAIYDTEDRDRFKHAMESIGEKVPRSFACHTVDEAVAVIDRLG
FT                   LPLIIRSAFTLGGTGSGVAHTVQDVRHIAEIGLNKSRIHQILVEESVLGWKEFEYEVMR
FT                   DASDTCITICNMENIDPMGIHTGESIVVTPSQTLSDADHQTLRSAAIKIIRALGIEGGC
FT                   NIQFAWNDGDYRIVEVNPRVSRSSALASKATGYPIARTAAKIALGLRLDEIQNKVTMET
FT                   PASFEPTIDYVVVKIPRWPFDKFKNADRHITTSMKSTGEVMAIGRTYEEAYQKALNSLD
FT                   ISEFWGYGNWSRAEMVDLLKNPTHERMFVIYKALQTGAFTIDQIAKLTNIDPWFIKKLK
FT                   NIVDMADALKADIDPGLLRRAKRMGFTDEWIAELRGTSPEAISDMRHKYGIIPTFKMVD
FT                   TCAAEFAAKTPYYYSSYEQECELTPSDRKKVLIIGAGPIRIGQGIEFDYCTVHAVKALR
FT                   ESGIEAHIINNNPETVSTDFDVSDKLFFEPITLEHVMNIIEKERPYGVMVQFGGQTSVN
FT                   MAIPLQMELNRRKDLNTVIIGTSPDDMNIAEDRDLWGRMMKEMGILQPEHGIAYSTDEA
FT                   KVEAARIGYPILVRPSYVLGGRAMEIVYDEADLERYMTEAVKVSRKHPVLIDDFLEDAT
FT                   EIDVDAISDGKDVLIGAIMEHIEEAGIHSGDSACVIPPQSLSKEVQDQVRDITRKIALA
FT                   LNVIGCVNIQMAYKDGKVYVLEANPRSSRTIPFVSKATGLPLAKIAAKAIIGYSLKEMG
FT                   YTEEPKPKYVSVKEVVLPFDKLPGADPLLGPEMRSTGEVMGIDTDFGKAFFKAEQSAFN
FT                   SLPLEGTVFISVRDEDKKEMARLAKVLHANGLKLIGTTGTKKYLEAQGIPVTLISKVHE
FT                   GSPNVIDLMRRGKVDLIINTPTSKMARKDGSRIRRAAIDYDVPYLTTIQAVRASADAIN
FT                   AMGKRKMSILSLNEYLGHAAAPVPAVDAFKTREPAA"
FT   CDS_pept        complement(196611..197678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="carA"
FT                   /locus_tag="MCP_0201"
FT                   /product="carbamoyl-phosphate synthase small chain"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0201"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60273"
FT                   /db_xref="GOA:D1YV01"
FT                   /db_xref="InterPro:IPR002474"
FT                   /db_xref="InterPro:IPR006274"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR035686"
FT                   /db_xref="InterPro:IPR036480"
FT                   /db_xref="UniProtKB/TrEMBL:D1YV01"
FT                   /protein_id="BAI60273.1"
FT                   /translation="MKAVLGLEDGTCVLGEGFGREGTTLGELVFATPYTGYEEALTDPS
FT                   YKGQILLFTYPLIGNYGVNDANFQSDGIKAEALVIREKCVHPSHPRFRRSLDAFLTDEK
FT                   VSGIAEVDTRMLTIKTRTYGTMRSALIVGSDDGEKAVELAKNSKPDPTLVEKVTCRQPY
FT                   EVKGTGPRIVVMDFGAKRNIINSLARRNADVVVVPSSTSYQAIQDYKPDAILFSNGPGD
FT                   PQDAKNGIAVARQAAGQLPVFGICLGHQIIGLAMGASTYKLKFGHRGANQPVIDLIDKK
FT                   VYITSQNHGYAVDPNTIEGTGLTMTQTNANDGTVEGMKNDKMRIMSVQYHPEASPGPRD
FT                   TNWFFDAVVKKAGVW"
FT   CDS_pept        197924..198847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fba-1"
FT                   /locus_tag="MCP_0202"
FT                   /product="fructose-bisphosphate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0202"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60274"
FT                   /db_xref="GOA:D1YV02"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D1YV02"
FT                   /protein_id="BAI60274.1"
FT                   /translation="MIFATLKEVLEAARAGKYAVGAFNINDMEIAKAIGGAAKEEKSPV
FT                   ILAVSPSAIKYAGIEYIYEIARVTADKSGVPTVLHLDHGTTFNDCVQCIRHGWSSVMFD
FT                   GSKLPLEENIKQTADIVRIAHAAGVSVEAELGKLAGVEGHVSVAEKDAIFTNPDEAKMF
FT                   VERTGVDALAVAIGTSHGAYKFKGEATLDFPRLEKIEKLVNIPIVLHGASGVPKDVLDK
FT                   AAKYGAKLPGAAGVPNDAIKQAISLGVAKINIDTDIRLALTAAIRQVLAEHPEEFDPRK
FT                   IFGPAEDAMKAVAKGKMQLFGSSGKA"
FT   CDS_pept        198850..199887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pfp"
FT                   /locus_tag="MCP_0203"
FT                   /product="pyrophosphate--fructose 6-phosphate
FT                   1-phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0203"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60275"
FT                   /db_xref="GOA:D1YV03"
FT                   /db_xref="InterPro:IPR000023"
FT                   /db_xref="InterPro:IPR012003"
FT                   /db_xref="InterPro:IPR012829"
FT                   /db_xref="InterPro:IPR015912"
FT                   /db_xref="InterPro:IPR022953"
FT                   /db_xref="InterPro:IPR035966"
FT                   /db_xref="UniProtKB/TrEMBL:D1YV03"
FT                   /protein_id="BAI60275.1"
FT                   /translation="MADIKKIGILTGGGDCPGLNAVIRAVVFKAGEYGWQVLGVKYGWK
FT                   GMLNADAIPLTRNDVKDILPLGGTILKTSRTNPYKVEGGEAKVLENAKKMGIDCLVAVG
FT                   GEDTLGVANKLTKAGLRCVGVPKTIDNDLGATDYTFGYQTAVQIASDAMDRLHTTAKSH
FT                   DRVLVCEVMGRHAGWMTVDAGMSASAHWIYTPEAKGSVEDCCKMLKERYARGDKYGIVA
FT                   VAEGAEFSDLDVKAASQTTDSFGHVKLGGVAETLAKEIEKRTGLETRHVVLGHTQRGGS
FT                   PLAYDRILGTRLGNKAAEMIKNGQFAMMASLRGENVEAVPIEEAVKTLKTVPPQYYDVA
FT                   KTFFG"
FT   CDS_pept        200308..201438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0204"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0204"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60276"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:D1YV04"
FT                   /protein_id="BAI60276.1"
FT                   /translation="MLPQRLTALAIISLFIMMLIPVALAQSSLTVEEYKYPNGTTVDAM
FT                   CVDSRGNVWLAQSSPATLYRVDPSAGTFDKYVIPTSSDTLFRGMSAEGSSYIWMADEGG
FT                   QQIIGYDVGKNKFYNFTFPLDLNPTDVIAQDNYLWVACNMELGRINMDTNEMKDYYVDR
FT                   YDASLADLAMDRMGNVWFVEYSSGKVGGYSRMDDQVHIFPIPTADSKPTCLGIDSQGRL
FT                   WFLESASSKLGMFDTNLNTFKEIDLPQLDGAQVYAKRLAVDSDDNVWLTDTANGRVIKY
FT                   YTAKDAFVPISLNGTKSYPTLIEADGNTIWAVESGASSLAKIRADPLYGLDATPTPTAT
FT                   PSPTPSATPTPKPTPGFEVIAALCAVCIVARKFNKN"
FT   CDS_pept        complement(201435..202304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0205"
FT                   /product="conserved hypothetical protein"
FT                   /note="Belongs to the Protein of unknown function Met10
FT                   family (IPR003402)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0205"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60277"
FT                   /db_xref="GOA:D1YV05"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030382"
FT                   /db_xref="InterPro:IPR030867"
FT                   /db_xref="UniProtKB/TrEMBL:D1YV05"
FT                   /protein_id="BAI60277.1"
FT                   /translation="MGKNNSKMFNKQRGIPVPADPLATLLKDRLTPEELAVLPRGWQII
FT                   GEVLLIHIPPVLQTKKALIAEALLTLYPRCRTVMETHRIAGEYRQPVFERISGDGTETL
FT                   HKENYVVYKLDVAKIMFSQGNFYERRRMGTVGKGERVVDMFAGIGYFSLPMAVHARPGK
FT                   ILAIELNPESYGYLCENVRLNHVEDIVEPVLGDCREKAPEGWADRAIMGYVGTTQEYLP
FT                   WGIRALKRGGILHYHETTPDKLVFDRPVQNIKDAAKEQGRKAEILEKIKVKKYSPGVWH
FT                   VVVDARIS"
FT   CDS_pept        complement(202291..203367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0206"
FT                   /product="conserved hypothetical protein"
FT                   /note="Belongs to the NMD3 family (IPR007064)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0206"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60278"
FT                   /db_xref="GOA:D1YV06"
FT                   /db_xref="InterPro:IPR007064"
FT                   /db_xref="InterPro:IPR039768"
FT                   /db_xref="UniProtKB/TrEMBL:D1YV06"
FT                   /protein_id="BAI60278.1"
FT                   /translation="MVTTSSLFCPRCGKETQHEGLCEACFADKYVVFEVPQVMEAVICA
FT                   KCPAYKAGERWVLTKLKTYEELAKKAASKDIRLAIKVNKEVRDPAILVTSDFINPNILK
FT                   ARVSVDGTIEGRPVKTEAEVEVRIRKETCDICSRIAGGYYEAIIQVRASGRLPTKKELA
FT                   RCMKIADDNMVRAEKAGDRLAFVSDVMELPEGTDLYMGSTTAARQISRAIVNEMGGTII
FT                   ESPKLVGEKEGKGLYRVTFAVRLPGIVPGDIVRMHNSLVLVEKVGRRISGTDLATGFST
FT                   SIEAEEEPPKAASAREGTSTVLVSEDGNSIQILDPESYVPLTIRKPAFLNKKPGEDVQV
FT                   IKTREGVFLLPGGGRGEE"
FT   CDS_pept        complement(203449..204027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0207"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0207"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60279"
FT                   /db_xref="UniProtKB/TrEMBL:D1YV07"
FT                   /protein_id="BAI60279.1"
FT                   /translation="MVTASKKPKAAPKKAAAKPKAPAKKATASKPKAKPKTTVVKAKTA
FT                   KKTSTPAKAVEARKVGEMVYNDELFESLSEAVLLSEAAAAALLPEIKKQLFDYDIYMVS
FT                   FLGDEDIDEIAEGISKADSAALKPLLAAIRDNARVFVDIASGYNSVRAFIDRSLKSEGK
FT                   DKLKLSFIEGEYCLKGAGPETCESFLMLF"
FT   CDS_pept        complement(204257..205120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0208"
FT                   /product="putative transposase orfB for insertion sequence
FT                   element"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0208"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60280"
FT                   /db_xref="GOA:D1YV08"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D1YV08"
FT                   /protein_id="BAI60280.1"
FT                   /translation="MSILECRGSLPVSRAVELMGVSRSGYYRWLHTRNMIQPTESDLLI
FT                   TEEIQRIALDYPRYGYRRAWVELGNRGFIVSRKKVYMLMRQYNLLCVRRRYRVCTTDSN
FT                   HDKPVYENLAGGMRVSGINQLWVADITYIQLSREFVYLAVVIDVYSRRCVGWQLSHSID
FT                   TRLTLGALHNALETRRTELGGLVHHSDQGVQYASKEYVECLLEHGIRVSMSRRGNPYDN
FT                   AFAESFMKTLKYEEVYLNEYETFKDAMENIERFIDEVYNQKRLHSSIGYQSPIEYEKTL
FT                   NTNIVP"
FT   CDS_pept        complement(205117..205431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0209"
FT                   /product="putative transposase orfA for insertion sequence
FT                   element"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0209"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60281"
FT                   /db_xref="GOA:D1YV09"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D1YV09"
FT                   /protein_id="BAI60281.1"
FT                   /translation="MGRVERRRFSREFKLQVLRELKGGKSVAEVCREYDLTRFLVARWK
FT                   REHEENPDAFQGKGKARVDENRTRELERLVGQLYAENDFLKRALANMKKREEDRGRDRI
FT                   "
FT   CDS_pept        complement(205774..206496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0210"
FT                   /product="putative glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0210"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60282"
FT                   /db_xref="GOA:D1YV10"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D1YV10"
FT                   /protein_id="BAI60282.1"
FT                   /translation="MDFSIIVPAFNEEKRIRACLESIKAQHTAHSYELIVSDSGSTDGT
FT                   VSIAREYTDKVVVCKEKGTARARNEGAKLAGGDILVFIDSDTIVSPDYIDTVARAFKDP
FT                   RLLAASCAFKFTRRSPKLLGAEYVTNAYYVLRSAFHAATLPGFNVCIRREAFEKLGGFR
FT                   LCHLEDLDMSIKLRKMGRTKYLPRRVVVTSSRRLEQDGVLGTLKYYGDLFEASQGRRLG
FT                   FEPVKLGESKFDDYVHRE"
FT   CDS_pept        206598..207251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0211"
FT                   /product="metal dependent transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0211"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60283"
FT                   /db_xref="GOA:D1YV11"
FT                   /db_xref="InterPro:IPR001367"
FT                   /db_xref="InterPro:IPR007167"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR022687"
FT                   /db_xref="InterPro:IPR022689"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036421"
FT                   /db_xref="InterPro:IPR038157"
FT                   /db_xref="UniProtKB/TrEMBL:D1YV11"
FT                   /protein_id="BAI60283.1"
FT                   /translation="MRKNIAEEYLETILYLTKGGRTAKTKDIADAMGIKPPSVSEMLAK
FT                   LKEQGYVEYQPYVGATLTEKGRAEAVQMERKHQLLETFLVDTLGVELNKAHEEACEMEH
FT                   AVSDSTVSKICSFLGHPKFCPDDHPITSGECCEKHEESMPLTELKEGECATIKIVCADH
FT                   RTRDYLISLGFLPDVLLSIKKRLPSNCLLVRIKGSEIAIGGDIAEKIFVRKAAA"
FT   CDS_pept        207248..209191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0212"
FT                   /product="ferrous iron transport protein B"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0212"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60284"
FT                   /db_xref="GOA:D1YV12"
FT                   /db_xref="InterPro:IPR003373"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR011640"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030389"
FT                   /db_xref="UniProtKB/TrEMBL:D1YV12"
FT                   /protein_id="BAI60284.1"
FT                   /translation="MKPVKVARPIKVARPIKVALIGNPTVGKSSLFSRLTGIGVIISNY
FT                   PGTTVEVAHGRVAHDGVSLDLSDLPGVYSLDTASSEERTVLDFLRDERPDVILNVVDST
FT                   RLERNLYLTLEVLELGLPVVVALNMVEEAHAQGMDIDAEALSRVLGVPVIPTYIHRGAG
FT                   LEELTHALFHPRLLKPRLTRYDRHVEAFIRQLMGMQLGLTRYEAIRLLSNAPEASKYPE
FT                   GIRTAAEMMRKEVEQSHNEPIGDILAGNRYAEAGLIAKGVARQRQPSPEATLRERIDDL
FT                   LMSPLSGFLILALAILGMLLIVFLVGGFLEDIIVGAMETYVISPVSGALVTHPLVLVIV
FT                   KYTLIGIQAGLGIVIPYIMTFYLLMAVLENSGYLTRAAFLLDEVMHKFRLHGRAMIPLI
FT                   LGFGCSVPAIMSTKALQTKRERIVTSAMVCMVPCSARSVVIMGLVASFVSIPAALSIYL
FT                   LMILITIAMGYVLGRTVKGEEMGFVMEMVPLRVPQVKDILDKTWMQMKEFIYVAFPLLI
FT                   AGSAVLGVLQYAGILDVVNGLLAPVTTGILGLPPYTATALIFGVLRKEMALETLAVLAG
FT                   TAQFNTVFTALQMYVFGVFTTIYMPCIATVTMLNRVVGLKDTILITGLTFLLALVISGL
FT                   IANLVPLLAALI"
FT   CDS_pept        complement(209197..210966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0213"
FT                   /product="RNase L inhibitor"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0213"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60285"
FT                   /db_xref="GOA:D1YV13"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007209"
FT                   /db_xref="InterPro:IPR013283"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1YV13"
FT                   /protein_id="BAI60285.1"
FT                   /translation="MRIAIIEKDRCHPRKCSSECIKYCPKVRTGDETVRIGDEGKAVIS
FT                   EELCVGCGICVKKCPTQAIMIIGLPDKLAGQLTHRYGGNGFALYGLPVPSRGRVSGILG
FT                   VNGIGKTTAVKILSGQIMPNLGKSDTTWEDVYKFFAGSELQDYMRRVSKKEMKTAQKPQ
FT                   YIDLIPKAFKGKVIDLLRKTDERKIFDEVVKELDLGVILDRDISGLSGGELQRVAIAAC
FT                   AMREADFYFFDEVTPYLDIFQRIRMARMIKRMGEDKNIMVVEHDLAILDLLADVVHVAY
FT                   GEPGGYGVITHPKGVRVGINEYLRGYLPEENIRIRPTPIEFEVKAPRPQKEVQALTAFP
FT                   ALTKTLGTFRLDVKGGELRKREVVGVVGPNGIGKSTFARLLAGELKPDKGELDFKVKIS
FT                   YKPQYVKADTEMSVGALLGSINKKFDTSYYNSEILVPMQIQRLMDCNVNELSGGELQRV
FT                   AIAACLGKDADMFILDEPSAHLDVEQRTMATKVIKRFAENNDVTMLVIDHDIYMIDLLS
FT                   DRLLVFDGEPGVSGEVHGPFEMREGMNRFLSNLDITFRRDEETRRPRVNKPESNLDREQ
FT                   KSIGEYYYMPQVE"
FT   CDS_pept        complement(210982..211323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0214"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0214"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60286"
FT                   /db_xref="GOA:D1YV14"
FT                   /db_xref="UniProtKB/TrEMBL:D1YV14"
FT                   /protein_id="BAI60286.1"
FT                   /translation="MVEVKEPTKDERVAFHLRGIKMSLIPAVLGVLAGFISSPYVLSGA
FT                   HSSFSILILAIAIYAQKYIFPLWGIESGKFDLKAWFYVGFMTFAYWYVTWTIVANGIPS
FT                   TGPQFGPFF"
FT   CDS_pept        211505..212158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0215"
FT                   /product="F420-dependent NADP reductase"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0215"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60287"
FT                   /db_xref="GOA:D1YV15"
FT                   /db_xref="InterPro:IPR010185"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D1YV15"
FT                   /protein_id="BAI60287.1"
FT                   /translation="MKIAILGGTGDIGEGLALRLAQKHQIIVGSREAEKAQDAANNYNR
FT                   LLKEKGLKDDIRGMTNLDATKNSDVVILAVKYQFAIQTIQSVEGVLDGKVVVTPIVPMS
FT                   KQKLCSYTPPEQGSAAKHICSVMPPEIRTVVAFQTLPAPRLADLNDPLGFDVIVCADDE
FT                   EAKKLVMGLVSDLGNVRPLDGGGLEEAKLVESLTPLLINLAIKNKMKPLSIKFV"
FT   CDS_pept        212213..212836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0216"
FT                   /product="putative endonuclease III"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0216"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60288"
FT                   /db_xref="GOA:D1YV16"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:D1YV16"
FT                   /protein_id="BAI60288.1"
FT                   /translation="MRRDEAALLKKLYELLDDGTGWEEWWPADSDFERVVGSILIQRTR
FT                   WENVDRAIAALNKEGLLTPRALASCPSGRLEELIRPAGFYRQKAARLRAVAGYFSRSGA
FT                   GSIPTEKLREELLSLPGVGNETADVIMLYVAGRPRFVLDAYAKRILKCAGIMDDHDELQ
FT                   ALARKALCDDLEAHRRCHALIVEHGKRYCNKNECEMCLVKRYLG"
FT   CDS_pept        212879..213766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0217"
FT                   /product="conserved hypothetical protein"
FT                   /note="Belongs to the Mrp family (IPR000808)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0217"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60289"
FT                   /db_xref="GOA:D1YV17"
FT                   /db_xref="InterPro:IPR000808"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="UniProtKB/TrEMBL:D1YV17"
FT                   /protein_id="BAI60289.1"
FT                   /translation="MSSTNATDEACNTCKDGKGSSKCDMCPSKGKHGDKPAWDERIMKR
FT                   LATIKHRIAIVSGKGGVGKSTVTAGLALNLSMMGFKVGVLDADVSGPNMPHLLGLEGKK
FT                   LMGSELGIEPVQSRNGIKVVSSEMVLTGSDTPMIWRGPMRTTLVNQFVADVNWGDLDYL
FT                   LVDLPPGTGDEPLSVMQMMPLDGIIIVSTSSNLSTLDVSKIINMAKELNVTILGVVENM
FT                   SYLQCPDCNKKIHLFGESKVEKLAKKYGVPLIGEIPLDPQNAGIDELPADGRSLIVSAL
FT                   RPIAEKVAHDVEHK"
FT   CDS_pept        complement(214153..215424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hmgA-1"
FT                   /locus_tag="MCP_0218"
FT                   /product="3-hydroxy-3-methylglutaryl-coenzyme A reductase"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0218"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60290"
FT                   /db_xref="GOA:D1YV18"
FT                   /db_xref="InterPro:IPR002202"
FT                   /db_xref="InterPro:IPR004553"
FT                   /db_xref="InterPro:IPR009023"
FT                   /db_xref="InterPro:IPR009029"
FT                   /db_xref="InterPro:IPR023074"
FT                   /db_xref="InterPro:IPR023076"
FT                   /db_xref="UniProtKB/TrEMBL:D1YV18"
FT                   /protein_id="BAI60290.1"
FT                   /translation="MDKTSKISGFYKLPPQERLNAVKQYAGLSDDEAATLGNTGALKPE
FT                   QIDRMVENVIGVMPVPMGVAVNFLINGRDYLIPMAIEEPSVIAAASNAAKMAREKGGFT
FT                   TSSTGPVMRGLIQVTGIKDPYSARFSVLSAKNNIMEMANAVDPVLVKFGGGCKDVEAYV
FT                   KDTPHGPILVVHLIVDCRDAMGANAVNTMAETVGPYLEKLTGGKVYLRIISNLADKRLM
FT                   RARAVFSKESIGGDDVVDAIIKAYEFALVDPYRAATHNKGIMNGISAVTLATGNDTRAI
FT                   EAGAHAYASITGTYLPLTIYEKSAGGDLVGTIEVPLAVGLVGGATASHPTAKANVKILG
FT                   VKTASELGEVMAAVGLAQNFAALRALATEGIQRGHMQLHSRNVAIHAGATGDLIDKVAE
FT                   AMVREKKVRADRAKELLEQFTKAH"
FT   CDS_pept        215560..216690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0219"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0219"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60291"
FT                   /db_xref="InterPro:IPR009351"
FT                   /db_xref="UniProtKB/TrEMBL:D1YV19"
FT                   /protein_id="BAI60291.1"
FT                   /translation="MMLEKEAVNFFVMAKSHLTPDSRLDSAGAVLRDMIALDANNLDDA
FT                   YFSLYLRVKRFDVVALEKGMYRGTSMARVKGLKNYMQVIPQEFLPAVYAVSKKDREAAA
FT                   RNLLSTWGIAEDEYRKVGSKVLESLDGKEKTLVQLKKGLSPVSRDIVRKKKEKATNVSI
FT                   VAQAMQDRWLLLRGGIGRHPGENPGRFSAFKERFKMKLDVGRDEALSLLAKRYVKSYGP
FT                   VGAEDLAWWLGVTKSEASWALDSLDSAEAVDVEGVPGRLFIDKRDESLIDGKFMEPSVV
FT                   FLPRDDPYVKAYYNDGRFVPEGHDAMTKFGESKSVVLVNGTVWGTWSLEKDRMTFVCRV
FT                   EWFDGHPEVPAERVEAAALDAGRFYTGGEVEVKGDT"
FT   CDS_pept        216860..220177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ileS"
FT                   /locus_tag="MCP_0220"
FT                   /product="isoleucyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0220"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60292"
FT                   /db_xref="GOA:D1YV20"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002301"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023586"
FT                   /db_xref="InterPro:IPR033709"
FT                   /db_xref="UniProtKB/TrEMBL:D1YV20"
FT                   /protein_id="BAI60292.1"
FT                   /translation="MIQEEKEQYNGKVIEARVDQFWNSTDAYHKTRALRKGNKKFYFVD
FT                   GPPYTTGRIHLGTAWNKIIKDSVLRYRSMNGFDLMDRAGWDMHGLPIEVKVESLLGFKT
FT                   KKDIENYGVAQFTEKCKAFAIENMREMTGQFKKLGVWLDWDDPYMTLKNEYIEAAWWTI
FT                   KQAHEKKLLERGLRNVNWCPRCETAIADSEVEYADRTDDSIYVKFPLKDQEGFLVIWTT
FT                   TPWTIPANMGVAANKDFTYALVHALPGPVLEEASLAAGLDPAALMDKHSDGTPKPMRFA
FT                   DKVARMKEAIGPEKLEELYAAKGEKLIIAVDLVEGVMKLGRYGDYRVLKTMQGEELKGT
FT                   QYRHPLEDLVPCHKGTEHKVYLADFVVGENTGLVHIAPGHGLDDFELGVKEGIPVFCPV
FT                   KPNGAFAPEAGAYAGMNIRDANPKILDDLRARGLLLGATEITHRYGHCWRCKTPIIFMT
FT                   TDQWFIAVSKIKEPMLAEVSRVNWYPPWAGSSRFHDWVSGARDWCISRQRYWGIPIPIW
FT                   KCENCGSMDVIGTKEELEHKTGVRVNDLHRPFVDSVYMECECGGRMKRVEDIFDVWFDS
FT                   AVASWATLRFPQRKDLMDWWPADFIVEGHDQTRGWFYSQLGAGMVGFGKAPYNSVCMHG
FT                   FTLDDQGRKMSKSLGNVVAPEEVLEKFGADALRLYVLSQSAPWEDLSFSWDECGNVYRT
FT                   LNIFWNVYRFPLPYMVLDKFDPTKTTYGSVKEHLRVEDRWILSRLQAVIKEVNEGMATY
FT                   ELHRSTRALINFILEDLSRWYVQLSRERTWVEANDPDKLAAYWVLYHVLSNTVKLMAPY
FT                   TPYMAERMYQNLVRNSEPSAWESVHMCEWPTVNASLLDEQLNKDMDVARKIVEASSNAR
FT                   QKAKRKLRWPVKKITVAPDTEETATAVKDLTGVIREQTNAKEIVLLGVGAPNPDLGVEV
FT                   VPNPKVIGPAFKGEAGKVIGALKSSDGRVVKSTVEKDGRFVLTLAGGEVEVTPDMVSFR
FT                   DVIPETLAMGEFPGGKLYVDVELTPELEAEGYTRELIRRIQDMRKDLKLNVEDKIKAEV
FT                   YVGDDRVRGLVAGMNGLIMNEVRASGLEFKGDKSVSGALVKEWDVEGLPVTIGIEKA"
FT   CDS_pept        220174..220809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0221"
FT                   /product="conserved hypothetical protein"
FT                   /note="Belongs to the Protein of unknown function DUF115
FT                   family (IPR002826)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0221"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60293"
FT                   /db_xref="GOA:D1YV21"
FT                   /db_xref="InterPro:IPR002826"
FT                   /db_xref="InterPro:IPR027510"
FT                   /db_xref="InterPro:IPR036759"
FT                   /db_xref="UniProtKB/TrEMBL:D1YV21"
FT                   /protein_id="BAI60293.1"
FT                   /translation="MRYEQWEPYYRAILQDFGWTAEGDEKAAELLSSMLPEDTPCLARV
FT                   EELIRGKEVIVCGKAPTLQKDMAKVDWWYKYTVIAADGAVSTLLDQGIVPDIVVSDLDG
FT                   RHEDLLEADSLGSIIVAHAHADNVEAVKSLVPKLRHVVGTTQARPLRNVYNFGGFSDGD
FT                   RCVFLAKELGAKSIKIIGFDLDDTKVTPKKLKKLKWARRLLGDLGINI"
FT   CDS_pept        complement(221322..221828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0222"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0222"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60294"
FT                   /db_xref="GOA:D1YV22"
FT                   /db_xref="UniProtKB/TrEMBL:D1YV22"
FT                   /protein_id="BAI60294.1"
FT                   /translation="MRSRYIAALTAGIVGGVLLAGYLAVSFILELAAWNAWVPGAGTAS
FT                   NACGCLTLPAILIISLATGVLAAMRAKDLTKLSDAAIVSALAGALAGLIYGVVNVIIAF
FT                   LRPAIEFGMAVDSSDILGGIALGSIFGGAGGVMTCLCAPVGLILIAVVAAIGGAIYASV
FT                   KLNLK"
FT   CDS_pept        complement(221904..222938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="asd"
FT                   /locus_tag="MCP_0223"
FT                   /product="aspartate-semialdehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0223"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60295"
FT                   /db_xref="GOA:D1YV23"
FT                   /db_xref="InterPro:IPR000319"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR005676"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D1YV23"
FT                   /protein_id="BAI60295.1"
FT                   /translation="MIKAGILGATGAVGQRFVQLLADHPWFEITALAASERSAGKKYGE
FT                   VAKWRLDTDLPENVRDITVVSTKPKEVDADIVFSALPAEDAITIEKDFAKAGFVVSSNA
FT                   SSHRMEKDIPLLIPEVNPEHLALIDVQKKKRKWDGCIVTNPNCSTIMMVLTLKPLMKFG
FT                   IENIHVATMQAVSGAGYEGVSSMAIMDNVIPYIGGEEHKMETETQKLLGTFDGKIVKDA
FT                   PFWVSAACHRVPVMDGHTMSVWMRSKKNPTPEQVKNAFLKFDPKLGDLPTSPKKAIIVR
FT                   EEPDRPQPRMDRNQGRGMSVSVGRIRAGADNAVQYVCMGHNTVRGAAGASILNAEVLKK
FT                   KGYL"
FT   CDS_pept        complement(222951..223139)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0224"
FT                   /product="ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0224"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60296"
FT                   /db_xref="GOA:D1YV24"
FT                   /db_xref="InterPro:IPR001080"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D1YV24"
FT                   /protein_id="BAI60296.1"
FT                   /translation="MVAKVDKEACVGCGTCVDACPEAAIELVDEIAKVDEERCQECGDC
FT                   VAACPTEAIKLEKEKTK"
FT   CDS_pept        complement(223246..224013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapB"
FT                   /locus_tag="MCP_0225"
FT                   /product="dihydrodipicolinate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0225"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60297"
FT                   /db_xref="GOA:D1YV25"
FT                   /db_xref="InterPro:IPR000846"
FT                   /db_xref="InterPro:IPR022663"
FT                   /db_xref="InterPro:IPR022664"
FT                   /db_xref="InterPro:IPR023940"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D1YV25"
FT                   /protein_id="BAI60297.1"
FT                   /translation="MVRVAIAGINGRMGTMVSDIVLAQPDMELVAGFDLSAGKQVGPVK
FT                   VSSAKDIDSVLKAVKPDVLIDFTAPSAAVGNVKAAAANGVRMVVGTTGFDEAQKKEMAD
FT                   AIAKGNVAAIISPNFSVGVQVFLKLLAEAARDLEGCDIEIIEAHHNKKKDAPSGTALKA
FT                   AEVISGALKEKPPLVYGREGVALRGKEIGVHAVRGGDIVGDHTVLFACEGERIEIKHQA
FT                   HSRSAFASGAVKAARWLVSQKPGLYSMSDMVMQ"
FT   CDS_pept        complement(224031..224966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapA-1"
FT                   /locus_tag="MCP_0226"
FT                   /product="dihydrodipicolinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0226"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60298"
FT                   /db_xref="GOA:D1YV26"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR005263"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020625"
FT                   /db_xref="UniProtKB/TrEMBL:D1YV26"
FT                   /protein_id="BAI60298.1"
FT                   /translation="MKLKGELKGVYPALITPFKKNGEIDIAGFRNNIDYVIEGGVSGIV
FT                   PCGCTGEAATLSFDEQKRLLETAVDQANGRVPVIGGSGSNNTREAVELTRYAMDSGATA
FT                   AMLITPYYNKPGDAGQLLHYRTVAENVDIPIILYNVPSRTGINMKPSIVAELAKIDNIV
FT                   GIKEASGSPAQTAEIIELTRGYKKGFTVLSGDDNLTIPIMSYGGKGVVSVAANVLPKEV
FT                   SQMVAYYLKGDQKKALDVYYKLAPIMRGLFIETNPIPVKAAANMMGLAAGPLRAPLTTM
FT                   APENQKKLQAMLEALGAVKKKVAVKARAKK"
FT   CDS_pept        complement(224966..225163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rps17e"
FT                   /locus_tag="MCP_0227"
FT                   /product="30S ribosomal protein S17e"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0227"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60299"
FT                   /db_xref="GOA:D1YV27"
FT                   /db_xref="InterPro:IPR001210"
FT                   /db_xref="InterPro:IPR018273"
FT                   /db_xref="InterPro:IPR036401"
FT                   /db_xref="UniProtKB/TrEMBL:D1YV27"
FT                   /protein_id="BAI60299.1"
FT                   /translation="MGSIKQTNIKSTGHALLRQHPDEFTTDFNANKAQVEKLTGVDSKT
FT                   LRNRVAGYVTRKVSSKGRRK"
FT   CDS_pept        225531..226418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0228"
FT                   /product="putative glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0228"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60300"
FT                   /db_xref="GOA:D1YV28"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D1YV28"
FT                   /protein_id="BAI60300.1"
FT                   /translation="MKVAVIIPTMNEPAISKVVDDARQALRHFDTEVIVVDKSLDDTPR
FT                   KAKKAGAIVVTQKESGYGNAYMVGFSSVGPDVDVVVMMDGDNTYDAYEIPMLIDPIVNG
FT                   PTDVCLGNRFARMEPGAMNARNRFGNRMITGVINGLYGLKLKDSQTGFRALRKSALDTL
FT                   DLDEDGMPFASEMIIDARKKSMRIAEVPISYRQRIGEAKLKAYKDGSLILSLIIRMVRD
FT                   YNPFAIFLTIGSLFILGSLLSGGYVVYEWLMNGVITHLALTILSAMLFMGGIQVISFGL
FT                   LADIITSALRAAKR"
FT   CDS_pept        226425..227552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0229"
FT                   /product="putative glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0229"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60301"
FT                   /db_xref="GOA:D1YV29"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D1YV29"
FT                   /protein_id="BAI60301.1"
FT                   /translation="MKIAFVSDVIYPYIKGGAEKRFYEFALRLSKAHEVHIYGIKWWDG
FT                   PPVLVKDGITYHGVCRPRTLYSAEGRRSIVEALAFGLALMWPLLKEKFDIIDCNQHPYF
FT                   SIFTCKLATMLRGGRFYVTWHEAWGDYWYEYMGWIGFFGKLIEKVTARLAGRIIAVSEG
FT                   TAAGLERLGVKKERIIILPNGISTAAIGGAPTGGEGADVMFAGRLIRDKHVDVLLRACA
FT                   EASRKMPLSVLIIGDGPEKGSLEALAAGLPLKVKFAGAVDEMALYSSLKSSRVFVLPST
FT                   REGFSITTLEALACGVPVITVSGEKNSARELVVDGVTGRVVGLGEKELSDAVLDVLGDE
FT                   ARRKRMAAECAPAARKYDWDGLSELLLECYAKQTN"
FT   CDS_pept        227593..228285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0230"
FT                   /product="putative dolichyl-phosphate
FT                   beta-glucosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0230"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60302"
FT                   /db_xref="GOA:D1YV30"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D1YV30"
FT                   /protein_id="BAI60302.1"
FT                   /translation="MISVIVPAYNEEKRIEQTLRDYSEGLKASGRDFELLIVCDGNDRT
FT                   AELAKPYGKVLEFGHRLGKGGGVLEGFKAARGEVVGFTDADNSLKVDQFLRLLDEMDRT
FT                   GAGCVIADRKSKESMIMESQYLFRRFASEVFNFMLSRAIFGLRIRDSQCGGKVFKREYI
FT                   DRVAPSMACKGFEFDVELLWRLKNAGCDIKEVPVVWKDDKASTFSFKYVPSMFFNLMKV
FT                   RLGLYKKA"
FT   CDS_pept        228471..229256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0231"
FT                   /product="conserved hypothetical protein"
FT                   /note="Belongs to the Protein of unknown function DUF849,
FT                   prokaryotic family (IPR008567)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0231"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60303"
FT                   /db_xref="GOA:D1YV31"
FT                   /db_xref="InterPro:IPR008567"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D1YV31"
FT                   /protein_id="BAI60303.1"
FT                   /translation="MVPTRKDSPYVPLTPEEIAEDTYRAYKLGVSSVHVHARDEAGNPT
FT                   YKKEVYGEIFSAIRRKCPDIIICASTSGRSDRSLEHRAEVLELRPDMASLMMGTVNFIK
FT                   NPSPNSQEDIVALAKRMEEHGVKPELEAFEPGFVNVAKYLASKGHLRPPLHFNLLLGSL
FT                   GSMPAEARDLVFLAGSVPPGSTWAATGIGRFQLQVNVASMLMGGHVRVGLEDSLYYSYP
FT                   EKSLATNEQLVERVARIARELGREIATPAEARAILGLDH"
FT   CDS_pept        229273..231030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0232"
FT                   /product="putative acyl-CoA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0232"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60304"
FT                   /db_xref="GOA:D1YV32"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D1YV32"
FT                   /protein_id="BAI60304.1"
FT                   /translation="MAELTCIHELLHGGQDGRSHAIEAPGRAPITYDQLRMHISGIAGA
FT                   LYGMGYRRNDRIAVVLPNGPDMAIAFLSVASGFTCAPLNPLYSRPELEFYLSSLGAKAL
FT                   ITNGEPSPAEEAARGMNIPVISLKSLYEAKPLGASQEFSEPEDTALVLHTSGTTSKPKR
FT                   VPLTQANICASACNIADSLRLGPGDRCLNVMPLFHIHGLIGALLSSVAAGATTVCAQGF
FT                   VAPEFMGWLRDLKPTWYTAVPTIHQKVLEMAKSDPGKYDSLRFIRSASSALPVPIMRSL
FT                   EERFGVPVIEAYGMTEASHQIAVNPLPPLSRKPGSVGLPWGTEAAILDGAGNMLTAGEA
FT                   GEVAIRGPGVTAGYENNPDANAAAFHDGWLRTGDNGYIDANGYLHLLGRLKEIINRGGE
FT                   KVSPFEVEEALLAHPAVKEAAVFPVPGGPLGEEVGAAVVSSDGVTAEALKEFLIPRMAY
FT                   FKVPSRIVIVESLPKGPTGKVQRIGMARRLGVSVERVADQAPVKTAPMTRTEAELARIW
FT                   SEVLRRGDIGALDNFLELGGDSLLATQVMSRIRRSFDVDVPIVRIIESENLSGLGRTID
FT                   RLKGERPNG"
FT   CDS_pept        231023..235030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0233"
FT                   /product="putative peptide synthetase"
FT                   /note="Similar to peptide synthetase AdpD in Anabaena
FT                   circinalis 90 (Q9K5L9)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0233"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60305"
FT                   /db_xref="GOA:D1YV33"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001031"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020802"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D1YV33"
FT                   /protein_id="BAI60305.1"
FT                   /translation="MDERQRIKPRVKDGPILASFAQQRMWFLEQMDPDNAIYNQLNALL
FT                   IRGQPDIGVLGRCLDEVMRRHEALRTNLIIENGQVLQHISPPKALDLHIVDLSGLSPVE
FT                   AMAEAERLAVVEAKRPFDLGNEPLIRARLFKLSDGEHLLTFVTHHAIFDGWSVNIFMSE
FT                   LAVLYGAVRESRPLPPEPALQYADYAVWQRERYDRGDFDEQLRYWQDKLGGDLPFLELP
FT                   ADRPCPPAQSFDGAVYTCDIPGDVADALKALARSERATLFMVLLAAYNVLLYRHTGQND
FT                   IVVGCPIAGRHYLEIEDNIGLFVNTLPMRNRLSGDMPFIELARSVRKTALEAYSNQDIP
FT                   FDKLVETLPLDRQPSRPPVFQTLFQMRNFPGRDIMVSDIFFERHFFNYSTAKVDLTFEV
FT                   TETKAGLSCRLVYPVAIFDERTIALLADHWLVLLRSIVQDPGQPIGRLAMLTPGERRLI
FT                   VHEWNDTKADYPVKAVSRIFEERARASPDTVAVAHDNERLTYEELNARANRLARHMDIS
FT                   PGATVVIYMERSIEMVICELAVLKAGGVYVPVDPSDPRPRTELMLKDSHAGLILVKTPP
FT                   SGLQLPDECRMICLEAEREAIGLLQDGNLAVSPSVKSTAYIMYTSGSTGQPKGVRVPHR
FT                   GICRLVINTNYVHMSPGDTVAHISNPAFDASTFEVWGALLNGARLAIFDRDTVLTPDMF
FT                   AAHIAEEHVDTLFVTAQLFNLYSREAPGAFKSVRDLLVGGDVVEPTPVKRVLEHGRPRR
FT                   LLNAYGPTENTTFSTWYLIREPVENSIPIGRPISNTTAYVLDEYLEPVPVGVTGEIYLG
FT                   GDGVSQGYHGRPDLNASAFVPDPFCSGSMLYRTGDLGRYLPDGNIRFLGRRDSQVKIRG
FT                   FRVEAGEVNALLGAHPSVKASLIAVNEVRGERQLVAYVVPLDGRGIEEGDLREHMRAKL
FT                   PEYMIPVAFIPIETIPLTPTGKVDYLALPVPGDLSHGNGGELRDELEYELAEIWEDVLG
FT                   IDNAGTDDNFFGLGGHSLKAITLCARIGEKLHVKLPVNTIFLAPTIGRMARAIRELKTF
FT                   NPPLLIKNGPVRPPLFCIIAIGGTLAEYAPMAAEFEKGRQVYALQMPWHDEGLVPGSIE
FT                   ELARRLIEDVKAVQPHGPYNLLGYCAGGAVAYEMAARLRSAGEEIGFLGLIDLVPPGYH
FT                   YRLDSRSLKILAGRFPIVLSNIALAPPGQRLARIWGIPAMAGQFLSNLAHREPGDGSRA
FT                   ARSYPEWLMAMPGPYHETTLAAFEIYKKYVFRPYAGDVVLFFSRKTADNFKDALYAGPA
FT                   LGWEKYVDGALKVHVVPGDHETMTRPPSAKELARAVEEYLATDKSPGGGAT"
FT   CDS_pept        235027..235671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0234"
FT                   /product="phosphopantetheinyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0234"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60306"
FT                   /db_xref="GOA:D1YV34"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="UniProtKB/TrEMBL:D1YV34"
FT                   /protein_id="BAI60306.1"
FT                   /translation="MTLEMPGPGEVHVRVVSLEHSTGELPMECLDEGEMDTFRRFRRET
FT                   DAGRYLAAHEALRHILASYLGIEPDAIRYVRGPHGKPYLEPAIHGGRLRFNLSHSGGIA
FT                   AIAVTDGLDVGVDVEQVRDMEFEELASCAFSRDEQAALGNNNIDSGVFFRLWTRKEAYL
FT                   KATGLGLSVQPNEATIGEGWSIIDIDPAPGYAGAVAVEGPIARVSVFRPPE"
FT   CDS_pept        235704..236831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0235"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0235"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60307"
FT                   /db_xref="UniProtKB/TrEMBL:D1YV35"
FT                   /protein_id="BAI60307.1"
FT                   /translation="MDASRTDIVCFSDIFWDFVWQRHQSLLTRFPEGWNILFVEPTSLV
FT                   VLLKEPRRLLARKHGNITVISSPALPLTDKVSILRPVNDIFIWCWLKAMFLKHNITRPV
FT                   LLYYAPRFSSLIGRLGERLATYDCADDRMAFSREPHWMGPYVENLFKKSGIVFVTSESL
FT                   RKKALGYRSDNVHLIGNGVDAGLFEKAWGDVPVPDDIKWLKKPIIGYFGVIDEWMDIDL
FT                   IVRMASAYPEASIVLVGPALIGPEGLQKLKSLPNVYLPGQKPHDALPGYLKAFDVCIIP
FT                   FRINELTKSVNPVKLYEYLAGGKNVVTITMAEVEKYDGTIYIARDHDDFIRKTADALRN
FT                   KPDADRMKAVVSENTWDSKAKAMVEIIQRSIDTHG"
FT   CDS_pept        237031..238221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0236"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0236"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60308"
FT                   /db_xref="UniProtKB/TrEMBL:D1YV36"
FT                   /protein_id="BAI60308.1"
FT                   /translation="MGSPLTKLLSRTFNRVSPSGEPAPKNVEAYRAALNEILKEREGKI
FT                   KGIIVYPPTVDWNIPLFQRPQQLALELSKSGYLFFFSTGKNLYDRVDGFRKINDNCYVT
FT                   NQYDLVIKELPKFILLLSSTNLGVLLEDVARMKGKATVVYDYIDEIHRDISKENVDHAF
FT                   KRHEYMKRHADVFIATADNLYNEALKDRPKDTYLIPNGVDYDHFHVQRNPANVPLDLAP
FT                   ILEKKKPVIGYYGALASWFDYELIKKAAETRTDLEFVLIGWDYDGSLYKQGLDQYRNIH
FT                   YLGIKDYSILPQYAVWFDVATIPFVLNKITESTSPIKVFEYMALGTPIVTTNLRECRKY
FT                   RSVLIGKDQGDFLRQLDEALRLRDDTGYKALLDKEAKENTWDKRAAEIVERITGKH"
FT   CDS_pept        complement(238247..238903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0237"
FT                   /product="hypothetical protein"
FT                   /note="Contains one Methyltransferase type 12 domain
FT                   (IPR013217)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0237"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60309"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D1YV37"
FT                   /protein_id="BAI60309.1"
FT                   /translation="MGSIVHLLSMELFGESIPLSEFPVRKDITGIGMSDWDVYTSRLAK
FT                   KLGYTNTFYHKEPKLDIISVDDIQNGKYDFIISSDVFEHVVPPVSTAFYNTGKLLKRGG
FT                   VLIFSVPYISTPGHGTVEHFPDLYQYKIINMRQGKILKNITAEGVSQTYTNLTFHGGKG
FT                   NTLEMRSFSESSLWDELRKAGFKDIKKYNQSYKEYGIVWTDEHITHCSPPLTARI"
FT   CDS_pept        complement(239170..240123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0238"
FT                   /product="putative glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0238"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60310"
FT                   /db_xref="GOA:D1YV38"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D1YV38"
FT                   /protein_id="BAI60310.1"
FT                   /translation="MGSLVSVVIVNWNGLKYLRECLDSLFAQSYANREIILVDNASTDG
FT                   SPDFIRKNYPMVKVIESSSNLGFAGGTNRGIKEAKGELIALFNQDAVADKNWLEILVKA
FT                   VNSSNDIAAVAGKIFYWGDEQERKKVFCTWPKVDPRKALAYNFFDERPAADVDYLPGCA
FT                   MLIKKKALDEVGLLDEDYFLYFEETDWCARAIMAGYRLVYVPDAKAWHVVSGSIGSGAK
FT                   LSYIMRNRVRFALKNFDSSYLPVFVVEFTKETYKMMINGIHGQGFDDFIVRMKALFWNG
FT                   FHLIGTLKARRRDLSRIANRKSYNRSLPLSNIEWEY"
FT   CDS_pept        240270..241175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0239"
FT                   /product="putative glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0239"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60311"
FT                   /db_xref="GOA:D1YV39"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D1YV39"
FT                   /protein_id="BAI60311.1"
FT                   /translation="MKTTLVVPAYNEEEALPKTFEEYMEYVDEIIIVNDGSQDNTDGIA
FT                   RDYASKNDKIKYIKHDTNRGKPEALKTGVEHSTGDILIFTDADCTYPARYIPEFVKRIN
FT                   MGADMVLGARVFNTTNIPRFNRIGNIIFSLLITYFCYTRIMDAQTGYRAMRTSIFPELD
FT                   VTAKNLEYETKMTMRAAKLGYSVVEVPIEYRKRVGKSKLNPFRDGFRMLNSIPSTIWQE
FT                   STFILKSVILINILLFCLGLLFGLYSIYEKLAVGVLSHEYYPLLAVVLILTAMQLMSFS
FT                   LIMEFIVNKLNKIEDLVKKY"
FT   CDS_pept        complement(241181..241531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0240"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0240"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60312"
FT                   /db_xref="GOA:D1YV40"
FT                   /db_xref="InterPro:IPR000390"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:D1YV40"
FT                   /protein_id="BAI60312.1"
FT                   /translation="MNKVIIDILIGIVFASFGQLFFKVGANNVGEISFSNLLQLFNVYI
FT                   IVGLILYAIGSVFWIIALSKADLSYVYPFIALTFIVVYAFSILVLKEPFHAGRMIGTAI
FT                   IIIGLCVLVAFD"
FT   CDS_pept        complement(241528..242082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0241"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains one Methyltransferase type 11 domain
FT                   (IPR013216)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0241"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60313"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D1YV41"
FT                   /protein_id="BAI60313.1"
FT                   /translation="MPEELLEPFFRKLRVGLVLQHLDKDTTLCDLGCGSGSFLRSVSGD
FT                   IRAGYGFDKKAEEETFGNITIKNSFIDGKVPLETGSMDCVTLIAVLEHLDRPEDVLGEC
FT                   YRIVKNRGKILITTPSPASKPILEFLSYRLKIVSPVEIRDHKHYYSRSELKTILEECGF
FT                   TGVQVRSFEFGLNNFAIGHKQ"
FT   CDS_pept        complement(242157..244133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0242"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0242"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60314"
FT                   /db_xref="GOA:D1YV42"
FT                   /db_xref="UniProtKB/TrEMBL:D1YV42"
FT                   /protein_id="BAI60314.1"
FT                   /translation="MIIDYSIFFLSYVCWFIALVGFGSVSVDFIKKTFHIDSDGEHLSL
FT                   LTYGIAGMAVVTTLATLINFFMPISLTVTIVLLFFGIGLFFFNRKSILTYLSWFEKVLI
FT                   STLALLIFMIIPFAWVSWFDTGMYHLPAIKWIIESQAPLGLANLHGRFGYNCSWFMLSA
FT                   CIDQWVIILNKPFFLVNGLIMFFYASAILLIVKRKIFPARLDKAGDISRHKGAKDKNIE
FT                   IGLSDLFLIFSSIALVYPGLMMLTSSSPDLPVMIITLFVIYLAIYVLERTQNDNFYLFF
FT                   AILLVAYAITIKLSSIALIVSLPVFLFQGTIESFKNKGKILDIFNDGMKEILNVLLLAI
FT                   LLLLTLPWMIRGLLLSGCLFFPFRIVYFSGLKWAVPPLLCTSEINWTTAWARLPSNDAL
FT                   TALSGWGWVKPWLERYFNIFGWSHMPLSRQIIIGTELDDFIYSLTQNIIISFIYPIAEL
FT                   VVPFIIFISGLLLIFYYIVFKKERLSNISLNKTACIIPMAISIIGIAFWFYSAPDLRFG
FT                   IGFVYSLVLLTFSIPVYIYLFSKPRGQQLQTNVVQKRMKIIVIVLSAIILIYGSCIAIY
FT                   YSTNTHGWGSDGFNFPQIQLDGYKTVDGTTIYISSGQYQLFWNGPLPNTPYFNASLRSH
FT                   ISNSTGLPDMFWYDDKNGLPIIL"
FT   CDS_pept        complement(244186..245304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0243"
FT                   /product="putative acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0243"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60315"
FT                   /db_xref="GOA:D1YV43"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:D1YV43"
FT                   /protein_id="BAI60315.1"
FT                   /translation="MTVENDTHKSNNFDFLRVFAALLVIFSHSFPLSGIHTEPLGAITG
FT                   YMTCGALGVAIFFIISGYLITKSWMEHPSAIRFLWNRSLRIFPGLFVVTIICILVLGPL
FT                   VTNLSLSEYFAQAEYLWLYLKNTTLLSISFYLPGVFTNNPYQVAVNGSLWSLPIEFGMY
FT                   LLILALGLLGLLRKKEFLLLLASCTIIVFAFNNIPELATIKPIVDLFDAISILGFLTSI
FT                   STGIAIMFMIGAIYYLYKDSIVYNGWISLTLFVALCLSFKTNFFQLASLICLPYMIIWA
FT                   SQVPTRYIKNTGKYGDFSYGLYIYAFPVQQLIMNYFNGISWLELFILAVPATFICAFLS
FT                   WHLIESNFLKLKKIDLQLLFETMIKKISPKIA"
FT   CDS_pept        complement(245323..248166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0244"
FT                   /product="hypothetical protein"
FT                   /note="Contains one Methyltransferase type 11 domain
FT                   (IPR013216).; Contains two Glycosyl transferase, family 2
FT                   domains (IPR001173)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0244"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60316"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D1YV44"
FT                   /protein_id="BAI60316.1"
FT                   /translation="MPDILRAIRYEPNTIDPENKNTSHGLIIDLVGRNKAVLEVGNSTG
FT                   YLSKIFRENGNRVTGIDIDREAGSIAQQYCETMVFGDIEIIDLDAYLKDSYFDVIVFGD
FT                   VLEHLKSPEQILIKVKKYLKSDGYLVVSLPNGCHGDIILNLLFGDFRYTPMGLHDVTHL
FT                   RFFGWKNILDMFNDHGYMVINVNKVRVPVGNTELKVDKDKVPDDLFNFIKSIPDSDVYQ
FT                   YVFTAIPGDIKNNTGNEQTPIIQLAPIFNSAIEGTLEKRVELLKEEILKVSAENQELLR
FT                   DIERLDDQNSTLKRELSDMRQSSIWRLVMAYHNGFVERFLPHDTRRRKAYDRILISARK
FT                   LVNGGLGGLSKKYSHHKKNKAMIAAKPKFPRIVENSVPPYKRIRQIKNYPLISIIIVTY
FT                   NSERFIGNAIDSIIGQNYPPASTEIIVVDNNSRDKTAVTVNEYMEKYNDKIKIKLVETN
FT                   KNNGFGKGVNIGVLNASPNADYVLLFNPDCKLYKDTLTELISAASATISDGYRLWECRQ
FT                   MPYEHPKHYSPVTLETSWSSGACCLIHKDAFENVGGFDENIFLYMEDVDLSWRLRMNGY
FT                   KLMYLPFARVQHDTYSEANVVKSAQYYNSVLYQFYLRYKYGNREDIKWYYKEYFRLLNN
FT                   VPNKLPYERSKLIEQFVKHSLLIPKALAFRIKNRKALKSFKPWFMDYDFEFRREGAFVK
FT                   SDIDMEDPSLLPKVSIIVRTIGRKGFLREALTSIRNQTYGNIETIVVEDGPATVKEMLD
FT                   QEFSRMDIKYFALGENHGRCRAGNFGLNKCTGEYLRFLDDDDLLYPTSIETAVCFMLKD
FT                   DGEHRLMYDLSFEVPTEIISEDPFKYREFDYRLTYDQNFDRNILSIHNYMPIQNVLFDR
FT                   ELYELYGGFDESLDALEDWDLWIRYSQHTDFFKIPKITSLYRVPAVENDIEKRQVKLDK
FT                   YYKIVKEKYNLPIGQLE"
FT   CDS_pept        complement(248197..248973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0245"
FT                   /product="ABC transporter ATP binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0245"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60317"
FT                   /db_xref="GOA:D1YV45"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1YV45"
FT                   /protein_id="BAI60317.1"
FT                   /translation="MPLLLKEKSKLDEESAIVVNNVSKCYRIPMEKKRTVYENIIGMFS
FT                   GNKSYEEFWALKDVSFNIKRGETFGVIGPNGSGKSTLLKMLAGVLYPDSGSVKVNGRIA
FT                   PFLELGVGFQYELTAKENIYLYGAIMGLTKKEVDRKYEDILDFAELKRFENMKLRNFSS
FT                   GMYVRLAFSIAIQTDPDILLLDEVLAVGDEHFQKKCMEKIEDIRKSGKTIVFVSHSLPS
FT                   VNSLCQKSLLLNSGMIVAMGETNKVIQKYQQMANQI"
FT   CDS_pept        complement(248977..249744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0246"
FT                   /product="ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0246"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60318"
FT                   /db_xref="GOA:D1YV46"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:D1YV46"
FT                   /protein_id="BAI60318.1"
FT                   /translation="MSLYDYRELIKNLVVSDLKVKYANSMLGFAWSLLNPLLMMLVLYF
FT                   VFSNFFGSGGSFVLYILTGLLVWRFFSIGTSAALASVVGKPSLVTKIYIPREILPLSST
FT                   LSSLISSVLEFCVLVPLLFIFGIGLSPAILLFPVLLAMFFLIVYGMALILSSLFVYFRD
FT                   LNNIWDVLMQVGFFACPIMYPLSQLSKLPEQIKTLYMLNPVTLLIEMYRDIFLEGTVPD
FT                   LWSFAIVLVFGVVLVVFGNAVFKRLQRRFAEEV"
FT   CDS_pept        complement(249758..250735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0247"
FT                   /product="putative glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0247"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60319"
FT                   /db_xref="GOA:D1YV47"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D1YV47"
FT                   /protein_id="BAI60319.1"
FT                   /translation="MPLASVIVVNYNGKQYLKRCLDALLDQTYRNVEVILVDNGSGDGS
FT                   VDFVRSNYHTVQIIDNVKNLGFAPANNVGIRAARGELIATLNNDTMAAPGWLEALAGEM
FT                   ISNERVGMCASKMLRMDDPTIIDSTGICISRSGACWDRGMFEKDEGQYEAVVEVFGPCA
FT                   GAALYRKSMLDEIGLFDEDFFSYMEDTDLAFRGRLAGWKCRYVPNAIVRHVHGGTAGYV
FT                   SDYTVYYGNRNIVWYALKDFPPGLLVTSLPFIAGRSMGVIPYYVLKGHGKTILRAKWDA
FT                   LTGAPKMLRKRRKAKKNDINKFIRTWADIKKPPEAYVKAEGGLS"
FT   CDS_pept        complement(250747..251820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0248"
FT                   /product="putative glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0248"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60320"
FT                   /db_xref="GOA:D1YV48"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D1YV48"
FT                   /protein_id="BAI60320.1"
FT                   /translation="MRVAIFHDYFSFIGGGEKLILTLARHLGADVITTEANPELISRMG
FT                   FDDVRVISLGPLVKIKPLKQIQATYKFATCDFRGKYDFFIFSGNWAHHASRLHKPNLFY
FT                   CHTPVRVFYDQRENFLSSLGPAQRAAASAWIALHSRSDRRSVARIQHIVCNSRNAAGRV
FT                   KKYYGRDADVIYPPVDTGRFAYKGDEGFWLSVNRLYPEKRIELQVRAFEQMPGERLVIV
FT                   GNSGTGDHSAAYAEKLRASLPHNVRILSDLPEEELIDLYGRCRGLIATPLDEDFGMNAV
FT                   EAMASGKPVVAVREGGYLESVVDGVTGMLIDADSSSIVKAVKDVSRDPSKFREACAEQA
FT                   RKFDISVFLARMEAMIP"
FT   CDS_pept        complement(251875..252543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0249"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0249"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60321"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:D1YV49"
FT                   /protein_id="BAI60321.1"
FT                   /translation="MGVLDMLMGKRKESGPADIAGLFDQSIKDVEDPRTIGESPALNKA
FT                   IMEYQSPENVDKGQIFTFDSEIKRAPDFYLPYYWAATYHFDKGNFDEAKKILLEGIKNC
FT                   RIKSVLCRRLGEFCLQNGDVDGALYWFFTTVMADTSSIDYHAYLYLAYIFEVYGMKKAE
FT                   SWSLRRARGISYKILMQAAEYSAKKKEKIKGFAGAHKSEAIAKKLDDFYRYAKPALKAL
FT                   "
FT   CDS_pept        complement(252594..253769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0250"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0250"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60322"
FT                   /db_xref="GOA:D1YV50"
FT                   /db_xref="InterPro:IPR002372"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR018391"
FT                   /db_xref="UniProtKB/TrEMBL:D1YV50"
FT                   /protein_id="BAI60322.1"
FT                   /translation="MQGNTLVKAIIAVAVLIFISALALTAYKSGGAALNWQMEEVQKIY
FT                   PSDDGLYVISSSNISLVDASGTALWSVPYQGAGLSTYGGGRLLVYSSASGLSAVGKDGN
FT                   ISTLTAQSMNYPPVVGPDGTIFVRSWSLLSALDRSGSEMWNITDVISAPVVDGRGYIYF
FT                   FRRPAESVTDVYLECVSPDGSLRWSIQYPKFTAGTKLLPASSGGVTVYDEPGGILARLS
FT                   GSGNVSWDHTMPYLGEYTLLQDEYDRLYMFYEFGTVHVVNDRGSLAGKFNPVNAYNANL
FT                   SHMPAVRNGTVYVIGDGDASATLYALSIDGSLKWERTFNTTSPGAIYAGQDIVCVGADT
FT                   ESGPVLYVVGEGGSLKFTYKSGDGSGWAQVYVDNGTIYAKTCGGRLYALKG"
FT   CDS_pept        complement(253873..255306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0251"
FT                   /product="truncated threonyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0251"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60323"
FT                   /db_xref="GOA:D1YV51"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002320"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/TrEMBL:D1YV51"
FT                   /protein_id="BAI60323.1"
FT                   /translation="MSKAKNREDVVKSISSRHFIVTPDGAEIPLDLTKPEDVLNVLKDI
FT                   GCKPLESYVVSEELKMPPMKEPPSIKIMQGHELVGYEPSSDSGNFRFYPKGYLIFELLR
FT                   DWAYDIAINRFKAIQVDSPLLFDWDDPQIKEQAGTFHERHYTVKAPDHPEKDFILRFAG
FT                   DFGLFKIMKDATISYRNLPLRMYEFSKSFRYERDGELSGLKRLRAFHMPDIHCFCRDID
FT                   EGWNEYQELYRNYADLCDASGVEYAVVFRIVDSFYLQNKSRIADLVKYSNTPAFVEVLS
FT                   DMKHYWAVKNEFQGVDSTRSCIQLSTVQLDVKDAAVYGIDYTDSDGKKKGCIICHSSIG
FT                   SIERWYYSILEEALKHETPTLPAWLSPTQVRIIPVSEKQLNYCKYLDIDGVRVDVDDSD
FT                   DTLSKKIARASMEWVPYVAVVGDKEVESGLFSVSIRQSGKRVSMTRDELALEVKKKCAG
FT                   RPYRPLPLPKLLSQRPVFR"
FT   CDS_pept        255436..256098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0252"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0252"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60324"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:D1YV52"
FT                   /protein_id="BAI60324.1"
FT                   /translation="MSQTLQFEIDPLRISGDFVGSVLVAVDVMAYSREDYPRPDAPVCL
FT                   IAAAHTGGLSSISKAYTKLFIAGAPTLPEEKLIIRDFAAYLDMFDGGTLAAHYGALDSP
FT                   DEGFDVPYLLARAKSQHPEVYVSLRRPLNKLKRHDTCAYVKENMNLPSAELDYVESYYG
FT                   LARKPDAIIPDVKAAMDSYWRSGDASALKSGLANAYNCLRIAQSQIKKTICCTDIPL"
FT   CDS_pept        256204..257391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pan-1"
FT                   /locus_tag="MCP_0253"
FT                   /product="proteasome-activating nucleotidase"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0253"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60325"
FT                   /db_xref="GOA:D1YV53"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:D1YV53"
FT                   /protein_id="BAI60325.1"
FT                   /translation="MAQSRDLEKEKQSIQEELDLLKLQYEELKSRLFESTIMNSNNLKE
FT                   IQRLQQEVAHLRRTPLFIATVIEIVDGGMVLLRQHGNNQEVLTKPSDEIMGKLTLGTRV
FT                   AVNNSLAVVKILEKPADVRARVMEVIEAPGVSYEDIGGLEDQIREVVETVELPLTEPEL
FT                   FASVGIEAPRGVLLYGPPGTGKTLLAKAVAHASKSTFIRMSGSELVHKFIGEGAQLVRD
FT                   LFQMARDKAPSIIFIDELDAVGGRRTHDGTTGSAEVNRTMMQLLSEMDGFTDRGNVRIM
FT                   AATNRIDMLDPAILRPGRFDRIIEIPLPDDKGRESIFKIHTRKMTMDADVDVPKILKEM
FT                   TDVSGADIKSIVTEAGMFAIRRRSKSVSGDDFDKAIKKVIHKEEVAVAPPNTVYA"
FT   CDS_pept        complement(257438..260098)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0254"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains one Pyruvate phosphate dikinase,
FT                   PEP/pyruvate-binding domain (IPR002192). ; Contains one
FT                   PEP-utilising enzyme, mobile region domain (IPR008279)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0254"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60326"
FT                   /db_xref="GOA:D1YV54"
FT                   /db_xref="InterPro:IPR002192"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="UniProtKB/TrEMBL:D1YV54"
FT                   /protein_id="BAI60326.1"
FT                   /translation="MERYVLYFSEIDKASLPEVGGKGSSLGEMTKAGYPVPGGFCITTA
FT                   AYRKFIRSCEEMDELIDLLEGIRHDDLGRIHELGESVRKCLRSHQMPDDIRESILEAWK
FT                   LTGEDKAYAVRSSATAEDLPTASFAGQQETYLNVRDGERMLHAIRDCWASLFTDRAISY
FT                   RARSGFGHGRVYISVVVQEMVFPEVSGILFTADPITGRRRTASIDASFGLGEALVSGVV
FT                   TADHYKVRSGVIVEKRIAKKAVAISPLPEGGTVKKDIPPERQEAQALSDEKIVELARLG
FT                   EGIEAHYGTEQDIEWCLADGKLYVLQSRPITTLFPVPRIAGDGLHVLISFGHVQMMMDP
FT                   IRPLGISVLKSFLKFAKPSPESDIVVEAGGRLFIDPTPLLVLRPAQHLAPRILAVMFDE
FT                   RMAASLREVFGRSDFRRAKRIKIGTLIKAALAVLPGIGKAILIVLFADPARGRDYLVAS
FT                   TGQLWIAREREISSVSGPVRIRLIQDGLEKLLPTLFPMVFPYLIAAIPSSRIIHGMLKS
FT                   QYGEKQGAHMFSRLNRSLPGNVTTDSGLAVGDLADVARKYPEVVDYLRRAKDETFYAGL
FT                   LEVDGGAEFKRALDRFMDQYGVRSPGEIDITNPRWKDSPALLVPPILSHIRSVGPGEHR
FT                   ERFERGEEDANLAAAEILSDMGKARLGFFKAKAMSRLIHVYRNLMGMREYPKYLIMQQF
FT                   YVFRQGILGEARSLVEAGILAREKDVFYLSLDELLALEEGHFSGNVGEIVALREKQREQ
FT                   FQKLTPPRVMTSEGEAITGKRQATGEPEGAIIGTPASAGVVEGIARIVLKPEDAKLSPG
FT                   EILVAPYTDPGWTPLFNSAKGLVTEVGGMMTHGSVIAREYGIPAVVGAENATSLIKDGA
FT                   RIRVNGNEGFVQILD"
FT   CDS_pept        complement(260188..261699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0255"
FT                   /product="ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0255"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60327"
FT                   /db_xref="GOA:D1YV55"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="UniProtKB/TrEMBL:D1YV55"
FT                   /protein_id="BAI60327.1"
FT                   /translation="MSPLRILSLARRIITQCLRDKRTFGLIIIVPSIVMALLGYFYTAS
FT                   TTQVVTIGVVNEDLGLGSVMLSHDVVDKLREQGNITVVELSRADVNQSLKDKKIDGAII
FT                   FGPGFTEDVLVDQTVYASIVTEGTDQGKSASVNMKAHNATIAALTSAMQGGAGFSMNLS
FT                   LPAMPAGNLTNTSLRIGVLNQDEGLDGIILSDTLIYELLEQGNLTVVSLEGPDVNQSIK
FT                   DKKLNAALVIGPDFTRDIYEEHAVNLSVMAMAPDPRNISAYQQGLSLLSSKLQNATVAA
FT                   LSNVKKNDFTVNVDSSVIYGDGFAMLDLFAPYLLGVIAFAFIFIFTGVTFLRERSFGTF
FT                   ERLLVSPITRSEIILGYMLGFSVFAIIQSMIILAFAVFVLNVKIVGNIYDVVALQLLVT
FT                   LVSVNLGIFCSSFAKNELQAVQFIPLLILPQIFLDGMFWPISTLPNYLQVFSYLMPLTY
FT                   ANDALQNIMVRGLGLGDVLIDIVVLLAFAVVMVALSALSLNKRLQ"
FT   CDS_pept        complement(261696..262433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0256"
FT                   /product="ABC transporter ATP binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0256"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60328"
FT                   /db_xref="GOA:D1YV56"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1YV56"
FT                   /protein_id="BAI60328.1"
FT                   /translation="MEKRTEEYIIDCSALSMRFGKITALDNVDLKIPYGENYGLLGPNG
FT                   AGKTTLIRILCGLLKPTGGSASVMGRRQPDRRNNLSIGYMTQMDALYSDLTIRENVRFF
FT                   ASLYGQQGHEREKCIDDILDITRLSDRQNSIVSTISGGMRKRASMACVLVHRPKLLFLD
FT                   EPTVGVDPQLRCELWKYFHYLNNEGVTLIVSTHVMDEAEHCNRLAFIRDGRKLIEGSPA
FT                   ELKEYTSCDNLEAAFMKFSEGGQ"
FT   CDS_pept        262568..263359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0257"
FT                   /product="putative TrmB family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0257"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60329"
FT                   /db_xref="InterPro:IPR002831"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D1YV57"
FT                   /protein_id="BAI60329.1"
FT                   /translation="MNSISNGLVESLKMLGLTEYEAKVYSALVMFDRAEVKQVYEYLDA
FT                   PKPSVYQSLRSLTDKGLVQVVNSKPAIYRATPPKIAIKHMMEAHRKAEDMALQELEEIE
FT                   KSRVESDYPDVLWTLYGEENIEHKMEEMLGKAKHSLVMILPRDHVHYLDMLRGKDISAE
FT                   LIVFGSDVKAAVESYGLKNAKVHDAFSIDLSDLHMLLKYFEAFPLPPDRIDKFLLVAAD
FT                   NQEFMYIPPIPGPIPSGMTSRNQFVLALMNTVFHILWDRTS"
FT   CDS_pept        263484..264164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0258"
FT                   /product="putative geranylgeranylglyceryl diphosphate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0258"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60330"
FT                   /db_xref="GOA:D1YV58"
FT                   /db_xref="InterPro:IPR008205"
FT                   /db_xref="InterPro:IPR026438"
FT                   /db_xref="InterPro:IPR038597"
FT                   /db_xref="InterPro:IPR039074"
FT                   /db_xref="UniProtKB/TrEMBL:D1YV58"
FT                   /protein_id="BAI60330.1"
FT                   /translation="MIDWKKWRHVTKLDPDKPITPKAVAEIVDSGTDAIMVSGTQNITK
FT                   ENVARLVDMLAQYNIPKVLEPAGTPGMRSDLDFAFIPSVFNTKNPKWLVGAHKDFVRDF
FT                   QIDYWDKIIPEAYIVLNPFSAVALVTRAQTGLGPKDAAAYAEVADRFFNFPIVYVEYSG
FT                   VFGNPELVKAVKEKLHNSVLYYGGGIDCREKAEQMAKYANTIVVGNAVYKKGGVEMLKE
FT                   TIVK"
FT   tRNA            264230..264302
FT                   /locus_tag="MCP_t0007"
FT                   /product="tRNA-His"
FT   CDS_pept        264347..265435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0259"
FT                   /product="GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0259"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60331"
FT                   /db_xref="GOA:D1YV59"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006074"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR031662"
FT                   /db_xref="UniProtKB/TrEMBL:D1YV59"
FT                   /protein_id="BAI60331.1"
FT                   /translation="MTLEEEIRAIQEEMDKTQKNKATEHHMGRLKAKMARLKDELIKKA
FT                   IASRGGGAEGYSVKKSGDATVTLVGFPSVGKSTLINKLTDAHSEVGSYDFTTLDVIPGI
FT                   MEYKQARIQVLDLPGLVKGASSGRGRGREVISVIRGCDLIVLIIDVFNYQHMKVLEDEL
FT                   YDAGIRINQRPPDVTITKLVKGGITITSTVELSIDHETIKTVLGEYRMHNALVNIREDI
FT                   TADQLIDVVRGNRVYIPCITVVNKIDLVDKEHMKSFPKDALKISADMESGLDALRDEIY
FT                   DSLGFINIYLKPQGEPADMDEPLIMRAGCTVGDVCDRLHKDFRRKFRYARVWGDSAKHA
FT                   GQRVGVDHGLEDGDVLTVIIQK"
FT   CDS_pept        265611..266132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0260"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0260"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60332"
FT                   /db_xref="GOA:D1YV60"
FT                   /db_xref="UniProtKB/TrEMBL:D1YV60"
FT                   /protein_id="BAI60332.1"
FT                   /translation="MRFNKDNYAQMSIDFLIGITIFILAFLFVMMSIPQMFTPFQSNSD
FT                   ELTMIADRVASTLVENTLAYRVVETDTILTSIIDIDKFDNTYKTDPPTLLYSEVGLDNQ
FT                   KYCIEIDIEQLKVDNTIHVTDSIIDTTHPLGNQNVGQSRRFVIIRSPDENNGWTDTKAV
FT                   IVVRIWQWAY"
FT   CDS_pept        266120..266734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0261"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0261"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60333"
FT                   /db_xref="GOA:D1YV61"
FT                   /db_xref="UniProtKB/TrEMBL:D1YV61"
FT                   /protein_id="BAI60333.1"
FT                   /translation="MGVLGDNGQISTVEAITAAIIMISVIVLVVQATSVTPLTSSFTNQ
FT                   HIKLELQNIGMDVLTTLDETPSVNDGNHDTQSMLKKSVTDWINNYYCDWFTWANNADKY
FT                   KSQTNPLNPSLNIPLGDQLSYLLAYYGIAYNVEIRYSDINNNVKITKMIWNGNPSDNSV
FT                   TVSRFVVLHDEDILYRDLIPNFGLTTDFYNIVEVKVTLWVM"
FT   CDS_pept        266736..267971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0262"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0262"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60334"
FT                   /db_xref="GOA:D1YV62"
FT                   /db_xref="InterPro:IPR008964"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:D1YV62"
FT                   /protein_id="BAI60334.1"
FT                   /translation="MREDSGQMMLINAFMLVIVIVTITLMLNNIIYSSNMAYAGFMDQS
FT                   RYDDISLKEATAKEASHAYSIYITHPSNYDYDKHIDDYERALNNLMSLKGRYVEITSTE
FT                   YPTPSQTLGISVETMTTMTTYGNDAKLSYVLYTGDDGKTPPTPTPIAYGDVAKVELYQS
FT                   KVSMVSSPDANVLKDYVILRAVVKDASGNLIPNKAVQFQLDDREDDKGQTIPADYAFLN
FT                   LDLSTPPPPPPTDSSGQVRIAYVDKKIDAGTAYISATCDGIKSSTVQIAVSPPLCDSHN
FT                   IDFYDPIIIPVDNNPNKNKGRYFVILPVKFVGFLNGKVMTDIDAGVSDNIIIKTSPVFY
FT                   TNYKSSYNDVIVTEIQLDDENDLSTYWLELTFEVQATCTQCTPNRPYDKIWTVTITREK
FT                   QLMPPPTPTNPP"
FT   CDS_pept        267986..268525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0263"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0263"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60335"
FT                   /db_xref="GOA:D1YV63"
FT                   /db_xref="UniProtKB/TrEMBL:D1YV63"
FT                   /protein_id="BAI60335.1"
FT                   /translation="MSRIISKNNEGVNIILEYLLMMVITIIMFSTMVLLLNDIQNRTDR
FT                   IVLNEEFEIISNDIANRLSTFSSELYLNQHMDDDEKAIIDDQNAGRPDQEIYFDLPELV
FT                   KGKQYNVKIEHISGNIYTVTVASTSNSDIVSKTTFSNKAQDDLISINEIEFNSQPGKYM
FT                   ISYDKDNKLITMVGIG"
FT   CDS_pept        268522..269316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0264"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0264"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60336"
FT                   /db_xref="GOA:D1YV64"
FT                   /db_xref="UniProtKB/TrEMBL:D1YV64"
FT                   /protein_id="BAI60336.1"
FT                   /translation="MREIIYSDEAVSESLGFVLIACIITFAISLVIMLGYPVYVNSINE
FT                   AHMQNMEEGFYLLSTNGNMVAMYQSPAQSSELKLDNGALYTRIDGEISVICKDSANNVI
FT                   NPFDTPYPLTSLEYQLGNMRIAYDLGGVFKKDGSSSIVLKEPPIYYKTALVVPVITIQN
FT                   SIGSISGKGLTRITLNSPYSSKISSTVSYQNAKIYTHVKSVQINIKCDYNDALQRYFKD
FT                   SQGSLQFDSAIIDSNGVLIATKTYPTDITVYITPSYVNVKVN"
FT   CDS_pept        269326..270852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0265"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0265"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60337"
FT                   /db_xref="GOA:D1YV65"
FT                   /db_xref="UniProtKB/TrEMBL:D1YV65"
FT                   /protein_id="BAI60337.1"
FT                   /translation="MTDNVIGSGNMRIFDSEEAVSEVFGYIIILGILIAALGVILIYES
FT                   PSIQDTKDSGQMSQNEQAFTVLDSRLSKARFSTSIFQEVPFKVTDGTVKVDDTSSKITV
FT                   TDIEEDLSGNIISTTQLYSENLGTLKSIGKDVEIGYEDGGVWELYPNGGGSIMISPPDF
FT                   NYNGITLTLPVTLIRSDNTLNGYSSAGYSNSIAVIDAESTGISTIKYPNADKGWANPIA
FT                   TGHYIEVKITSDYANAWKSYFNERVEGAEATIDPGNPRTVIIRLSSGWPLQTGLYSDGF
FT                   TTSYMETTDTNIPLDEFMFDLFTVNPGNDFWLTYGVKPQGVTTPDPQLLIYMCRHLGNQ
FT                   NKDLADIRIQYQKGSQIEIFEGTVPFHRKVDNEIYIDMLSHDETLTYRADSSPKAITWG
FT                   SDPSNPDPGIAAGLDNGAEVSIGDTRTLYDVSQHYMWLMAYEDQNNGNLYNGPQYVVYS
FT                   THDYSPGNPHPNKKDLEDSKFTLKYKSKQDIKYLYITEGTLKISLGGKSA"
FT   CDS_pept        270981..271970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0266"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0266"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60338"
FT                   /db_xref="UniProtKB/TrEMBL:D1YV66"
FT                   /protein_id="BAI60338.1"
FT                   /translation="MIIMKLNPTQVKEKYGPMFSQRFLTMVDSSRNVAEIIETCAVKGT
FT                   IEWDAVNRCRAGGAIQWCEVEGTTMVMRARLGESPIKFGPTDVEYGGQGLEAVLVDGDK
FT                   VITKWAGCGGAGLGVAACLTQAPGVLHAIYPTEEDMKVGGARANRVELVTPLYEKVTIG
FT                   IDDTDNKEGGATWVLALKASKMAAAIDGVQSLNLRLIQLFPKSPHKTTNCVSSAITFAA
FT                   RPDAVDSLIKSVVATVKRETRSSKTGIAVYRGIGISPALNAFGWEVKKHLVTVETVEEN
FT                   AKGTGIEFIDLFPNREGRIGALAAVALSEERTDAAALYNDCALPLIRR"
FT   CDS_pept        271967..272797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0267"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains one Phosphate acetyl/butaryl transferase
FT                   domain (IPR002505).; Similar to Putative methyltransferase
FT                   mtx subunit X in Methanosarcina barkeri (strain Fusaro /
FT                   DSM 804) (O32853)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0267"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60339"
FT                   /db_xref="GOA:D1YV67"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR016764"
FT                   /db_xref="UniProtKB/TrEMBL:D1YV67"
FT                   /protein_id="BAI60339.1"
FT                   /translation="MRPHQEVSAMLWETITARAVVNYANIAVGVGPQYADKTVDAAEKA
FT                   AERGFAKVTLVSSRPLKTALDVVVSDKPDEALIQLLKDGKVDGLVRGSLGANSTLRSLR
FT                   RIMGLQKILRVSLLKAPSGRFFFFAPVGVDEGWTVADKAELGEAGATLIKKFGIEPRVG
FT                   VLSGGRMEDRGRSPLVDKTMDDAEAVAAALRAKGIDAKHASILFEDAINEYEYILAPDG
FT                   VCGNLMFRALCLVGCGEGYGAPLVGTDIVYVDTSRAGSGYEHAICLAGAMASKK"
FT   CDS_pept        complement(273303..273647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0268"
FT                   /product="conserved hypothetical protein"
FT                   /note="Belongs to the Protein of unknown function DUF192
FT                   family (IPR003795)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0268"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60340"
FT                   /db_xref="InterPro:IPR003795"
FT                   /db_xref="InterPro:IPR038695"
FT                   /db_xref="UniProtKB/TrEMBL:D1YV68"
FT                   /protein_id="BAI60340.1"
FT                   /translation="MSLITGDGRVVSADVELADSFLSRAVGLMFRRSFSGALVFDMGRE
FT                   TYDGIHMLFVFFPIDVVFLDPDKQIVDMKLNLRPWIGTAFPKSRFRYAIELPAGTIEKA
FT                   QLIIGDKLSW"
FT   CDS_pept        273712..274770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0269"
FT                   /product="sodium/calcium exchanger protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0269"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60341"
FT                   /db_xref="GOA:D1YV69"
FT                   /db_xref="InterPro:IPR004481"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniProtKB/TrEMBL:D1YV69"
FT                   /protein_id="BAI60341.1"
FT                   /translation="MDLIVFLLSFAIILIACEFFTNGVEWTGRRFNLSEGAVGSVLAAV
FT                   GTALPETLVPLIAILMIGGDAGHEIGVGAILGAPFMLATLALFICGLSVLIFAKRRNTR
FT                   TLHINGKLIRRDLKFFLLAYALAAVAAFTPPEFGIFKTILGFTLIPLYIVYTIYTLKTG
FT                   EAATGGDDMKALYLDSVIKRCIPGKADKDCPAPREPSTALIIVQVLAALGAIILGANLF
FT                   VNQINAIAMFIGINPLILSLVISPIATELPEKFNSMLWIRERKDTYAIGNITGAMVFQS
FT                   CIPVTIGIFLTSWHLNIANPVELLEAMTIGIALLSGIILYIESSHKELKMSGLMIGGLL
FT                   YVLFFVAVLLSI"
FT   CDS_pept        complement(275354..276160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadE-1"
FT                   /locus_tag="MCP_0270"
FT                   /product="NH(3)-dependent NAD(+) synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0270"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60342"
FT                   /db_xref="GOA:D1YV70"
FT                   /db_xref="InterPro:IPR003694"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022926"
FT                   /db_xref="UniProtKB/TrEMBL:D1YV70"
FT                   /protein_id="BAI60342.1"
FT                   /translation="MKGLLLSKDELVKCENAIEESIVRAVETSKMNGAILALSGGIDSA
FT                   LVAVLASRVVDVFGLLLPDRATSDPGDMEDARDLAKSLGMDYELIEIGGIVEAVYSARP
FT                   NLGPKECRLAYANVKPRVRMIMNYFASNLDGRIVLGTGNKTELLMGYFTKYGDGGVDLL
FT                   PIAGLYKTRVRQMAKHVGVPEAIIKKPPSAGLWKGQTDEGEMGISYEALDKILYGVYDL
FT                   GLSYGEIQKETGVDEATFTRIMERVRDNEHKRNMPPITDITAVIGP"
FT   CDS_pept        276245..277201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0271"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains one Protein of unknown function DUF6,
FT                   transmembrane domain (IPR000620)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0271"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60343"
FT                   /db_xref="GOA:D1YV71"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:D1YV71"
FT                   /protein_id="BAI60343.1"
FT                   /translation="MARPYPELLAVLGAVLFGASAPLSKVLLGEVDPVLLAGLLYLGCG
FT                   MGLLVFKFLLHVSGAPGGLPLGRNDVPWLAGAVLAGGVAAPIALMIGLQNAPAATASLL
FT                   LNFECVATTVLAAFLFQEYIGRRIWLAVGLITAASAVLSFGNGQFGLSFGVLAIILACV
FT                   LWGLDNNLTRNISSKDALSIGIVKGLVAGTFSLLLALVLGARLPALPVALAAMLLGSLS
FT                   YGLSIALFILAMRHIGAARTSAWMGTAPFAGVIISFIIFRSVPGVTFLIALPLMVFGAL
FT                   LLFGEEHAHTHIHVHGTITHEHVHAHDGHEHGHEHSR"
FT   CDS_pept        complement(277618..278313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0272"
FT                   /product="putative nucleotidyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0272"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60344"
FT                   /db_xref="GOA:D1YV72"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D1YV72"
FT                   /protein_id="BAI60344.1"
FT                   /translation="MKAFILCGGRGERLKPLTDNLPKPMVKVGGKPILEHQLELLSKHG
FT                   IDEAVLLVGWCGDQVEKYFGDGRKINMHIEYSYEDPNNRLGTAGPIKAAKDKIDGTFIV
FT                   MNGDIVSNTNISGIVSFHVGMECWGTINMINMTSPYGIIDLDGNKIKQFREKPVLPFKM
FT                   NAGLYVLEPDVVDFMPDVGSIETDVFPKIAALGKLCGYDSTGIYWSDVGTHKDLEKANK
FT                   DILAGKLKI"
FT   CDS_pept        complement(278315..279310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0273"
FT                   /product="putative nucleotidyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0273"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60345"
FT                   /db_xref="GOA:D1YV73"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D1YV73"
FT                   /protein_id="BAI60345.1"
FT                   /translation="MIGMILCGGSGKKLKPYTDNTPAPLVEIKDDVTILDKQLFDFASA
FT                   GIDEAILLTGYKSDMIESRYGDKFKGVKISYHVEDKPLGTLNALKAGMQLAKGEDVVVR
FT                   NGDVVTDANLKKMMLKHKNNPYPVTMFVTRMRSPYGIVDLGDDKVRSFKEKPVLEYYIN
FT                   GGIYCINHDVPVSGFEGKTLEHALFPRLAEASSLGYYREDGVFWATVDTVRELEEVRKE
FT                   YRNKTDKPWGYEKVLISTDKYLTKELYIRAGYQTSFHKHPRKDETMYIIEGVGYIEFED
FT                   HKEHFGKNDTVRIEPNVPHTIVATENTVLHEVSTPFLEDTVRIKDYYNVR"
FT   CDS_pept        279459..280481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0274"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains two 4Fe-4S ferredoxin, iron-sulfur binding
FT                   domains (IPR001450)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0274"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60346"
FT                   /db_xref="InterPro:IPR007160"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D1YV74"
FT                   /protein_id="BAI60346.1"
FT                   /translation="MTVHFVPWDTSHNLLSRAEKLYEAAGTLDCVAEGDLVAVKLHVGE
FT                   LGNPYYVQPFFVHQLVQKIREAGGKPFLTDSNTYYLAQRNNAVDHYETSLANGFGFCQF
FT                   IAADGLRSESGRLVSTKGILKGIEVSGAIAEADAMIVVSHDKGHALTGFGGAVKNMGMG
FT                   CTTRAGKLRQHRTVGLKIDESKCSGCGLCRKVCEMGLPEIVDKKAKNVSRECMRCPVCM
FT                   EACPKGAIKLLKKENLGRALASAAYGVLSTFGKNKTSFVSFADNITQYCDCVPAPGHVV
FT                   MNDIGIFASSSPVSVDAAFLQKADHKYFNEAYDVDCWTQVKELKELGIQGELKPKIKEA
FT                   "
FT   CDS_pept        complement(280485..281252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0275"
FT                   /product="putative glucose-6-phosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0275"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60347"
FT                   /db_xref="GOA:D1YV75"
FT                   /db_xref="InterPro:IPR010551"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D1YV75"
FT                   /protein_id="BAI60347.1"
FT                   /translation="MERALRFGQNEVEPDVRKLSEMRDVIYDIDWLKTAPDRDLYYMYR
FT                   DLAMSRNDRSLMLDNHLRFDITVIPPGKLGAEYVKTAGHYHPCVPGTCCTYPEVYEVLR
FT                   GMAHYLLQKCEGGRIEDVVMVEAGEGDHVIIPPGYGHVTINPSNKELKMSNWVSRDFSS
FT                   LYEPYKKCGGGAYFELADGRIIRNGRCDHIPDIRFLKPTNITKVGMGKGKEMYGLVRDI
FT                   SKLEFLNRPQDYDLLWEEVLSDENRAKPDVAAR"
FT   CDS_pept        complement(281529..281903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0276"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains one Ferritin-like domain (IPR009040).;
FT                   Contains one Rubrerythrin domain (IPR003251)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0276"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60348"
FT                   /db_xref="GOA:D1YV76"
FT                   /db_xref="InterPro:IPR003251"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:D1YV76"
FT                   /protein_id="BAI60348.1"
FT                   /translation="MSKLTKIMEQTFTGETYEVGLYLAMAKKAELDNMPEVATYLRGLA
FT                   MEEAGHACEVAIMLDKIKGTKENLEYMLGGETMATREKMDAARIAKEEGNNDAATFFER
FT                   ASADENRHRSGLQGFLNKMK"
FT   CDS_pept        complement(282231..282617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0277"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0277"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60349"
FT                   /db_xref="GOA:D1YV77"
FT                   /db_xref="UniProtKB/TrEMBL:D1YV77"
FT                   /protein_id="BAI60349.1"
FT                   /translation="MGMDSMEELGGYDDVDADQVFNGGQIAGNRGGMGEGRRKGKKSLS
FT                   SRNNYRARSKRPMGRGFSFNFRGFEDTAKMMLAVSIGTLLICGVILYATFGMHLLPDFY
FT                   GALLASIVVMALLFYTAMKLVRTR"
FT   CDS_pept        complement(282630..282809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0278"
FT                   /product="conserved hypothetical protein"
FT                   /note="Belongs to the Protein of unknown function DUF343
FT                   family (IPR005651)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0278"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60350"
FT                   /db_xref="InterPro:IPR005651"
FT                   /db_xref="UniProtKB/TrEMBL:D1YV78"
FT                   /protein_id="BAI60350.1"
FT                   /translation="MKKDLMDILCCPVCKGDLELTVKKESGPEVIEGTLHCKKCNENYP
FT                   IEDGIPNLLPPELR"
FT   CDS_pept        complement(282814..283827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purA"
FT                   /locus_tag="MCP_0279"
FT                   /product="adenylosuccinate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0279"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60351"
FT                   /db_xref="GOA:D1YV79"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR018220"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="UniProtKB/TrEMBL:D1YV79"
FT                   /protein_id="BAI60351.1"
FT                   /translation="MVSTIVVGGFFGDEGKGKIVAHIAYTEHPSIIARGGVGPNAGHTV
FT                   YKDGVKYGVRMVPSGFVYDKARLLIGAGVLVDPVVLDREVKLLGCGGRIGVDYRCSIIE
FT                   EKHIAEDKGTERLAKKIGTTGTGCGPANKERVMRSAKQAADVESLKKYLTDVSQECNDA
FT                   LDRGENLIIEGSQGFGISLYYGTYPFVTSKDTSASSLAADVGVGPTKIDEVVVVFKAFP
FT                   TRVGEGPFETEMTPEEAQKRGIAEFGTVTGRARRIGYWDPKMARYSAMINGATQAAITG
FT                   LDRIDPAVKGVQEYDKLTENVKEFVKQAEKDAGVPFTLLSTGPDQKDIVDLRNHKK"
FT   CDS_pept        283917..284363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0280"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0280"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60352"
FT                   /db_xref="UniProtKB/TrEMBL:D1YV80"
FT                   /protein_id="BAI60352.1"
FT                   /translation="MPIFYGADFNLMKASTVILFVALTASAAMCFGCISNADGEKGTLS
FT                   GNVTVGPLTPVERVDATPILPAPEVFTSRHLIVYEADGMAKVADVGIVPAGYYGTYSVS
FT                   LAPGTYVLDYVHQGIGRASPLPMKVTIEAGKTTIVDVDFDTGIR"
FT   CDS_pept        284886..286253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0281"
FT                   /product="putative FAD linked oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0281"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60353"
FT                   /db_xref="GOA:D1YV81"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:D1YV81"
FT                   /protein_id="BAI60353.1"
FT                   /translation="MFEELQAIVGPERVTRDPGELYCYSFDSSYVRGHADYVVRPKSAE
FT                   EVAEIVKVATKYNTPIVARGSASGLTGGSVPVKGGIVLDMTGMNRILELEVENLQAVIE
FT                   PGIIHKELNNELIKHGFFFPPDPGSSDMCTVGGLIANGGSGMHSVKYGTVKDYVLGLEV
FT                   VLPSGDIINTGCKAPKTSSGYDLTRLFIGSEGTLGIVTKARLRIHPLPETKSIMMATFG
FT                   RIEDAGRAAVSVLSSGVIPAAMEIMDGSAIKAVKELDPTLEVPDVEAMLLFEVDGYRES
FT                   VTREVGLICTICEQCGGTTRVAKNKNEEERLWAARRLVGVAITKLNPGKVRVYEAEDIG
FT                   VPIKDVPFMLKKIQEIGRKHGMSLVTYGHIGDGNLHTGIAINPRDEAEWKRVHAVKDDI
FT                   YDVVLSLGGTLPAEHGVGIIRADYMARAHGKGYEVMKSIKKAVDPQNIMNPGKMGM"
FT   CDS_pept        286264..287307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hdrD-1"
FT                   /locus_tag="MCP_0282"
FT                   /product="putative CoB--CoM heterodisulfide reductase
FT                   iron-sulfur subunit D"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0282"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60354"
FT                   /db_xref="GOA:D1YV82"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D1YV82"
FT                   /protein_id="BAI60354.1"
FT                   /translation="MIQDHIEDIIKCTRCGRCRALCPINEELGWESTNARGRMLLARAL
FT                   AEGEKPSYAMKRSFYTCLTCSMCTSTCPSGAKPDDVVEDARREMIAQGSAPPYYDTILE
FT                   NITKHGNSLGDTGPRNAWVPEELRLNNGSADVIYWSGCLTSYRQQQTALSNLKILSRFG
FT                   ARVLDDERCCGSPLLRLGGDSVALEHNRKEIEKSGAKTLVTGCAGCYKTLSESLDIEVL
FT                   HVTQFLARHVDELPLERLPYRVSYHDPCHLGRCMKVYDEPRTIIKRICEFEEMATSRSL
FT                   AKCCGGGGGVRRGYGDLARKVAKKRLMDAPAGIDYIITACPMCHANLQDAGGKVLDISE
FT                   LVLMSMI"
FT   CDS_pept        287317..288564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0283"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0283"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60355"
FT                   /db_xref="GOA:D1YV83"
FT                   /db_xref="InterPro:IPR018657"
FT                   /db_xref="UniProtKB/TrEMBL:D1YV83"
FT                   /protein_id="BAI60355.1"
FT                   /translation="MADVDLKYGKGHFEVNVPDKNMAGIILPKEMTGVKDEQAEIRRAL
FT                   ENPIGSQRLREKVKKGMKVVVIISDATRPCPSYKFLPLLLDEINAGGVPDGDITVVIAL
FT                   GSHRRSTPEEQKALMGPAFGRVRNIGHDKHDCKYVGTSSFGHRIEIFKEVVDADFIVCT
FT                   GNTEYHYFAGYSGGAKAVLPGCASHSTIEINHAMMVDPKAETGRLDSPIRQEIDEVPGM
FT                   MRNIGFLLDVVLNSKKEIVAAVAGDVMEAHREGVKYVDRMYSVKVPKADIVVTSAGGYP
FT                   KDINMYQAQKAMDNCKHVVKEGGTMILAAQCQECLGNDVFACWVDEATTIEAQARRMDE
FT                   HFELGGHKASVIAKTAMKCDIQLISEIPGETVRKMFLTPVKSPQEALDAALKKYGPDAK
FT                   VLVSPYGGMVLPKPLE"
FT   CDS_pept        288716..289087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0284"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0284"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60356"
FT                   /db_xref="UniProtKB/TrEMBL:D1YV84"
FT                   /protein_id="BAI60356.1"
FT                   /translation="MRVKLLIALALASIFLLAGSFPAGAVIGKTGTSSTSVIVPTVLTV
FT                   PTVANSIVKPCISFPATSAPLAGQCLANTITLGGPALQTSIQLFAPQTPTFAPPNFVLP
FT                   NLSPPLITAFSCTSPIFDP"
FT   CDS_pept        289270..289806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0285"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains one Oxidoreductase, molybdopterin binding
FT                   domain (IPR000572)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0285"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60357"
FT                   /db_xref="GOA:D1YV85"
FT                   /db_xref="InterPro:IPR000572"
FT                   /db_xref="InterPro:IPR036374"
FT                   /db_xref="UniProtKB/TrEMBL:D1YV85"
FT                   /protein_id="BAI60357.1"
FT                   /translation="MLRKLPALDVEGPPLSDPRQWQLKVDGMVERPRAYSIQELRELEP
FT                   AEATMPFVCVEGWDMWVKWKGVKLRRILDDVKPLPGACWLTFYAYSEYTDSLFIDDARD
FT                   ERTMLVYGYEDGDLPAENGGPLRLVVPFKLAYKSVKWLQRISFTDAEELGYWETRGYPP
FT                   EAGIPEETKMKYSIR"
FT   CDS_pept        289811..291985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0286"
FT                   /product="conserved hypothetical protein"
FT                   /note="Belongs to the Amylo-alpha-1,6-glucosidase family
FT                   (IPR010401)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0286"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60358"
FT                   /db_xref="GOA:D1YV86"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR032790"
FT                   /db_xref="InterPro:IPR032856"
FT                   /db_xref="UniProtKB/TrEMBL:D1YV86"
FT                   /protein_id="BAI60358.1"
FT                   /translation="MAYEQEFASQAKIHEAHTVIKDILGALVIRDGPLTLVTAQNGDIP
FT                   VRENHGFGLYYRDCRFLSGYVLTCNGRQPISILSSDDKSYAGITVLTNQRYVDRGGRTV
FT                   EKETLGIRRDRIIPGMLDEKITVTNYNEFEADVELALEFVSDFDDIFTVRGITQPTKGR
FT                   VLAPAYEPGQLTLQYIGEDGHRRNTRITFDPAPSDVKGGIALFRLRVGPRKRDTIGVRI
FT                   YVEDMPPDVPSVLDDQHIQRRIRGIKASYADTMECCSNIQTDNGIFNKIFLRSLSDLRM
FT                   LYMGQPVNIFYSAGVPWYDALFGRDSIISAMQVIPYNPEVARSTLKVLAGLQGGKTDDW
FT                   RDEQPGKILHELRVGEQANLNNIPDTPYYGSVDSTPLFLILLADYIDWTGDMGLFNELQ
FT                   GNVDAALRWIDAYGDLDGSGLISYTRKSTKGLYNQCWKDSFDSISHADGSLAVHPIAAA
FT                   EVQGYVYMAKRRMANLFERVGRHGDASRLRRDAVNLRWKFNNDFWMKGEKYFAEAIDKN
FT                   GQCDVVTSNPAQGLWSEIIEPQKARMVVDRIFREDMFSGWGIRTLSYKEKRYNPLGYHN
FT                   GTIWPHDNSIIAMGLNKYGFKEELAVLFTCMYEAAGFYPIYRLPELFGGFQRGEYDVPI
FT                   KYPVACSPQAWSAGTIPYMLSASLGFIPDALNMRLTLYKPKLPPWLHTVKISKLIVGDA
FT                   YTQLEFKREGESTLVNVVDKRGSLEVQVVY"
FT   CDS_pept        complement(292197..293447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0287"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0287"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60359"
FT                   /db_xref="GOA:D1YV87"
FT                   /db_xref="InterPro:IPR003416"
FT                   /db_xref="InterPro:IPR025105"
FT                   /db_xref="UniProtKB/TrEMBL:D1YV87"
FT                   /protein_id="BAI60359.1"
FT                   /translation="MVDLLLLQKLFTALLIGLVIGLEREIAQEGRQNVKFAGLRTFGIV
FT                   GLIGGIAAYLTTQGYIIFVAALLGVIALTAIAYYRSTGIDKHLGFTTETALILTFLLGG
FT                   LAYFEQTVAIILAIVVTILLAFKVPLHEFTFKIPKEEFYDSLKFALIALVILPVLPDQA
FT                   FGPLEAFNPYQIWLIVVILTGISFVGYFLVKWFGADLGLSLTGIVGGLASSTAVISSMA
FT                   IRTRENKEIERPAMVAATLASMVMLLRVVFMVFIFNPGLLVSIYLPIGIMCVASILVAS
FT                   YFYLQGRDGRKGETIKLKTPFNIVPALIFAGFIAIVLFVSKAALLYLGNYGLYITSALA
FT                   GLADVDAITVSTSQLAANGLASAPTAVTAIMIAVFVNLAIHTAYAFYFGTRKFGIYNAA
FT                   MSAVIIAAGIAVIAATL"
FT   CDS_pept        complement(293976..294614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0288"
FT                   /product="putative phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0288"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60360"
FT                   /db_xref="GOA:D1YV88"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:D1YV88"
FT                   /protein_id="BAI60360.1"
FT                   /translation="MKFKNRSEAGRMLAGQLGAYKGKDVIVLAIPMGGVPVAYEIALEM
FT                   NAPLDVVMAKKVGAPFNQEFAIGAVTWNGAVLLDENMMRKYNISREYVGEQSRKLIRDM
FT                   NERLNSLRAGLGSFPKLYGRTVIIVDDGIATGNTMIAAVEAIRDQGPADVVVATPVLPK
FT                   ELVEDMERVAPLVYLDAPDDFEAVGQYYEEFEMTSEDAVRGLMLLANSA"
FT   CDS_pept        complement(294626..295084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0289"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0289"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60361"
FT                   /db_xref="UniProtKB/TrEMBL:D1YV89"
FT                   /protein_id="BAI60361.1"
FT                   /translation="MYRPRIFFTGGIALDTGLEESMGAMCEDVAKSLGYKVEHDINLGA
FT                   GNITQVWSRQDHPNLPEMKYAVQILAERGDVDPDVITSNAMKSLWTDCDHLIFVVPDNA
FT                   TQKSIQGKVRSFDAIGGFLQLHKYITTITVSELTKGLAQATRSTEARA"
FT   CDS_pept        295173..295529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0290"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0290"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60362"
FT                   /db_xref="UniProtKB/TrEMBL:D1YV90"
FT                   /protein_id="BAI60362.1"
FT                   /translation="MAGVGRMSDFGKPEFTDDDIENRLDTVDPFVDENLTYRENVQRLV
FT                   SCGLSEDKAAKCVDMIIIRRNKDRARREDILREQSEYRKELGDLKTCKSDDESCVPTGP
FT                   GDEKKSARAEKRQP"
FT   CDS_pept        complement(295536..296642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0291"
FT                   /product="conserved hypothetical protein"
FT                   /note="Belongs to the Protein of unknown function DUF373
FT                   family (IPR007254)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0291"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60363"
FT                   /db_xref="GOA:D1YV91"
FT                   /db_xref="InterPro:IPR007254"
FT                   /db_xref="UniProtKB/TrEMBL:D1YV91"
FT                   /protein_id="BAI60363.1"
FT                   /translation="MDILVICIDKDDDIGVKGGVKSPVIGRAACLDAACRLGTADPEDS
FT                   DTNTIFGGIQAFDQLKAEGHNVELVCIAGHRELGIKSDRAIAAQLDDILLKYPTERAIL
FT                   VSDGAEDESVLPILQSRLKIESVKRVVVKQAQNLESTYYIIKQLINDPKVAKVIFIPIG
FT                   LILLVYAATTWIDWPNATPIAIALLLGGYLLYRGMGLDNLFDTFIFNMRRSFSESKLTF
FT                   VTYLLALVLSIMAFIMGAWGVAQWQNDLPGVLSPGLLDYAAIFVSHSVLWFIAAFLAIV
FT                   IGWIVDAYADESDTLYRYLSTPFFLLAGGLLIWGSSQYILHMSNTVQAFESLVISIVLA
FT                   VVVSYVGVQFANQVRQIMQYRTVEVIDF"
FT   CDS_pept        complement(296899..297759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0292"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0292"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60364"
FT                   /db_xref="UniProtKB/TrEMBL:D1YV92"
FT                   /protein_id="BAI60364.1"
FT                   /translation="MLKELQDKKTKYLKDAEEFKKNRNEWNSKASAFSKRRDELNKQTK
FT                   ELIDKAQEYRTKRDEFNNQVSENKEKRNELNEKANEVYARVDSLRKKDNIGSGRSLNEL
FT                   RKEIDHLEFKQQTEVLTTEKERALVDKISELKEEFKKKKEQLEQNQELKSFLGDAQGLR
FT                   DEASEFHKKVKEYADLAQEYHDKMIECFREADKVRAEADAQHKEFVKAQETADEFHKQF
FT                   LKLQKEIRDFDKVIVGLKKKAKTEKESKDKVEYKKQAEDVFAQFKAGEKLNTEDLLLLQ
FT                   RSGFL"
FT   CDS_pept        complement(297719..298423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0293"
FT                   /product="phosphoserine phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0293"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60365"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D1YV93"
FT                   /protein_id="BAI60365.1"
FT                   /translation="MSLCSGDGSEPVIFFDMDSTVIDAEGIIELARARGVGDYVAGVTA
FT                   RAMNGELDFECALRERVKLLRGLPTQKALEVAGSIPLMPGAEKLMKELKSLGFRTVLIS
FT                   GGFTIIARRVAEQLQMDAFFANELVVDDGVLTGDVRGPLTRQSSKKEVLEEICNKLNIS
FT                   PCECVAVGDGSNDLCWKGVVGTFIAFNAKPVVRNAADVVVDGKNMESLIPIIKEEYIRH
FT                   AKRTARQENKIP"
FT   CDS_pept        complement(298404..299672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyA"
FT                   /locus_tag="MCP_0294"
FT                   /product="serine hydroxymethyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0294"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60366"
FT                   /db_xref="GOA:D1YV94"
FT                   /db_xref="InterPro:IPR001085"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019798"
FT                   /db_xref="InterPro:IPR039429"
FT                   /db_xref="UniProtKB/TrEMBL:D1YV94"
FT                   /protein_id="BAI60366.1"
FT                   /translation="MNSDVQCVVDAVMGSQELFKYSLPMIASENVTSPLVRQVLSSDLG
FT                   HRYAEGQVGHRFYQGCGFVDTIEAKAIELAKEVFRAPHVNVQPISGVNCNIAAFFALAQ
FT                   PGDKLLALAVPSGGHISHAKFSAAGIRGMKIYTHPYDNSKMNIDVDGMVKEIKRLKPKV
FT                   VMFGASLFLFPHPVKEAREACDEVGASIVYDAAHVAGLIAGGEFQDPLKEGADVVTAST
FT                   HKTFPGPQGGIILCKEKWAKDIDEAVFPGTVSNFHLHHKAGLAIALAEMKQFGKAYARQ
FT                   TVKNAQALAASMDDMGFSVLCKEQGYTKSHQVAVDVSKIGGGSVVAANLEKANVIANKN
FT                   LFPWDNVNGTDDPSGIRLGTQELTRLGMKEPEMKEVARVLKRVAIDKEKPEKVKKDVIL
FT                   LKSQYQTVQYCFDGDGAYEFMLR"
FT   CDS_pept        complement(299798..300559)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0295"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains at least two CBS domains (IPR000644)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0295"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60367"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:D1YV95"
FT                   /protein_id="BAI60367.1"
FT                   /translation="MKVKEIMSKAYVVDKSDRISEALDLMHKYRSRRLIVKNRDGVQGV
FT                   ITLRSICGELGSRRKYNHPPTLFHVADALSNDYALVGPEDDMGQALDALKSVGCVIVVD
FT                   IGVVGQVTTKDVLSHYSPEGTVGSIMSPPVVAPPDARVAYIRKLMIEKGVSRVPIMDGT
FT                   ALVGMVSETDVANAMRSVKKHSPQSRQDNNVELLIAMDIMRSEVITARPEMPLKDAAKL
FT                   MVDNDIGALPVKDEHGHLVGMVTRRDIVKAF"
FT   CDS_pept        complement(300556..301401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0296"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains two CBS domains (IPR000644)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0296"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60368"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:D1YV96"
FT                   /protein_id="BAI60368.1"
FT                   /translation="MTEVSEIMTAPVYAVSPRDNVARARNLMLRYGVSRLVVAEGNTLR
FT                   GIVTRKDIGSRLSQAEPQWRRRPIDQIPVDLVATHDVFTVKPDAQIQDVASTMLCHDIS
FT                   GLVVYDSEIRGIVTKHDMVKYFTLLGSPLRVGDMMSEKVVTVSRHHTINSVIDIMAENG
FT                   VDRVIVRDGGPAAAYAGMVTLDDLGFATMDFRDTKPIKEAHRMVQGGPKMLRGFREAMM
FT                   VAEDVMSTPLVSVNRGTKALDAAKLMLEHNYDMLPVIDSELLGEFSVESILKWLSEARE
FT                   "
FT   CDS_pept        complement(301398..302375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0297"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains two CBS domains (IPR000644)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0297"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60369"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:D1YV97"
FT                   /protein_id="BAI60369.1"
FT                   /translation="MSREGIKEFGDQRRERKVNTGKFEHDLRESQVTRDLNFKQRQAQH
FT                   ESGIMAVAKKAVVTVPPTTTVMGAARTMVGYGYRRLPVADAGTKRLKGICTVIDIIDFL
FT                   GGGEKRRIIDRVYDGNMIVAINGPITEIMEEDVATVQDDASLDDAIKVMIDRSVGGVPV
FT                   IDPESIVVGIITERDIVRLMGDSVSGTKVRDIMSRRVTTAPPNMPIETAAKTMIESGFR
FT                   RLPVVTDSYVCGIITATDIMRYLGNGEAFKKLVTGNVSEAFSVPISGIMKSDIVTVGPD
FT                   QDLGETARIMRQNKIGSLPVIENQQLVGIVTERDVLMSMKGGKA"
FT   CDS_pept        complement(302372..303157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0298"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains two CBS domains (IPR000644)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0298"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60370"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:D1YV98"
FT                   /protein_id="BAI60370.1"
FT                   /translation="MRVSDIMATNPQSVAPGEFVTHAREIMREYNYDSLPVVDNGRVAG
FT                   MITLQDIINVTSTRSDVTVSGYVRADVPRLTPDTGLPRAAFIVIRTDEGRVPVVDPDSR
FT                   LVGLLSVKDIFKGLPELELEDRPVSEYMTRKVVVCQPEDSLSRVWLNMIHYGLTGFPVV
FT                   GDRMEVIGMVTREDITKRGYARIERESEGKKNPTTVQKIMSTPAITVEENDSIRKAAKI
FT                   FMERNIGRVPVVMNGKLTGIVDRYDVIRACRALQGVTPR"
FT   CDS_pept        complement(303169..303762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0299"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains one CBS domain (IPR000644)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0299"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60371"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:D1YV99"
FT                   /protein_id="BAI60371.1"
FT                   /translation="METDLSVSDVMSRRLITADVAQTADRLARTMAETQVGCIIITRDN
FT                   HPVGIVTERDMVVKLIAENAQPSKVKAQDIMSTPLITIPPDKSVELALREMARRRIRRL
FT                   PVVQGRKLIGLVSDSDLLSVSSELSEILRDVIRQNNPEGDMGQTIPDWEQEERNPSVFV
FT                   QGICEVCQSFQESLENIDGTYVCMRCREELPFYQ"
FT   CDS_pept        303893..304528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0300"
FT                   /product="GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0300"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60372"
FT                   /db_xref="GOA:D1YVA0"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVA0"
FT                   /protein_id="BAI60372.1"
FT                   /translation="MALLAGLRESLSGIWGRVFRRKASRIGIYGPPNAGKTTLANKILM
FT                   DFTGETIGAVSNVPHETRRVRRREGVTIKGDGYSVTLDIVDTPGLATKIDFHDFMAFGM
FT                   TEEESKRRAKEATEGVIEAIKWMDNLDGVLLVMDATEDPYTQVNVTVIGNMEARRLPML
FT                   IVANKTDLPGAAPDRIKGAFPQHTVVPISALNGTNMDLLYETIASRFG"
FT   CDS_pept        304530..304880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0301"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0301"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60373"
FT                   /db_xref="InterPro:IPR012017"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVA1"
FT                   /protein_id="BAI60373.1"
FT                   /translation="MEAQNIQINMISANKLQAMSTMDKISLILNDVSSGRIVILERGLD
FT                   PREEAQLIEHTMLKIRDSQFYGIEIQSYPREGRPSPWNILRRPDNRVTVIGPADRLKTL
FT                   KKEKDIISAVIS"
FT   CDS_pept        304890..305354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0302"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0302"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60374"
FT                   /db_xref="InterPro:IPR018645"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVA2"
FT                   /protein_id="BAI60374.1"
FT                   /translation="MPHRCMECNSVLESRELNLGTGCPVCGGKKFEYVRPQKAMEADLR
FT                   KMTVSQYVAYAGSADADEAEPEHEEKPKHKEHKAAPKPAEEPKSKAKKPAAHEGRIDSV
FT                   RILEKGNYDLNLPMLLNRKELVMSKEEGVYHVDLPSALKTTPKPSKKKKR"
FT   CDS_pept        complement(305358..305828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0303"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0303"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60375"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVA3"
FT                   /protein_id="BAI60375.1"
FT                   /translation="MKILSVGIIVLLLGTLAVPAEAAAASDSDFRVTKMIVEPAGPDLN
FT                   FTVNYESGFFARVFSIIFGAKVLQPDILNVFANFSNVSLVSIDSNSGVAKVAVKNVSAL
FT                   NSDGWYIYDGNTTFTSKIAVIEIHNKDGTVVSLSDTNKLPVISSKMQVLSKK"
FT   CDS_pept        complement(305964..306284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnp4"
FT                   /locus_tag="MCP_0304"
FT                   /product="ribonuclease P protein component 4"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0304"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60376"
FT                   /db_xref="GOA:D1YVA4"
FT                   /db_xref="InterPro:IPR007175"
FT                   /db_xref="InterPro:IPR016432"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVA4"
FT                   /protein_id="BAI60376.1"
FT                   /translation="MPERRRKEPQRKPFNVDMAEQRIKRLFELAEQAYPGRPDLADRYA
FT                   DIARRISMRHRVGIPRELKRRVCKGCGSFLVPGDNCRVRLDGNNIVITCMKCGAIKRYP
FT                   YR"
FT   tRNA            complement(306361..306432)
FT                   /locus_tag="MCP_t0008"
FT                   /product="tRNA-Gly"
FT   CDS_pept        306449..307252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0305"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains one 4Fe-4S ferredoxin, iron-sulfur binding
FT                   domain (IPR001450)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0305"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60377"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVA5"
FT                   /protein_id="BAI60377.1"
FT                   /translation="MTLQSINIFGRRIITSMPDVRPENVKEDIAAIASKYGIEVVGFLG
FT                   LDERTKIPAEEMGLLRGVKWKDSEVDVSKVHDPLDIMPAARTMIILGKRLLDDSQDIYY
FT                   RASDDYTASVEMMLLDIASAKIVAGLKKGGFEAEEYTSYYLKAWAALAGLGWIGRSRMF
FT                   VSKAHGPRLRLHGILTDADIGELHAVIPDDSCGRCTECMKACPAGAISGDEVDRKKCGA
FT                   CPLNHRKISENALAYCTACTASCPVGRPSRHEHAVQAVSRQQITP"
FT   CDS_pept        complement(307718..307906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0306"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0306"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60378"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVA6"
FT                   /protein_id="BAI60378.1"
FT                   /translation="MPAASMQKPARPGSSEELLDAAIDTVYTKLKHVNHSSHIVALSQE
FT                   LRELLKMRNEMGYEKQR"
FT   CDS_pept        308012..309010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0307"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0307"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60379"
FT                   /db_xref="InterPro:IPR008964"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVA7"
FT                   /protein_id="BAI60379.1"
FT                   /translation="MVPPAMKPSLVKLFLIILMASACCAPACSVPPVIVTAGPTIFEGS
FT                   VQGHVLAAGTNASIPGAKVWLVNATRDNTIYGATAADSGGHFYFINVPPLGPGAYRLKA
FT                   QKDSNTGFTTPFGVASLENRTVDVYVRMMPAAIGIEASRSYVVADGRDHMGITVLVNDS
FT                   MGRPVAGGYPVTFRAAGHPAGSLFGSIVPESAVTGMDGRATAEYVWVGETGAASHVIIE
FT                   ASAGAGLNASLVVDIRLPDTTPPATTLKAAGEPDNVGGFISDVTVTLDASDHGGWGVNE
FT                   TFYRTGDSGWARYTGPFTISAEGGTTVYYYSTDKAGNVETPKSRAIVIHKK"
FT   CDS_pept        complement(309021..309581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0308"
FT                   /product="flavoredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0308"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60380"
FT                   /db_xref="GOA:D1YVA8"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVA8"
FT                   /protein_id="BAI60380.1"
FT                   /translation="MDKVTMGPKTLMYPMPTVLLGANVGGKPNYMTAAWCGIACMAPPM
FT                   ISVAVNRVRHTLKGIEENRTFSINVPSTRDLVKTDYMGITSGARADKSIVFESFYGKLK
FT                   TAPMAKECPVSLECKLFDTMKCGSHDLVVGEIVETYVDKAVVTGGTPDIRKVDPIIYSD
FT                   GKYYRVGDFITDAFSAGKAYKKK"
FT   CDS_pept        complement(309628..310497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0309"
FT                   /product="putative phosphatase, PHP family"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0309"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60381"
FT                   /db_xref="GOA:D1YVA9"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVA9"
FT                   /protein_id="BAI60381.1"
FT                   /translation="MFIDTHVHTSHSDGLHPEAQVIRDAASAGISLLSITDHDCVDAYP
FT                   AALKLAKSAGIRLIPGVEMTTKNEQGCNCIHIVGLGVRTDGNVRSALKRVLDARDESDR
FT                   GFLANLNAYMAEKYPGWEPVEGIKPSVFQNTLAGARRQNIPMTEKQLMDIIMDPSLWVP
FT                   IEYEVTLGEAVSLIKEWGGVPVLAHPFDFSNDANVVLKRFLAAGGEAVELCKYRYKVRS
FT                   ASLAILPADELLKKEREMNEWTVAAARKHGLGLTMASDHHDGHRAMGMDPAEYGIDVSW
FT                   LLEMAETL"
FT   CDS_pept        310669..312159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0310"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60382"
FT                   /db_xref="GOA:D1YVB0"
FT                   /db_xref="InterPro:IPR008964"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR025874"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVB0"
FT                   /protein_id="BAI60382.1"
FT                   /translation="MLKKVSRSLLIIVIILMAYVGCVWCATAANVTLINPVISYNPVLK
FT                   SSLGMNLTLNNTSANAGSPISLVALAKYPNGTNIGPGYTITLTCAPVGGNFGVSTGTTG
FT                   YTKTMILISSINTNFMASAPGTYKITATVHDPNGVYWDGVANQTVTILATPTTVPVTPT
FT                   PVVQTPTPIVQSATPTAVIQNTPTATAQANMTAGGSTDLGPMLPYIAIVVVILLIIILI
FT                   VAFLWFKRTLRLELKKPSAPADGKSTVPVRISFVNGLGMAARARSDTDITLESSAGTIQ
FT                   NVVLQNGRDFVDATLTTSREFGPVTVRARAAGKEAKAALNFVYDSAVIDLAVAPGTIPA
FT                   DGKSSANIIIRIKDGSGNYIAPLQEISVDLKSTLGSIASPVKMPPKVQSVNSSITSGDV
FT                   SGVAAITATGGGLRGEAMLTFEGTAKRFCMHCGFTMTMEASQCPKCGLTPPSGVDAKQC
FT                   PTCGTVIPESAAFCYHCGARQPEVAKPVQPQDPGANKN"
FT   CDS_pept        312469..313818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0311"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0311"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60383"
FT                   /db_xref="InterPro:IPR020287"
FT                   /db_xref="InterPro:IPR035089"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVB1"
FT                   /protein_id="BAI60383.1"
FT                   /translation="MTRILPGVEIQVIKEIVPQQLNPSGVVALIGTTEKGEALVPTPVS
FT                   SYAEFADKFGSSESFTVTKDAKQAFQNGVFQVVVVPISGQNGTKGTLVLKDRKGRDTVL
FT                   LTAKSSGEEGNKIMVKVEGDADSIRVSVSDGASLEIYEDVTMNSSSQNYLVDIINQRSA
FT                   MVTAEDQHSSAKFPHNNPAAVEGQLSGGVTGVISKADYEAALDKLEGEPDVDIVAACEV
FT                   SDPEIHALIEAHCLKMSIDAKNRIGLGSVAKGESIKDICNRTTVMASDRFVIVAPYGCL
FT                   GAVAGLMSRLNYYESPTFKPVSGLAKLEKKYTPSEQMEMLKAGVLPLEAQKGRGIVVVK
FT                   GISTSKEQISVTRIADHAVRGVKSVSDLFIGTLNSPTGRAALKGKIIEFFMRMESEGAI
FT                   VPSTDGKEPPFLVDVYSSELDFAQGIVRVNIAVRPVRAMDYIYATIKVEA"
FT   CDS_pept        313829..314242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0312"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0312"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60384"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVB2"
FT                   /protein_id="BAI60384.1"
FT                   /translation="MAVQLFSARWSNVTITPSMGGSSETVGVQSIEYSINLNKEDHFEG
FT                   GSHLRTYVSYGYKQVKGKIQVKSVSTVLDALLDKMEEMNNSFSLHVDLSNGTDHKVLDF
FT                   FECYLESKEFGIDVNGNGISTYSFTARDVKEGA"
FT   CDS_pept        314260..314616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0313"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0313"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60385"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVB3"
FT                   /protein_id="BAI60385.1"
FT                   /translation="MKKLTKEDILKGKDKRETFRVDAYDSDVVLRPLTDGELSEVFAVI
FT                   GNVPLKSDGTPDGGQVDIVKNFKALRLVTSLGLVEPKLSVDEVGDMKFGVPEQIGTRIL
FT                   EISGISSAVKKELR"
FT   CDS_pept        314613..314837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0314"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0314"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60386"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVB4"
FT                   /protein_id="BAI60386.1"
FT                   /translation="MKRFVRSPEGQELAMLCLDFGYKLADRPGDLTRPQINFLALALSD
FT                   RLERINLARSDRPGVNKIVFVDDDEDEEE"
FT   CDS_pept        314912..317083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0315"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0315"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60387"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVB5"
FT                   /protein_id="BAI60387.1"
FT                   /translation="MYESLPPAAARIGSVSTIGLERMAGPDSPAEQPLPANIILLIEEL
FT                   RRSVIELNARAASVPEIHKYYLPPAAPALAVPAPVQAPAVEPVTVYVREQADQADKNQE
FT                   PVELSRIVPAKPAQAVDNDIIRSNVVLGRLREDYAGLTYDLAEVERLIKEAMRSSAADI
FT                   PAMVSAKATPIMPSQQAGGEYVERPAPEVIVREKTSIVKEVVTKEGARESKAGLDDAKV
FT                   SKPAVLATALAQGISLPGVIRKSTVDMMIMQAALAPEPARYLAVPVVPESRSAIARDAV
FT                   PDMVSSKIPAPEAPVVQALGIARAFNALIGSYLSFRGTPARRGDIKDGVTQLLLSLPEQ
FT                   KAVEGPASGLFDAMAALQAAGPKAAGMLQPVEIAARAPATAAAPLTQDNEPMRSTVLGD
FT                   LGEMHNTMVALQDAVGSLRRASPPVAEVPEAAEIPAAEWPEYEGELSVIRASIARLQAA
FT                   MDYLSVNVPTLADLVVIQRSVVDIPQVAAPQAAAPVAVTIEGVPPKAAAPVSLPDLSWV
FT                   TREFWQMQGMIARLQVPMYAEGGLVEEPTLAFVGESEPEWIVPMSAWDASQSKLNDFYH
FT                   MLWSQIQDLGTSMQDTVDGVNEALEGITPGGEGKPEDTDLRQQLQDTMKELVDRYLGMI
FT                   GLSVDTLKDAEKTAGMGLVLGTATVALPYAKKVMVGDDEEDKEESSGGGKEDDKEEDDE
FT                   EDFWEMIDGLDEAASISDKRDGKFDPDEK"
FT   CDS_pept        317090..318280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0316"
FT                   /product="hypothetical protein"
FT                   /note="Contains two Bacterial Ig-like, group 1 domains
FT                   (IPR003344)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0316"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60388"
FT                   /db_xref="InterPro:IPR003344"
FT                   /db_xref="InterPro:IPR008964"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVB6"
FT                   /protein_id="BAI60388.1"
FT                   /translation="MVRMDVEISETKTAGKKLVLTSSGLGLYVKSLLGVGAYYSVNNVT
FT                   ISESRNFVEHTMPGRKGSVFQDMGRPAIKVTIEGNIAEDGIYYGLSGKGKNTIMLEELH
FT                   KLCDAGNPVDFLCDMPALFGVSRVIIQELEATEVKGRKHNYNYKLTLKEWSEPAMGSDA
FT                   LRNKYVESMKKDAKIQLLKKGVVAGAAAGVVVTYMAVTTVKTNRLVIKLDIDKRVVTAE
FT                   EAVDIKASVNDSKGDPVADADVTIKQDTKELFSGKTNAEGIVSATFQSPDAGNYTVTAT
FT                   AVKSDYGDGEASATVTVDTRIKARLSTDKATIKTTGKANIKVTAADCNGKAIEGATIEL
FT                   ACTGATLEPASGSADSQGAFTASFSSTTAGSYEVKATVKKSPYADGNANVTIKVIT"
FT   CDS_pept        318325..319557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0317"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0317"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60389"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVB7"
FT                   /protein_id="BAI60389.1"
FT                   /translation="MPPSAKLLPKMPLPKKPLPAIPKIKKPLPKIPLSSRYRPIYKVTI
FT                   KTPQGKQYEYNSWYYKDPTGIKTKQNNKLAIYIDRDLEKKLDVCLMNISLRSGDLIDTA
FT                   KSPKFGDIRIGSVIKVYLGYANVNEENPSLKESDIAFAGIIDEISHSFKKISITAFSMA
FT                   YKIIFKKADPKKFEGDDWKKNEKSSKDIITTLLEKKLDVDKIDEGLKFTAYTPSDEQSI
FT                   YDNIKTLADCNGFLFYISKDGKARIHEKSSRAHSFKYGEDILENSITMSKPAYDKVEVK
FT                   FTYKKDGKDTSVLSSKPIAGSTLAKDKKEETKNIDFGLADDVNTAKKIAENILRGIYVI
FT                   ETGEVKVIGNTGVDLGDELTISFDSSAPGAKELDYMKRDKVVITRVTHKYGKKSGFTTT
FT                   IGWKKFEKKKP"
FT   CDS_pept        319591..320451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0318"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0318"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60390"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVB8"
FT                   /protein_id="BAI60390.1"
FT                   /translation="MVTMPRYFIDIGQVTKVMPHKSNNDGANYHCDIMLRDSGNSLTNV
FT                   PVASTRMGFACIPEVDDHVLVGFIRGNLYMPVILGTLYNDQAKPPLYLEGEAVYVCPEY
FT                   KQKQSSDPKPEELKRIYMELPKHKMKLIVREEDVHYELLKYKFDLKKEEGIKLEVNEKT
FT                   SLAISKDGDITITAKDTKISINKEGEIAIDSKQKVGIKTTAEVSLESSGGDMKLTANNI
FT                   TLKGNQSVSIEGTQAVEIKGTNAKMEAKAQLDIKGAMAKVEATGMMDVKASGVMNIKGS
FT                   IVNIN"
FT   CDS_pept        320460..320855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0319"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains at least one PAAR repeat (IPR008727)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0319"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60391"
FT                   /db_xref="InterPro:IPR008727"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVB9"
FT                   /protein_id="BAI60391.1"
FT                   /translation="MGMPAAKMGDKVMAVDTHIFLIPAPPGPPVPTPLPSPFNGTITGN
FT                   CSTNVIIEKKPAATVGSTAMNMPPHMPQGGPFQVPPTNQGQIIMGSPTVMINGKPAARN
FT                   GDTALTCNDPAPLPIGKIIAVGTVMIG"
FT   CDS_pept        320867..321304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0320"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0320"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60392"
FT                   /db_xref="InterPro:IPR020288"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVC0"
FT                   /protein_id="BAI60392.1"
FT                   /translation="MPDSIYGSDIKLRMGQYAGFYGIGADLYVNRRGDVDIVSGRENLG
FT                   QAIIHRLLTRQGELEELGYPEYGSNLHELIGSPNNLKTWNLVKLYVNQCLSQEVRVEKV
FT                   ESIDVMPHGSDPHAVVVEVAIVPIGSETPLGISFPYNLEVE"
FT   CDS_pept        321304..322842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0321"
FT                   /product="conserved hypothetical protein"
FT                   /note="Belongs to the Phage baseplate assembly predicted
FT                   J-like family (IPR006949)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0321"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60393"
FT                   /db_xref="InterPro:IPR006949"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVC1"
FT                   /protein_id="BAI60393.1"
FT                   /translation="MSYVPKAYRDIADAILSQIASGVVEQKFTYLPDGGVYTLSYPEEK
FT                   TVVKVEGSLNGYPHVFTKDVDYLVSDHTLKWLQGSKPDGNTPFTVYHLAGTPVDITDVN
FT                   PGSVVRTIIESIAVEMGFLYTQMEAVYESSFIDTATEQALDLVVAMLGVTRKPAEHATG
FT                   DVTFGRSGEPKLLSVPNEAIVFDGKDAHALKNGMVKSVKSIEGQANGTAVQFAEGTDFR
FT                   LESDRIVWLQPGKRPDKSSVFYVNYSYYEKIIIPKDSEVSTYSRNSENIRSFKTIREAL
FT                   LTKNSAGKWEIIVPVVATVPGRAGNVFSGSISMMPTAIPGVDYVVNKSDIMGGAEVEGD
FT                   EELRDRAKRAMERAGKATTRALQLAVQAVEGVTGEVVVIDQPDGVPGIIQVIATGGDRE
FT                   EIENAIEETRSAGIRVELKRPVSVPLDVRLMVYTAAGAEIEAVRQGVDQAVRKYFASLE
FT                   IGDDVIISRIIEAAVSVSGVKDVREVTINDKAENVRIKRDEKGDCRLLELFMEA"
FT   CDS_pept        322839..323750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0322"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0322"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60394"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVC2"
FT                   /protein_id="BAI60394.1"
FT                   /translation="MMSRADDIADRLPHFYMTWNADSAVTTLIRSVANVLDYTQSDLIE
FT                   ILRSHWVDTARGNDLDRLGLMLSTQRKVGEADQEYRGRLKTAIIGYSGGGTLNSIRIMI
FT                   RIALGLPEDYPIDIVENPKENMKKSWTVPANGEWAVDPVSISSSQPRITLAVETPDVEI
FT                   NNPTITNIDTGQSVTFNGRMARGDVLNLYAGRAILNGADRTASLSSTTPLTLPRGKTRW
FT                   KYTEAVGSNLGVFDRAQFDKSVFAVEIATKVTFEWSAYLPATFEVRIPSASLERVGARP
FT                   EYVQGLLDSLKASGVKGTVKVV"
FT   CDS_pept        323789..324418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0323"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0323"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60395"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVC3"
FT                   /protein_id="BAI60395.1"
FT                   /translation="MALELSYKKPGDLIRSEEWNRIIDELAGLRKYIDNMTRSVTLTQL
FT                   SSPAGKSYNLSTNMEDEYNYGIDTMGLITKQFYTDKNTVGTICRFGLNDYADTVSYWSG
FT                   AVGGDKEVLDITVEYVDGTAFNARGVYIHEWSNLRPRGTKNPYVEYLQSPNQRLWYRYV
FT                   LVNPYPDKEIRHITFADTSKDSAVRIANVLHYTTRVKQLVLPVVKT"
FT   CDS_pept        324423..325121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0324"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0324"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60396"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVC4"
FT                   /protein_id="BAI60396.1"
FT                   /translation="MIGQIDDALLDRLKSGLSLAKDEVALGPAAGKKRSVSLVCTDFIV
FT                   DETSVGGSMSVKYEEVVDMLDADGSTAIFRLSRPPVKAIISVECPPGTFKKEGDDYMVE
FT                   PSRGIVSLRAVPKKGKESVRVKYSIPRAIGETQNVHMALTYAITVKEADLRTREDIAMD
FT                   IIRLFYREKPFLVERGVEEIQIVKGFGNGAEGSPEDELTLVYKVLATLKVDIVTVGPLE
FT                   KIKLDGIRVK"
FT   CDS_pept        complement(325429..329370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0325"
FT                   /product="hypothetical protein"
FT                   /note="Contains at least one Bacterial Ig-like, group 1
FT                   domain (IPR003344).; Contains at least one Cna B-type
FT                   domain (IPR008454)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0325"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60397"
FT                   /db_xref="GOA:D1YVC5"
FT                   /db_xref="InterPro:IPR003344"
FT                   /db_xref="InterPro:IPR003644"
FT                   /db_xref="InterPro:IPR008964"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR038081"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVC5"
FT                   /protein_id="BAI60397.1"
FT                   /translation="MRQIRLALFVLALALLPALISAEASGSALVYFNQTSESVGEGSTV
FT                   GLTIIYDNPDAWIIGGLPVTIKMRATGGNATYGTNYTATLNGVPFNSDGSATYVFTPVY
FT                   TYWHEIPVVFHASNSIANDVSQEFTLEVSGALYTYPGWPDRNTLHIDKLPTTQFQAVQE
FT                   SVNEGSSINVAVVRSGATYMPSSVDYTCMSNATRGGTFTVSPQPQTVNFAAGETVKYIT
FT                   VSTSVDGYFENDYNVTLQLSNPVGCRLVNTVKNNLTVTSSGSTPVVEFKETSESVDEGG
FT                   SVNLTVTREGDISNTASKVELSMDILPGTGYYAVTGNNATQLNNNNYQITFQKGEKEKT
FT                   ITINADSNLAYDDTRVIKFTLEAVNGGKALIGTKGSNDLTINDRTALPEIEFVLSGEAV
FT                   DEGNAIDITLCRTGATNIRSSVEFSYTVEGHSRDNFSVSPTNMVLFQPGQKTANITVTT
FT                   RDDVICGNDYRLDFTLTNPVNATIGNSMNALAVSDTTPYPVVSFTAGIASVNEGNTVSL
FT                   YLTRSGAKNVESRVVFQYDNTLSRNMYVSRFQADPALDSTSKCIITFAPNETGKTVNIS
FT                   VIEDNRTHDAQYAYFRLQPQDNVSIGSLDHVEVEVIDLSERVPEPYDVYFTESGFDANS
FT                   GGLCEIIIERSAYDRESSIIFYRASGSAASPDDYSTTAGLPYTVHFAVKERFQKITVLV
FT                   NSSAQGEKSVVFGLQKVSDDAVPGNPQTYTLSIHGLTPTPTPTPEPTPTPTPAPDVEQL
FT                   YVNANLDTEQIVAGYEGKITITVTDGTRPVSGAKVSIDRTGGQIIMLNSTTDGNGVCYA
FT                   TFKSDNPGQHSLTITATATGYDPGTAMLAASVVNAIPGALTVNAMVKQQPVVIGSEAEV
FT                   TVSVMDGGIPVPGASIKIETTSGSVTPSSGTTDSDGNMFAMFHSGDPGSYILTVTATAS
FT                   GHPASRVSYAVQVVGADERHLYAAMSVDPKSVSPNSKAEVTVTVTDGVMPVSNAQVSLV
FT                   ATGGTITPESGVTDSDGKFVAQYTAGSEGTYTLGVTAYSEGIGQASYSTFIKVKQGMFD
FT                   MQILIYFIIAVIIIAIVLIILVTLIEKWREYDLRVVPKVGAIPADGMSRLPVRIEVFNG
FT                   FGRPKKARSDTYVELESTAGRIESVTIPSGRNFADAVLTSSKEFGPVTIKAKIGDKANA
FT                   SVPVEFKLEGGSLAVTITPGMIIADSKSSASVNVRIRNSKGNYVVPLSDKVIELNTTLG
FT                   DIVGSIVNMPARANSANATIVSNKEGGIAMVTATMGTLKGTGRVEFRSMSRQLCANCGQ
FT                   PIPGSLPVCPSCGAPAVSADDKKATASMN"
FT   CDS_pept        complement(329370..332561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0326"
FT                   /product="hypothetical protein"
FT                   /note="Contains at least one Cna B-type domain
FT                   (IPR008454)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0326"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60398"
FT                   /db_xref="GOA:D1YVC6"
FT                   /db_xref="InterPro:IPR003344"
FT                   /db_xref="InterPro:IPR008964"
FT                   /db_xref="InterPro:IPR011044"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR025874"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVC6"
FT                   /protein_id="BAI60398.1"
FT                   /translation="MVRKALVACILSIIIAVFLLLACTPVQAELVKKVFVTCENNGEVW
FT                   TVDPYMVNQSTKTIVGSQPKDLAVDSSGKYAYVLNYGDNDISVVDLAGGTVVRTIDLEE
FT                   TIPDYHPFRIVADPQRNYAYVAANLTGNPDDCVIFVINMNTGLVSKTIESEKYNQGSGG
FT                   VRAIAVTYFGGTPYLFITHYYDNELVIYNLNTYSEIGSVNIFHHNGGGDYEVFNTTDVA
FT                   FSANGQFVYVAHKNNVSMFNTDLLIGLAGSGIIYVTGHTISTSGVAGEVNRLLPDNTST
FT                   GVYLSCAPNSIAIADATLSRISVTIPVSYGPKEMAFDNNTLYVCDSDSSISVVDLSRQV
FT                   EIGRIKVGSMPSGIVVQTVDVPVPVPSPSPTPLPVTTVNVTVDPNPIIAGSDAQVKVTV
FT                   MNGTTPLKNSFVRVISTGGTVRSSSGTTTSDGVFLTNFTSSSSGRFDLTISANTSGYLD
FT                   QSSSAVIVVNPAGAKMLSLNVTAEPKELTSGSEASIAVKVTDNGAPVSDATVSFISTGG
FT                   KVTRLLPTTASDGTCYAKFTSNASGSFVLTVTANKSDYGTATANTIITVAPAAVNVLTM
FT                   NVTVSPQPVVIGNESVITVTVMNGTQPVNGARVDLTSTFGAVTPLSGLTTSDGKFLAKF
FT                   KPGSPGFGFLTASVNATGYERATSSTAIEAASAAPKKLYINMTIDPKPVDVNEGATVAI
FT                   SVTDGVKPLSDARINVTCTGGSIVPAYGKTDSDGKYNAKFIPDDAGTYTIAVVATATGF
FT                   EQASSNAMVDATESLVLSDFVFWIALIIVILAILIIAIVWFLRKWLRKSLSIVPKKTRI
FT                   PADGVTKVPVRVQYVNGFGMPSRMRSDVEVELEATSGTIKSVTLPSRRDYIDTDLTASK
FT                   EFGTVTITAKSARDVASAEVLYVVDNGSLEVTVAPDSIPADGKSSASITVKVKDGKGNY
FT                   VKPLEDTVIEFNTSLGDAVSSVYMPAGDQSANATIFSGDMTGISVVTASMGNLRGEAKI
FT                   EFRGLPKRFCMNCGSPMTLDAQSCPACGKNPPSGVDTKQCMTCGTVIPEQAQFCHKCGA
FT                   MQNVRVKVPPVGGLN"
FT   CDS_pept        complement(332742..333719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0327"
FT                   /product="alanine dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0327"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60399"
FT                   /db_xref="GOA:D1YVC7"
FT                   /db_xref="InterPro:IPR003462"
FT                   /db_xref="InterPro:IPR012742"
FT                   /db_xref="InterPro:IPR023401"
FT                   /db_xref="InterPro:IPR028609"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVC7"
FT                   /protein_id="BAI60399.1"
FT                   /translation="MVRLLSDTDIKRLVTMNDIVPAVENVFAEYAEGRVEMPSKIYLDI
FT                   KGYGDFRAMPSYVPSIGTAGVKWVNVHPDNPSKGLPTVMATILLNDPETGRLICVMNGS
FT                   TLTDERTGAAGGVAAKYLARKDSSVVGLIGSGHQAYTQMLAYNVVFGRQIKLVKVYSRH
FT                   PEHAEALAGRIRAEMGYDAQAVMTAQEAADSDIIATITPARRPVLIADWVKPGTHINAI
FT                   GADAPGKQELESMLTVKARVFVDSVEQASHSGEINVPWSQGLLNKDKLAGTIGEVIVGM
FT                   MPGRTSDREITVFDSTGLSIQDMAVAHLVYERALKEHIGTDVNI"
FT   CDS_pept        complement(333820..334404)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbr-1"
FT                   /locus_tag="MCP_0328"
FT                   /product="rubrerythrin"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0328"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60400"
FT                   /db_xref="GOA:D1YVC8"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR003251"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR024934"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVC8"
FT                   /protein_id="BAI60400.1"
FT                   /translation="MTQTIENLTKAFIGESMARNRYTFYASTAREEGYEQIAAIFQLTA
FT                   DNENEHAEWLMKMINQLKAKSTDDYGEIHVEAAAPTVWGTTVENLKAAIAGETYEYTTM
FT                   YPEFARVAKAEGYKDIAGRLLSIANAEEHHGGRYARILKEVEAGTFFKKPQEVAWVCRK
FT                   CGYVHFGREPPAKCPSCDHEKSYYELLNEVY"
FT   CDS_pept        334652..335407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0329"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0329"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60401"
FT                   /db_xref="GOA:D1YVC9"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR004096"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR024096"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVC9"
FT                   /protein_id="BAI60401.1"
FT                   /translation="MKQKKGRDERAAELFATEGGIRAVDSPVRMSILSMLLEKEMRFDE
FT                   IVEASGRAKSTISVHLKSLADDGIVSSRADPADARKKIFFIDSSYLGGLSRRKKLKKDM
FT                   TEYISKYAMSSGDPFAFFRLMFRTIRVALLDEGIDLDPVLHEAGASVGEALYPRVADPD
FT                   LGRLLANLAKFWEAQKLGRLDVRSVEPLDIVICDCFECQDLPYLGRPACAFDSGIFETI
FT                   FTKYYNSPAKVKETKCYAMGDGRCEFIIE"
FT   CDS_pept        complement(335424..336371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0330"
FT                   /product="putative S1 family peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0330"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60402"
FT                   /db_xref="GOA:D1YVD0"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVD0"
FT                   /protein_id="BAI60402.1"
FT                   /translation="MIPVDEEELVRIIENASPWVVNISVSMVQDAYMNAAPVQGMGSGI
FT                   VVDSAGYILTNNHIVENANGMVVSMFDGTQLDGTLMGNDPMSDVAVVKVDSNKKLPVAR
FT                   LGNSDGVKVGNTAIAIGNPFGFMLRGPTVTVGVISALNRTIQADKGVFENLFQTDAHIN
FT                   PGNSGGPLLNSKGEVIGMNSANIPFAQGIGFSIPINNAMAIAKELIEHGKVIRPWLGIL
FT                   GIGLNKDIAAYYNLSAEEGVLITRSFENSPAWAEGITSGDVITKVDGKPIKDMTELAGY
FT                   VRKKKIGDVITLSVKRGNLQGDVKVRLAEIPTSK"
FT   CDS_pept        complement(336460..337908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0331"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0331"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60403"
FT                   /db_xref="GOA:D1YVD1"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVD1"
FT                   /protein_id="BAI60403.1"
FT                   /translation="MNRVGKSMGAFAATIICFVLVCGSTLPLALAADTTPPVTNASLVG
FT                   TYNSTSGWYYGDSGPTVSLSATDDNSGVAHTYYRLDSNAEVTYTSSFTIADGSHTLAFR
FT                   SVDNAGNTETLSASHNYLTLNVDIIKPTLNITINGKWNATAGCYSGNTSVNLTASDKGS
FT                   GVSSIQYSFDNSNWKDYAGNITIPDGSNTLYYRSYDKAGNVNASSMAFNVFNPEILTSP
FT                   AHDTWYDHYIYGIMFVKPASNDTRYIQYSYSSDHKVWYTYDMDNPAPFDLFKEGNYSIW
FT                   YRAVSRSGNTSDIRFMWFGIDITPPTIGISYDGDMSRSKGWFNGDVTVHINANDNGSIS
FT                   RTEYSWDNSNWNTYKDPFKVTWGKSRTIFYRTFDMYDRTASGSTFIYFRPGSVDQGPMS
FT                   DTVYINGSTSGGNPTATASPTENPTPVPTQQPTPTPTIEPSATPVPDTSSGSGNPLAIA
FT                   VLVGVLAFLGIAAAAVYLFMSKKK"
FT   CDS_pept        complement(338051..338962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0332"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0332"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60404"
FT                   /db_xref="GOA:D1YVD2"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVD2"
FT                   /protein_id="BAI60404.1"
FT                   /translation="MDGFFSLFGKSMKELGKSPILLLAGLILGALSLPLLAGYIGVQQM
FT                   IRSALVDFSQLVVPLLITPFITGGALGYALEVREKGSSSLSTFFASAKKSYPKLLICGI
FT                   IAFIVYYFLLTAIMVFVLAGTVDPFIGSMLGFLMLGLTFFVLMSIEFYDIDVVSKGSGI
FT                   MAAFRNSMDFARKNLLTAAGFFIMAVVLKSLVQLPLSFGMAGAMISNETYYNALMAMSN
FT                   ASANATNATAANASVNMTTLLSMGNITLSPEALVVVGIFQMLIQGFVFALLALFKANLY
FT                   MVVRNRKKITDFDYDFSDEESP"
FT   CDS_pept        complement(339006..339734)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0333"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0333"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60405"
FT                   /db_xref="GOA:D1YVD3"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVD3"
FT                   /protein_id="BAI60405.1"
FT                   /translation="MDSIASASVKYGSSRTRELLFRPLDLKFWLLATLGLSAGDPRQAE
FT                   MCRLRPYYRGTRLLATMGVLIILPAFLIPFMAPFIGSGGALVLVVLYLVFVLAMCLASL
FT                   FLEVSLDAVFAIGHEAGCGFSDAFRAFARFVREDPGNAAGYMGAKLLVDTGAMTIVSLF
FT                   FLPALFTMVFILSSVLHTLQAGQAVSRATAFGGLALVAVFCAAAMLASGLLSVPLSAFY
FT                   GYYTEETVRRICPVSYAARR"
FT   CDS_pept        complement(339784..340074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0334"
FT                   /product="putative pyrophosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0334"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60406"
FT                   /db_xref="GOA:D1YVD4"
FT                   /db_xref="InterPro:IPR004518"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVD4"
FT                   /protein_id="BAI60406.1"
FT                   /translation="MEIGEFQRLMKALYGANDAERGLQKTQLWFYEECGELAEAMRKND
FT                   KKAIEEEMADVFAWMVSMANMLDIDVEKACLEKYPMKCPRCGHLPCTCTEK"
FT   CDS_pept        complement(340076..340897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisF"
FT                   /locus_tag="MCP_0335"
FT                   /product="imidazole glycerol phosphate synthase subunit
FT                   HisF"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0335"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60407"
FT                   /db_xref="GOA:D1YVD5"
FT                   /db_xref="InterPro:IPR004651"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVD5"
FT                   /protein_id="BAI60407.1"
FT                   /translation="MLTKRVIPCLDVVLGEGGGCVVKGVEFVNLKNAGDPVELAKRYNE
FT                   QGADELVFLDITASHEGRRTMIDVIERTADEVFIPMTVGGGIKTIEGIRSILRAGADKI
FT                   TVNTTAVKDPSFIKESSDIFGSQCIVTAIDCRSNTNIGDPNAVNIIKNKFGKPAWYEVV
FT                   IYGGRTPTGIDAIEWAKKVEELGSGEIMLTSMDADGTKDGYDLPITKAISKAVRIPIIA
FT                   SGGAGNIEHMYEAFAEADADAALAASIFHFGEYTIGQAKEYLRSKGVPVRL"
FT   CDS_pept        complement(341131..342180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0336"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0336"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60408"
FT                   /db_xref="GOA:D1YVD6"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVD6"
FT                   /protein_id="BAI60408.1"
FT                   /translation="MTEWWAFKPITTAFEKAKKILLEPFNAWAWLKLMIIVFFVGTGSS
FT                   RISNQFSNMANYRTGPEDTAGIEQGITSLLSNSTILAIIIVAALLIILVAVLFAYLRNV
FT                   FSFVLIKALTSGDVHIIQPLKENLGRGFRLFVFTLAASILTLVVVLAFIAIAILLILLA
FT                   VQAGTSSAAGIVTLILVICVICLLILLMVLFSIAMGIFIGFTYDFVAPMVYFKGRGIVE
FT                   SWKWLWASIKKDWQQYGVYVITRWALELAVGLLSMIIIVPVALIFIAILVAGCILAAAV
FT                   AKTSVALAVVIGLVLLVVLALFLIALMAISMPIAVYFRYYSLDVLKHIDPSAVIYSERF
FT                   APPPATLPA"
FT   CDS_pept        complement(342440..343060)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpD-1"
FT                   /locus_tag="MCP_0337"
FT                   /product="A-type ATP synthase subunit D"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0337"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60409"
FT                   /db_xref="GOA:D1YVD7"
FT                   /db_xref="InterPro:IPR002699"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVD7"
FT                   /protein_id="BAI60409.1"
FT                   /translation="MAIKDNIKPTRSELLELKKKIVLSQSGHKLLKMKRDGLILEFFEI
FT                   MEKARNARSELMKSYDDATTKIAIARAVEGVVAVRSAAFSLTEKPEINLESKNVMGVIV
FT                   PKIESSGVQKPILNRGYGIINTSARIDEAAQGYERLVEQIIISAEIESAMKKLLDDIEK
FT                   TKRRVNALEFKVIPEQLEAEQFIKLRLEEMERENTFRLKKIKD"
FT   CDS_pept        complement(343071..344456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpB-1"
FT                   /locus_tag="MCP_0338"
FT                   /product="A-type ATP synthase subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0338"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60410"
FT                   /db_xref="GOA:D1YVD8"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR022879"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVD8"
FT                   /protein_id="BAI60410.1"
FT                   /translation="MKEYKTITEIAGPLVFVKKTEPVSYNELVSIQLSDGSIKRGQVLD
FT                   TSKDVVVVQVFEGTEGISRECGVKFLGEAIKMPVSKDMLGRILSGAGDPLDGGPAIIPE
FT                   KRLDIVGAAINPYSRRQPKDFIQTGISTIDGMNTLVRGQKLPIFSGAGLPHNEIALQIA
FT                   RQAKVVGSTEPFAVVFCAMGITSEEAQTFMQDFERTGALERAVVFMNLADDPAIERIIT
FT                   PRLALTTAEYLAFEHDMHVLVIYTDMTNYCEALRQIGAAREEVPGRRGYPGYMYTDLAM
FT                   LYERAGMIDGKKGSITQVPILTMPGDDITHPIPDLTGYITEGQIVVARDLHRKGIYPPI
FT                   NVSPSLSRLMNLGIGVGKTREDHKAVSDQCYSAYAEGKDLRGLVAIVGKDALSERDRKF
FT                   LEFADIFEDKLVRQSREEDRTIEQTLDMMWGLLATLPVTELNKIDNKYIDKYHPAKKAK
FT                   VAA"
FT   CDS_pept        complement(344458..346197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpA-1"
FT                   /locus_tag="MCP_0339"
FT                   /product="A-type ATP synthase subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0339"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60411"
FT                   /db_xref="GOA:D1YVD9"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005726"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR022878"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031686"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVD9"
FT                   /protein_id="BAI60411.1"
FT                   /translation="MSLVGEIFRVAGPVVTAVGLQARMYDVAKVGKEGLMGEVIEIADD
FT                   KTIIQVYEDTSGLRPGEPVENTGMPLSVELGPGLLTSIYDGIQRPLPILKSKMGNFIER
FT                   GVTASGLSHEKKWQFTPTVNAGDKVSGGSIIGTVPETKSIVHKVMVPPLTGETAIKDIK
FT                   AGEFTVDEVIGHLADGTELRLLQKWPVRKPRPFKEKLRPDIPLVTGQRILDCLFPIAKG
FT                   GTAAIPGPFGSGKTVTQQQLAKWSDAEIVVYIGCGERGNEMTEVLSEFPHLTDPKSGNP
FT                   LMDRTVLIANTSNMPVAAREASVYTGITIAEYYRDMGYGVSLMADSTSRWAEAMREISS
FT                   RLEEMPGEEGYPAYLAARLSQFYERAGRVITNMGKEGSVSVIGAVSPPGGDFSEPVTQN
FT                   TLRIVKVFWALDAKLAQRRHFPAINWLNSYSLYQDSLKEWYTKNIGGDWNTLKAEAMEL
FT                   LQRESELQEIVQLVGSDALPEDQQLTLEIARMIREYFLQQNAYHEVDTFCSLKKQFMMM
FT                   NEIMAFGRLAKRALAAGVPMPKILGLKSKTDLAKVKFEADFEKYLGNVDNEMKAEFKAL
FT                   EAA"
FT   CDS_pept        complement(346228..346527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpF-1"
FT                   /locus_tag="MCP_0340"
FT                   /product="A-type ATP synthase subunit F"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0340"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60412"
FT                   /db_xref="GOA:D1YVE0"
FT                   /db_xref="InterPro:IPR008218"
FT                   /db_xref="InterPro:IPR022944"
FT                   /db_xref="InterPro:IPR036906"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVE0"
FT                   /protein_id="BAI60412.1"
FT                   /translation="MDIAVIGKSDFTTGFRLAGIRKVYDVASEKDLEEKVRQCINDGDV
FT                   GIVVLYADDVKKLPTVLQKTVDESVEPTFIAIGGREESGLRDKIKRAIGVDLWK"
FT   CDS_pept        complement(346527..347591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpC-1"
FT                   /locus_tag="MCP_0341"
FT                   /product="A-type ATP synthase subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0341"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60413"
FT                   /db_xref="GOA:D1YVE1"
FT                   /db_xref="InterPro:IPR002843"
FT                   /db_xref="InterPro:IPR014272"
FT                   /db_xref="InterPro:IPR035067"
FT                   /db_xref="InterPro:IPR036079"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVE1"
FT                   /protein_id="BAI60413.1"
FT                   /translation="MLFRRSAGAGNYAYATARVKARKAFLFPRDTYLKLLQMDVPEISR
FT                   FIGESKYKEEIDELATKYSGIDLMEYALNLNLARDFGQIMSFCEGDLKLLIGSYLNRWD
FT                   IWNIKSILRGKSFGASEEEIRETLVPAGSLSTQKLNDLIRKGTIADVVEGLAGTMFYKP
FT                   LTSALDEYNRTHLLSAFENALDKAYYANLMAIKIAGTTADELFISFIKHEIDAVNLRTL
FT                   FRLKRENVEHDKIMAYMIPGGSKFGMDDLRKLAQAPNYNEFVGMLKEYKLPEDMGPAIQ
FT                   KSQETGSLNSVEIALRKALIANGEKISHLYPLSVTPILGYIVRKNTEVNNLRIIARGKE
FT                   SHLSDEAIKSQLVI"
FT   CDS_pept        complement(347596..348156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpE-1"
FT                   /locus_tag="MCP_0342"
FT                   /product="A-type ATP synthase subunit E"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0342"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60414"
FT                   /db_xref="GOA:D1YVE2"
FT                   /db_xref="InterPro:IPR002842"
FT                   /db_xref="InterPro:IPR038495"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVE2"
FT                   /protein_id="BAI60414.1"
FT                   /translation="MGLDRVVKDISDKAEAESRDITARAQAEASVIKKDAEAEAKRAYD
FT                   AEMARADQAILKMRQRELSSAKLDIKKSKLNAEKDVLQEVRSDLIKRLSAMPKEKKVDI
FT                   LNKLINMARKDVPMGKIYSNAGDAELIKSSGYEYGGNIKCIGGIIVTSMDGSVNLDYTF
FT                   DSIMEDVWNAQMKPVSDILFGSR"
FT   CDS_pept        complement(348182..348397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpK-1"
FT                   /locus_tag="MCP_0343"
FT                   /product="A-type ATP synthase subunit K"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0343"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60415"
FT                   /db_xref="GOA:D1YVE3"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVE3"
FT                   /protein_id="BAI60415.1"
FT                   /translation="MPVEGLVAIGAGLAVGLAGIGSGIAEKDIGAAAVGAIAEDRSFFG
FT                   QGLIFTVIPETIVIFGLVIAILLMFL"
FT   CDS_pept        complement(348402..350426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpI-1"
FT                   /locus_tag="MCP_0344"
FT                   /product="A-type ATP synthase subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0344"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60416"
FT                   /db_xref="GOA:D1YVE4"
FT                   /db_xref="InterPro:IPR002490"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVE4"
FT                   /protein_id="BAI60416.1"
FT                   /translation="MLEPQRMDRVLIVGTKDVMESTINTLHDLDVFHVEDYTAEGEYFK
FT                   IGKPLKAATSLSEKLLKLRSISSYLGTKSNIQFKEKREKVASDIEKDLGPLEASLTSKM
FT                   NEKSALETGIKDIAHKEDILKPYEALGLPLELLYGYENVAAYVGTVPKDIEPVVKAVTG
FT                   DYELFSAPYEKGYTIALFVPRDAAPKVSESLFKNDFIEIEPLHEKGQPLEIKKALEIRK
FT                   AELKSKLEAVNKDIEEMNKQYSKFILASEELLAIDTQKAEAPLKFATSDNAFIVDGWVP
FT                   VNEFESFKQKMLKATGDRVHVTRVEPEPEAYPRETEAHAVHHEVDAPVKYANPKFMYSL
FT                   QAFIDLYARPRYDEIDPTLIFFIMFPLFYGFILGDIGYGLILLIGGFAVKRMLKYSPGF
FT                   QILTTALIICSVSSIVFGFIFGEFMGFNMAKEGILGFTLPYPHTINIGPIGPFSLPLER
FT                   LFPGGFEHGSYVFGIKDLLVFTCLVGVAQILLGYIFGFRNEYVQHGLKTAILHKGSWML
FT                   ILLGGVSAVWYVFPLMITQSLPTFNVMDPLFLAGAAMFIGGFVLLIMGEGATGILEVPG
FT                   LMTNILSYTRLLAVGMSSVGIAFAVNTMTAMLAASGIIGLIVAVIVFVIGHTVNLVLGI
FT                   IAPGLHALRLHYVEFFMKFYKGGGKIYDPFGYMRKYTED"
FT   CDS_pept        complement(350401..350745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpH"
FT                   /locus_tag="MCP_0345"
FT                   /product="A-type ATP synthase subunit H"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0345"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60417"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVE5"
FT                   /protein_id="BAI60417.1"
FT                   /translation="MSRAEILSQLKQTEEEAKVRKAKAEEEAKQIAAAARKDASGIVEA
FT                   ARSKASADADAKVKKASAEIQAEANAQKSEGEKQAAALKTSAKAKVNAATDYLMKEFEG
FT                   YVNARTSTHG"
FT   CDS_pept        complement(350934..352157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0346"
FT                   /product="conserved hypothetical protein"
FT                   /note="Belongs to the MgtC/SapB transporter family
FT                   (IPR003416)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0346"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60418"
FT                   /db_xref="GOA:D1YVE6"
FT                   /db_xref="InterPro:IPR003416"
FT                   /db_xref="InterPro:IPR025105"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVE6"
FT                   /protein_id="BAI60418.1"
FT                   /translation="MADLTLYDFAFRIGLSTALGMFIGLEREWAHKEAGIRTFALFSLT
FT                   GMVSTVIFPPYVTIACAVFAIAFAIIMSAYGISQKRDPNLTTSAALFITFFVGVLIGID
FT                   QIIPGVIIAIIVTALLSIKTELQSITADLTAAEVHAAVEFGILAFVIYPILPDHPIDPW
FT                   GVINPRTIWLMVVLISGIGFVNYYIMKRYGSKGAAYTGFFGGLANSTAVVAEFINRIKA
FT                   EPGLTMVAVAAVILSDVAMCVRNLGLCLILAPSLLPKLVLPFGIMIVIGGLFAYRYLSR
FT                   QETVTVKIHSPFSIRNALVFGTIFLGMVMLSAFAVFEFGSAGFFVSSVLSGMVSSASAT
FT                   ASSIALLQAGTIDTRMSALGIIVASMASIVIKFPLAYFSNNRQFFFNVVMGAGLMMVAG
FT                   IITAILFI"
FT   CDS_pept        complement(352263..352457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0347"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0347"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60419"
FT                   /db_xref="InterPro:IPR035258"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVE7"
FT                   /protein_id="BAI60419.1"
FT                   /translation="MGKTGSVEWVQIRGRKGQMRLVPRGDSVAGKPGPAQRYDAKGFVR
FT                   RILARSKKNVLGVKSKSKK"
FT   CDS_pept        complement(352527..353477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0348"
FT                   /product="putative phosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0348"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60420"
FT                   /db_xref="GOA:D1YVE8"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVE8"
FT                   /protein_id="BAI60420.1"
FT                   /translation="MKTVIFTHGDSDGICSGALALAANGDSPIYFTNPVSVLTDIDEGR
FT                   GYDRIIVCDIAINLPRSQQMKDKFEALAKESEIIYIDHHPLPPGFGEKWLFHDDTASAS
FT                   ELTFNYFENELSPDMSRVAMYGAIGDYQDMTPGARQLIDDWDKRSLYYQAGTLTQGIEV
FT                   GRRDYDFKRGIVRELAKNIIPSEIGSLAKNALVAARHEDQMRQRVQREVKRLKNVAYVM
FT                   DMNGCMGKAAIFARVYGRAAVGVSVEYRDHRNAYDISARGTGNVDLNAAIGEAAAKNGG
FT                   TGGGHPRAAGGRIPESSMKQFLLDLDEVVGKALVK"
FT   CDS_pept        complement(353474..354364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prs-1"
FT                   /locus_tag="MCP_0349"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0349"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60421"
FT                   /db_xref="GOA:D1YVE9"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVE9"
FT                   /protein_id="BAI60421.1"
FT                   /translation="MLPVVVAGSSHPGMALSIAQSLGVKALFPVVEKFPDGETHVVAPA
FT                   VKGTAVYVQTMHPYPNEMLVEMELTTDLLKELGAERVIAVVPYLAYTRQDTRHEEGEGI
FT                   GVKTMLRMLEKAGVNDIVSVDIHLHRLGLGELSGMSSIRLHEVSAVDALAKEAGRYLAK
FT                   PVVVGPDSESERWAKRAAELLNSSYDVLEKHRISPKEIEIRPRTLDVRGRDVLIIDDIV
FT                   STGDTIKKVIESLRAKGANKIAAAFTHGVLSGEDAAAGLYRAGATHLISTNTINNEFSR
FT                   VDVGPVIAQKLKEIV"
FT   CDS_pept        354531..355763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eif2g"
FT                   /locus_tag="MCP_0350"
FT                   /product="translation initiation factor 2 gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0350"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60422"
FT                   /db_xref="GOA:D1YVF0"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR015256"
FT                   /db_xref="InterPro:IPR022424"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVF0"
FT                   /protein_id="BAI60422.1"
FT                   /translation="MPQPVVNIGMVGHVDHGKTTLVSALSGVWTDTHSEELKRGISIRL
FT                   GYADCTFYKCTNCNEPECYTSKPECAACGTKDLAPLRTVSFVDSPGHETLMATMLSGAA
FT                   IMDGAVLVIAANEPCPQPQTKEHLMALDIIGIKNVVIAQNKIDIVSREEAIKHYNQIKQ
FT                   FVKGTVAENAPIVPVSAQQNINIDVLIKTIEETIPTPKHDLNKPGIMQVARSFDVNRPG
FT                   TVPAKLNGGVLGGTISQGTFKVKDDIEIRPGRKVEHEGRTRWEPIATSVVKLVYGGDSV
FT                   EEATPGGLLAVGTKLDPSMTKSDALAGQVAGKPGSLPPVWHKFVMKTQLLERVVGVADE
FT                   AAMVKAISTSEPLMLSIGTSTTIGVVTSARKDAAEVALKRPVCAEVGSRIAISRRIGAR
FT                   WRLIGVGVLSS"
FT   CDS_pept        355776..356147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0351"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains one Nucleotide binding protein, PINc domain
FT                   (IPR006596)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0351"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60423"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR041120"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVF1"
FT                   /protein_id="BAI60423.1"
FT                   /translation="MKVIVDTNGFMVQAQFGVDIMDELGRLGYDECIVPSAVLDELKML
FT                   EKKVRGKDKLAVAVATALARRCQGVDARGNADDVIVSLAKQLDADVFTNDAELRKRLRS
FT                   QGTKTVYMRSKHKLETDYM"
FT   CDS_pept        356219..356806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoE1"
FT                   /locus_tag="MCP_0352"
FT                   /product="DNA-directed RNA polymerase subunit E'"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0352"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60424"
FT                   /db_xref="GOA:D1YVF2"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004519"
FT                   /db_xref="InterPro:IPR005576"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR036898"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVF2"
FT                   /protein_id="BAI60424.1"
FT                   /translation="MYRKVRLVDIIRIPPQRLEEDLEQVITETIRDKLEGRIDKALGSI
FT                   VAVLDIVDIGEGHILVGDGAVYYEVTFDAISYRPELQEIVEGQVVEIVAFGAFVSVGPI
FT                   DCLVHVSQVADEFMSYDEKNSRLVSKESSKSLGEGDSVRARIVAVSLNEHDARESKIGL
FT                   TMRQVALGKLEWIEEEQRRKEKGERPEKARAS"
FT   CDS_pept        356883..357746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0353"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains one Beta-lactamase-like domain
FT                   (IPR001279)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0353"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60425"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVF3"
FT                   /protein_id="BAI60425.1"
FT                   /translation="MKLVHVTGDTYYVPGLTNVGVYKDYVIDPGKNERVDWARPETSFG
FT                   RKISAALITHGHNDHFWHASDMQARGTKIYAPRDERPMVENIDVHTNGFFLWTRPPDGM
FT                   KPWYFRGTPCRLDGIVEGLDMPLKAIPLKGHTDWHTGYMTPDGVLMAGDSIVDKKVWDT
FT                   TGIVYNTNIPRTRQTLQDIIDIDADFVVPAHAKAVTKDEAVEQAEGNLQGLDRLEHIIL
FT                   DALDTRGVSTEDIVCRVSHALSLRDVFNDYLVCETVVRAFLFALEEDGAVDYELKGHRV
FT                   LWRVRA"
FT   CDS_pept        357797..359563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0354"
FT                   /product="putative histidine kinase"
FT                   /note="Contains two PAS domains (IPR000014).; Contains one
FT                   PAS-associated, C-terminal domain (IPR000700).; Contains
FT                   one ATP-binding region, ATPase-like domain (IPR003594).;
FT                   Contains one Histidine kinase A, N-terminal domain
FT                   (IPR003661)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0354"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60426"
FT                   /db_xref="GOA:D1YVF4"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVF4"
FT                   /protein_id="BAI60426.1"
FT                   /translation="MALDLDPIYLVNLFLAVIIVAIGFASYRLNKNRIPLYIAIGFLGF
FT                   AVSHLAFILGFRAEAENYLIVVRILAYIVILLGLYFSWQQTKTYVAELSEKNRRLEEEM
FT                   ASRRQMEETYRSIFENTLTPMIIVNEDMTVYLPNQGFETMSGYTRRELESGMKITKFYL
FT                   GDEADMAIRYHKARRADPGSAPKSYEFHFVDAGGNIKDVIVNVAMLPGSMMSLLSFLDI
FT                   SERKHAEEALQESENKFRVLAETSLAVVCVYQGDRFVYVNPSTERITGYSRNELLEMNF
FT                   WDFVHPDYKELIRERGLARQNGADVPSRYEIKLMTKSGEERWADVSAGLVPYYGRPAAL
FT                   VNMFDITERKQIEEDLLDSKLQAELYVDLMSHDINNLNQAAMGYLELAEGAPEEDSKRY
FT                   ISRSLDALNNSARLIDNVRKLQRARSGKGQETVDIGTMLEEVAAMYAVVPGRDVAIHYS
FT                   PVTGRLVKADSLLRDVFTNIVGNAINHSSGPVRVEIAVAGIAVDGREYWKIAFEDNGPG
FT                   VPDELKNKIFNRLQRGATKSKGHGLGLHLAKTLVEGYGGSVHVEDRMPGDRGQGSRFVV
FT                   LLPAYRPVPVSS"
FT   CDS_pept        complement(359536..359895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0355"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains one Cupin 2, conserved barrel domain
FT                   (IPR013096)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0355"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60427"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVF5"
FT                   /protein_id="BAI60427.1"
FT                   /translation="MMHNRSNISSYVTKDGSRIWELFHPGSSPVAGFSVAEARVDAGQE
FT                   TVAHVHHRSQEVYYILEGCGEMSLGGDALAVIQGDAILILPGKRHNIKNTGVGALRILC
FT                   ICSPPYAHEDTGTGL"
FT   CDS_pept        359968..360828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0356"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains one Beta-lactamase-like domain
FT                   (IPR001279)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0356"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60428"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVF6"
FT                   /protein_id="BAI60428.1"
FT                   /translation="MASKSNGPALVAGNSYYLPAMSNAGLFKGYVIDPGSVGYADVGRD
FT                   DIHTVLITHGHNDHFRRAREFRERGARVIASKEDALLVRNPEVNVRGLFSWARPPKEMI
FT                   TPYFQGDACEVDLYIEDWLDSSIRAIYLPGHTLGEYGFITEDGVLYSADSLYSKELWGK
FT                   YKLPYSIDPDLCRESIRKIKTLDFDYLVPGHGDPLSREDALKAADFHLSQLDFVDEVVL
FT                   ELLREPVSTESLVTKFCYELDLYKSLNNYWLTLVMLKGHLSSLNHQGRVAYKLENYCMF
FT                   WFKSK"
FT   CDS_pept        361193..362272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0357"
FT                   /product="putative histidine kinase"
FT                   /note="Contains one PAS domain (IPR000014).; Contains one
FT                   PAS-associated, C-terminal domain (IPR000700).; Contains
FT                   one ATP-binding region, ATPase-like domain (IPR003594).;
FT                   Contains one PAC motif repeat (IPR001610)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0357"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60429"
FT                   /db_xref="GOA:D1YVF7"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVF7"
FT                   /protein_id="BAI60429.1"
FT                   /translation="MRESEKKYRTVADNTYDWSFWLDPNGDFIYTSPSCERITGYRPEE
FT                   FKKDPDLLSKILHPDDKEAFKKHVYEHEKKAGPGDLELRLVTKTGIIIWIHHMCQPVFD
FT                   EQKHFLGSIGSNRDITTRKSAELALQEAKRLAEMYVELMGHDINNKNQVGIGYLELVLN
FT                   EPGLSEDVKRSIEKALGALHDSSGIINNVEKLQRISSGKVKVEKIDLGQKLVDIRARYL
FT                   ESPGKAVTINYTPEKECFVWANELLTDIFSNIIENAIKHSRGPVTIDIKRGEMIRDGKY
FT                   YCKVTIDDNGPGIPDELKERLFARFQRGVTRAKGKGLGLYLVKSLVESYGGMVWVEDRV
FT                   RGDHTGGARFVVALPAVEK"
FT   CDS_pept        complement(362435..363310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0358"
FT                   /product="peptidase M48, Ste24p family protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0358"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60430"
FT                   /db_xref="GOA:D1YVF8"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVF8"
FT                   /protein_id="BAI60430.1"
FT                   /translation="MKDIPGQRYITGMNASKKNGADEYYVSGERRQGITFYIILALILG
FT                   LVIILAAEAYRSLSPLGMETFWSFAYLAASLAVGATAGIILFNSFNSYRIIQAMLRNSL
FT                   KASPHAFPEIYDIVGLAAERLHVQAPDTYVSQSPAVNAYLVRLGLRKKVIIINTGLLRA
FT                   MDQDELLFILGHEISHAKYGRWRRIPGLGLPYVIAPQYNEYRCDRGGLVASRNIDASVR
FT                   ALLKLVTGKEFIDRVSVKDLANEKGEAPPSEAPSKVLQRLASHPMIGARIKELMKFHSS
FT                   PAYTAYQNIS"
FT   CDS_pept        complement(363407..363934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0359"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0359"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60431"
FT                   /db_xref="GOA:D1YVF9"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVF9"
FT                   /protein_id="BAI60431.1"
FT                   /translation="MRSAIHTGIFCGLLIGFCFLLSGLTWRALSLDPLVPFSMMAGVLV
FT                   PATMVVSGMLARWAASSPFDERPPGSTSMASLASGLVTALSGAGLCGLMLALSESVFPP
FT                   AYAISMDAAGLGVIFVAYVAMSAIGGELYGVMFPELSRIYGRHHLSVPSGHIDDDERRS
FT                   AEHTRGDTRDEA"
FT   CDS_pept        complement(363967..364458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0360"
FT                   /product="hypothetical protein"
FT                   /note="Contains at least one PBS lyase HEAT-like repeat
FT                   (IPR004155)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0360"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60432"
FT                   /db_xref="GOA:D1YVG0"
FT                   /db_xref="InterPro:IPR004155"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVG0"
FT                   /protein_id="BAI60432.1"
FT                   /translation="MRKTGAVLALVTLSYFSGAAGAMSAMPAGEGNPYPNLFAFLLAMC
FT                   VLALGFILVDRFERQIVDRMRKANDVNGLIGALKNGWLSRKAACALGDMKADEAVEPLV
FT                   DALHDPNSDVRQAAAKALGDIGDVKAIGPLRQALGDRYRGVRECAALSLKRLQKPDNAL
FT                   "
FT   CDS_pept        364629..365036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbiX-1"
FT                   /locus_tag="MCP_0361"
FT                   /product="sirohydrochlorin cobaltochelatase"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0361"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60433"
FT                   /db_xref="GOA:D1YVG1"
FT                   /db_xref="InterPro:IPR002762"
FT                   /db_xref="InterPro:IPR023652"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVG1"
FT                   /protein_id="BAI60433.1"
FT                   /translation="MDNVEKFGLLVVGHGSSMPYNKQLIQDIADMLSKKMPQAITRIGF
FT                   MNINKPTIKDGLDSFKGTGIKKIVVFPLFLAKGVHTTEDVPGLIGLGEGQKRISYNGYD
FT                   IVYADPLGADEMIAELSARRVREAFTRYTGN"
FT   CDS_pept        365041..366339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0362"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0362"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60434"
FT                   /db_xref="GOA:D1YVG2"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVG2"
FT                   /protein_id="BAI60434.1"
FT                   /translation="MEPGATIGVLDINHGGLLLAERLRGLGYGAFAVDVYGTKEARDGT
FT                   KKTSTGAPVLKPDEVGDFDVLAVPVHMPTIPLLRRAFAENKPVLTHHELTGFIVRKSGL
FT                   LMSKCVEVTGTYGKTTACMLMARMFPREDVLLHTSRGLFYNGELIERLSITPANIIRAL
FT                   ELAADKRPTLCIFEVSLGLCGIGDVSVITTLDRDYPVAGGERAAREVKLSSLSRMKPGS
FT                   ILICENSLRCGRSLKSGSPDKLTFGRGGDVFYAPDGRVRYRLHDGTDGWLKIRLKGGFD
FT                   GRAYRGPALCAAAAALAMGGKPDGIQDAFEGFDGIEGRMKFSTLSGRVLLDNSNSGLSI
FT                   QGVERALDAAEEDEGWKVLVVGEESYNVCDGLDPEKVKSLLSDPRFDEAVLVGGRLRVE
FT                   GHAHADSLEAGLALALEKTEPGDTIISCVKTWR"
FT   CDS_pept        366344..367450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0363"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0363"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60435"
FT                   /db_xref="GOA:D1YVG3"
FT                   /db_xref="InterPro:IPR000510"
FT                   /db_xref="InterPro:IPR017675"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVG3"
FT                   /protein_id="BAI60435.1"
FT                   /translation="MEQLATAGRIIQPRPSSIVAALYTLRDLDTDVAILHGPPGCCFKH
FT                   SRLLEEDGMHVVTTAMCDSDYVFGGHDLLVNVLEKVIDRFHPRTVGIVGTCASMIIGEN
FT                   FHRAVEEADVEVPVIEVEIHAGYSDNTHGAIVTLEAANAVGLLSEAELERQKRMLLLAT
FT                   DIEKKFGAASKDYIEPSRGDLKYRAAERLLELMRQGKRGLSVLNAKKETAYMFADINLA
FT                   VSQAARAVGAPSPITIANLDPDVGLPRIRRYATTITAQLKENGVTIDHITGGLDEYPMS
FT                   GEKAARIITEKYSNYDYVVLSGVPHAVPYEAIRGMEIFSITNGPRQAEPLKAAGHGHVM
FT                   VEVDLHPKTLGVHGMVESELGETLRSML"
FT   CDS_pept        367447..368235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nifH-1"
FT                   /locus_tag="MCP_0364"
FT                   /product="putative nitrogenase iron protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0364"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60436"
FT                   /db_xref="GOA:D1YVG4"
FT                   /db_xref="InterPro:IPR000392"
FT                   /db_xref="InterPro:IPR005977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030655"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVG4"
FT                   /protein_id="BAI60436.1"
FT                   /translation="MKKQLAIYGKGGIGKSSTASNVAAAMGEKGIRAMLIGCDPKSDSS
FT                   ITLLGGRRMPTIMDTLRKKGSIEEEDVVFEGFNGVKCAEVGGPEPGVGCAGRGIIVAVQ
FT                   ALQKVCDAMKDSDVIIYDVPGDIVCGGFAVPITKGMVREAYIITSGEYMPLYAANNICR
FT                   GLKTLNTPLSGVICNEREAEHEREIVEKFAAALGVPMLAYIPRDKLVQNCERAGRSVIE
FT                   GAPGSEMAGVYRLLADRILTEKDKKVPDSLEDEDLRKLTQ"
FT   CDS_pept        368232..369623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobB"
FT                   /locus_tag="MCP_0365"
FT                   /product="probable cobyrinic acid a,c-diamide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0365"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60437"
FT                   /db_xref="GOA:D1YVG5"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR004484"
FT                   /db_xref="InterPro:IPR011698"
FT                   /db_xref="InterPro:IPR017929"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVG5"
FT                   /protein_id="BAI60437.1"
FT                   /translation="MMTMPRLILAGDRSSAGKTTISTGVMSLLHERGMKVQPFKVGLDY
FT                   IDPSYHSLATGRQGENLDGYLMSEQAIVEAFQHSAGGSDIAIIEGVRGLYEGLEALSDI
FT                   GSTAQIAKILKTPVVLVLDAQSITRSTAAIVKGYKDFDKGINFKGVILNKVGSDRHAEK
FT                   ATAAIQKYTGVEVLGAIPRNKGMSLTMRHLGLVPAREGASRVDDFDARITKIKEIIGEH
FT                   VNLDRLLEIANGAPKLRTGKQSIFKQEKSAGVRIGVALDEAFNFYYKDNVDLLQLKGAE
FT                   VVYFSPLHDREIPDVDGLIIGGGYPEFFARELSDNGSMRKSIADASVNGMPIYAECGGM
FT                   MYLTSALEDEHGKKFDMVGVMGGVASMKHIRHIGYVAGQLEKDTPIGEKGTFFKGHEFH
FT                   YSVITDVPFDAKFAYRMDRGTGIKDGLDGMLTNNTLGSYTHLHAASYVPFARSFVDACV
FT                   EHKGP"
FT   CDS_pept        369820..374304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0366"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0366"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60438"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVG6"
FT                   /protein_id="BAI60438.1"
FT                   /translation="MGLFDRKPKKDDSKAAKQQNEEERIKKELETLAAILDKTDVSEKP
FT                   AEKPTMKPIVAPPAEKPVEKPAEAVLKPAMKPITERPREAPKAPMAPVKQTLPPQKPIL
FT                   KPNITQSQPPIPAPKEKEAVKEVVKPAAPIKEREEAKPRPERVAQPVAQPDVQVLNLLK
FT                   GQMERQVSESEKQRKDLDKFREEVQAQREDNTRQMAAIVDKLQKLDAYKDEIKPEDFRK
FT                   LQSGLVEQKNLIESQSLTLSSIGEEIASLREFDFESYTEQEKQVLQKLAAEIKGLKDAY
FT                   AASEQRLTAIDTSIDSYREDFASLRTNTDRYEEELQALRASLDQCTGDVKTLKESLGNY
FT                   SSDTEQARSSIQVVDSKINSLREDIARLAGEIKAVRAGSEEGQTVLASNYESDMKALKT
FT                   SMEAYQESMVKSVEDLNEFKSTIAAVQKDNEKKLEAVEASLKQSTAKELASLNEKMSDI
FT                   EESLASSTSKDILAVNEKIVVIQDSLRQSTAKEVASLNAKMAGIEESVKASTSSDIQAL
FT                   NEKMAEVQESLKQSTVKDISSLNDKLDLIEASIKETSGVEISALSEKIESYYSDVRALK
FT                   VQLAEARNENKALTKTLASVNDSMADIRARLDEQTNDHIAEMGFVKGNMADFKNEMKPV
FT                   KLFVEKYGEKVKALKDYSGMEDELKAVKNEIGANSDEMATVSKLLSDQRVEMKAMKAVV
FT                   ERHAEDIKLAKEFNKSRDEIVKLKNEVEAYAGDIKTIKDFVADYKDEMDSIKGLIEQFK
FT                   NDAEHVTPQEAKLIKAGQYLKAQIDQVNNTFGDLDERLSAVRKEFINLNNIEYRYRALE
FT                   DNLNAMERNLENKIEVEMITRVREAENDLVVKISGVEERVLQQSKASHETIKALQDMQT
FT                   ATVGLLRQTQSDVLGSVTDVKSDAVKSVTEAVNEAAGNIEAMKARAQEFIRTTESEATS
FT                   TIRSVEADAVGNIQKKRQESLAELNESSEHVAGVAKTTREVVEGALRATRDDTLKSIDS
FT                   VKGQSVNEITAVKSHAMEEMTTFKNDTLHEASALKVTTLSEIAAAKEQVTADVEAMKAD
FT                   STGRVNVLKQETINEVLSLKQGTINEVTSLKEGTVKDLVSLRNETFAGVQSLKQGTINE
FT                   VTSLKEGTVKDLVSLRNETFAGVESLKQGTVSEVAAMKEQAIAEVNATKGDTIDQVQSL
FT                   KQGTINEVLSLKQGTINEVMSLKQGTVSEVTSLKDGTINEITETRDTAVATMKKSRDEV
FT                   LDAVDESRENVMETVKTLNTVSKQADEEYSKLSARVDQEAKSTMNQIRTEVLASIKQEK
FT                   DGLSGAIEAQKKDAVDDMSKFKDGLIVALRQTESIVLSSTDNARIVAEKSMAKTRDEIL
FT                   DTIRHTREDTIKKLLDTRDVVIAASNNSKEAALEELFRSRDETIKAMKESKAGMLETAK
FT                   TAKATTESSIKATRDEAIKAMNESKASMLDTAKTTKTTTESSMLSTRDEVLKQLKATQK
FT                   EVEDSINKKIDADKENTEKIKQIMKTMNELIKA"
FT   CDS_pept        374301..374936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0367"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0367"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60439"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVG7"
FT                   /protein_id="BAI60439.1"
FT                   /translation="MIPMDFEKYIGKEKPLLSRLDRDRASLNAYERRGNAGTLDIAEDE
FT                   LKLLDTLKQVKEHIAAAEAASKALDERAQRLKELEESVNRKGAQTQKRIEEWESSFDDK
FT                   YNVLLKRVEDEVGALELRNKELVAFMKAQEDIFNARSAELSSRADASEAGIKQASDNAY
FT                   QEMSDILVSMKKAQKEFETSISGKLDEDKQTIDRIKYMLSTMSDIIKS"
FT   CDS_pept        375020..375538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpl10e"
FT                   /locus_tag="MCP_0368"
FT                   /product="50S ribosomal protein L10e"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0368"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60440"
FT                   /db_xref="GOA:D1YVG8"
FT                   /db_xref="InterPro:IPR001197"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR018255"
FT                   /db_xref="InterPro:IPR022981"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVG8"
FT                   /protein_id="BAI60440.1"
FT                   /translation="MARKPGRMYKNFSGPAYTRRKYMGGVPGVKVTQFDMGNLTDELPI
FT                   AVTLVVNETCQIRHDALEAARISANRYLMSDVGKQDYRFKVRVYPHQVLRENKQATGAG
FT                   ADRVSDGMRRAFGKAIGTAARVYSGQGIFTIYTNRPNFEKAKEALRRAGHKLPSPHRLV
FT                   VEKGAELVK"
FT   CDS_pept        complement(375593..376240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0369"
FT                   /product="hypothetical protein"
FT                   /note="Contains one Beta-Ig-H3/fasciclin domain
FT                   (IPR000782)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0369"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60441"
FT                   /db_xref="GOA:D1YVG9"
FT                   /db_xref="InterPro:IPR000782"
FT                   /db_xref="InterPro:IPR036378"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVG9"
FT                   /protein_id="BAI60441.1"
FT                   /translation="MSGIKKYITILLLLALAAGLAAPFVNAQVGSQRTVLENLANIGQF
FT                   STFLGAVRAAGLDNVLKGPGEFTVFAPTNAAFDKLPKNQLNALMQDQPRLSSLLQYHAV
FT                   PGRLTFADLSRMTDVKTVDGKTLPINIKDGGLVVGGSRVLNQGVECKNGIIYPVDSVMM
FT                   PPGFTMAQKTQSSPLGWLPWLLAALVIGAGALYLMTRRKNREEPRVEEKKGP"
FT   CDS_pept        376434..377051
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eif2b"
FT                   /locus_tag="MCP_0370"
FT                   /product="translation initiation factor 2 beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0370"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60442"
FT                   /db_xref="GOA:D1YVH0"
FT                   /db_xref="InterPro:IPR002735"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR004458"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016189"
FT                   /db_xref="InterPro:IPR016190"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVH0"
FT                   /protein_id="BAI60442.1"
FT                   /translation="MVDYDALLNRAVSKTPQLELTGERFQVPRPKVFAEGRTTVWDNYE
FT                   EIREKLNRDTEHFGKFILRELGTAGKVEGNRMILQGHFTSDAINALVNDYVAEYVKCAE
FT                   CGRPDTKLIKYDRVTTLKCDACGAQRSIQKRRSRAISEKPAAAIEEGKTYELKIETTGK
FT                   KGDGIAKVDKFTIFVNGARPGEIVKAKINKVDGTRAFAVREH"
FT   CDS_pept        complement(377418..378251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0371"
FT                   /product="putative TatD deoxyribonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0371"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60443"
FT                   /db_xref="GOA:D1YVH1"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR011589"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVH1"
FT                   /protein_id="BAI60443.1"
FT                   /translation="MLPITDDHMHINLNGGRGVEAVKEFKNAGGTHVFIVSLPAGEVGR
FT                   TVARGEDFRAVFDDTVEATRRANELVRAYAVVGVHPAEYIGLAESLGMERAYSIVKEGL
FT                   EIAAKYVAEGKAVAIKSGRPHYPVSPELWETSNALMRYAMDLCVDEDCAIQLHTESEPG
FT                   TMESISDIAKQARMEPPKVIKHFSPPLVRECESLNVFPSVICSRGALEEALSQGTRFML
FT                   ETDYIDDPNRPGAVLGPKTVPRKTKEAIRNGVPEETFYKIHKDNPEKSYGIKIEI"
FT   CDS_pept        378361..379488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0372"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0372"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60444"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVH2"
FT                   /protein_id="BAI60444.1"
FT                   /translation="MINLAQTNESLAIDKGKLIFFVVFDTGGEVDKATLSGIFKVQAGP
FT                   EYSKPVETTLGQMTGLIVSDNNKICKVLAQAEVFAMGVGIIRVEFELAEGMLVKEIITA
FT                   MHSNGIFLDGLDLNAYVARKIGEIREQLKAYAKLKIYYTPTRKYSMLRLDQYTPPVDQG
FT                   ELKVQYGAELTRFLSGESSARRLHGKEIADKLSHDISYYDEDLFLVSYEAAFVKGCDDY
FT                   FNDLRHYLELGLALAFLYQIYDWKMDAEIGEAFKAIRNYQTQSTIGQLFSQSTKRLEKA
FT                   LLKVSEIKLDILDNLEDLMNPLKVTSDWYYQGAYEHIIRLIKVREYESIVTQKIDALED
FT                   LYSTAQELSYSKIALITEVVVILLIAFEVIAFLPH"
FT   CDS_pept        complement(379466..379795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0373"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0373"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60445"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVH3"
FT                   /protein_id="BAI60445.1"
FT                   /translation="MPEFYKVSFDEDELGAIRRGCDIRSGHEDRMLDEAAGGSLEGVVM
FT                   QESRADDMLLIKGTVDIFKPGQTILITMEDLRMIRSCLDDDDSPGAKSAVKKIDASLAS
FT                   GAERR"
FT   CDS_pept        complement(379845..380303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vhtD"
FT                   /locus_tag="MCP_0374"
FT                   /product="putative F420-nonreducing hydrogenase subunit D"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0374"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60446"
FT                   /db_xref="GOA:D1YVH4"
FT                   /db_xref="InterPro:IPR000671"
FT                   /db_xref="InterPro:IPR023430"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVH4"
FT                   /protein_id="BAI60446.1"
FT                   /translation="MTKKIVVLGCGNTLMGDDGVGIRVIERLQGMKLPENVEVIEAGVG
FT                   GMSILSWIEGADKAVIVDAVQTGNEPPGTVYEFTDKELPPSDMFMLSLHDLNLVDTINV
FT                   GRVVQKMPEDIVIIGVEVKRVAEFTKELTPEVEGAIPEVLDLVLKELK"
FT   CDS_pept        complement(380300..380971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrH"
FT                   /locus_tag="MCP_0375"
FT                   /product="probable uridylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0375"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60447"
FT                   /db_xref="GOA:D1YVH5"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR011817"
FT                   /db_xref="InterPro:IPR011818"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVH5"
FT                   /protein_id="BAI60447.1"
FT                   /translation="MRIVIKVGGSAIAPSLEAKRFSEYAQVIRSLAKDHTVLVVVGGGT
FT                   PAREYINVTKELKASNALRDLIGIGVSRLNARLLISAMNDAAYPEPPHDYQEASLAMYS
FT                   GKIIIMGGVQPGQTTDAVAAILAEYVHADLLIRTTSVDGVYTADPRVDKNAKKIDHMTP
FT                   QELLELVAKMEMTAGANNIFDMLGAQIIKRSHIPMMIISGQDPHNIIDAVNGKKIGTLI
FT                   K"
FT   CDS_pept        complement(381167..381814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0376"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0376"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60448"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVH6"
FT                   /protein_id="BAI60448.1"
FT                   /translation="MVIIIIIREDGSNVTKGSVVMKMAYRISTAVIVLLTLALIAPAAA
FT                   QFGPAACGGPVAYGAPQDCIATVSCNIPVTTQVPVMTTTTVPQTVPITVPVQDVCPVTV
FT                   PKVVVVPQTVPVPYVRPALSSMTVPVTVPVQSSVPVTSMVPQCYTVPLSSGAVASMMPN
FT                   MPYGGISKGMAPNAGLGKGMTPDIGGMGKGLGMGGMGLGAGIGSYGQMPMKI"
FT   CDS_pept        382089..382874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0377"
FT                   /product="peptidase S54, rhomboid family protein"
FT                   /note="Contains one Zinc finger, AN1-type domain
FT                   (IPR000058)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0377"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60449"
FT                   /db_xref="GOA:D1YVH7"
FT                   /db_xref="InterPro:IPR000058"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035896"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVH7"
FT                   /protein_id="BAI60449.1"
FT                   /translation="MPENRCDVCSAFELLPFKCKYCGGTFCGAHRLPESHNCPGLRMLK
FT                   QRPAADSRATVKRRSALRLPAAKLPYSGYYAYALIAITVIVYVLQVLFPGITDALILSS
FT                   SNLLSHPWGILTSIFLHSSLMHLFFNMLALFFFGPLLERRIGSGRFLGLYFGTGIIAGL
FT                   AQILAFPGSAVLGASGAIFGVLGTLTVLTPDLVVYLYFVPLKMVYVTILFAVLDLFPVL
FT                   TGTSDGVAHIAHLAGLAIGLAAGFWYRQKSKIRSVRWQV"
FT   CDS_pept        382916..383878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="birA"
FT                   /locus_tag="MCP_0378"
FT                   /product="biotin operon
FT                   repressor/biotin--[acetyl-CoA-carboxylase] synthetase"
FT                   /note="bifunctional protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0378"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60450"
FT                   /db_xref="GOA:D1YVH8"
FT                   /db_xref="InterPro:IPR003142"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004408"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR030855"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVH8"
FT                   /protein_id="BAI60450.1"
FT                   /translation="MTKEEILNILREAGDYVSGEFLAEKLGVSRAAVWKHIHTLIKEGY
FT                   AVDVAQGKGYRLMSVPDKLYPAEIRHGLQTKLLGRKVIHLNVTGSTNTVARQVAERGVE
FT                   EGTVVLAETQSHGKGRLGRKWVAKPGSLAMSVILKPAIDPMHASSITLMAAVSVTKALR
FT                   GAGLEAAIKWPNDVLVNGKKICGILTEMSAETDIVNFIILGIGVNVNNDVPLETATTMK
FT                   AELSREVDRVKFTQLLLEMLEEDYLTFKEEGFTPILWSWRRYSDTLGRLVEVTYQDEVV
FT                   TGVAQDVDEDGSLLVKTADGSIRKIVSGDCKHLRGARKL"
FT   CDS_pept        383895..384446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0379"
FT                   /product="putative biotin synthesis protein BioY"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0379"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60451"
FT                   /db_xref="GOA:D1YVH9"
FT                   /db_xref="InterPro:IPR003784"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVH9"
FT                   /protein_id="BAI60451.1"
FT                   /translation="MFFGFTMSSRVKKLVYAALFAALTAVSAWAAIPLPYVPITLQTFF
FT                   VILSGGALGAYFGALSMVVYLLLGFMGLPVFARGQSGLGVLAGPTGGYLVGFVLCAIVT
FT                   GLIVKMRKNPGLLWYVLAMAAGTLAIYACGLAQLTLVLHMPLETALIIGVLAFVPGDII
FT                   KIIIAAFVARKLNTGGEAGN"
FT   CDS_pept        384443..385195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0380"
FT                   /product="putative cobalt ABC transporter ATP binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0380"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60452"
FT                   /db_xref="GOA:D1YVI0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVI0"
FT                   /protein_id="BAI60452.1"
FT                   /translation="MISLRDVSFSYGCLSALDHISLQVEKGEHMALIGPNASGKTTLAM
FT                   VMNALLTPDRGECLVEGIDTRDDPMFARRTVGMVFQDPESQTVARRVWDDVAFGPMNLG
FT                   LPDGEVEKRVRESLDHVGLGAFSRREVSCLSGGQKQLLAVAGILAMKPSYIVFDEPTAL
FT                   LDGPGCRMVNKAVAGLKKNGIGIITITHDMEEALTADRIVALDTGRIVADMPPASLFSD
FT                   EALMARIGIKPPYTFNLAVPREVVRECR"
FT   CDS_pept        385186..385980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0381"
FT                   /product="putative cobalt ABC transporter ATP binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0381"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60453"
FT                   /db_xref="GOA:D1YVI1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVI1"
FT                   /protein_id="BAI60453.1"
FT                   /translation="MPLVANGVGHVYRRGEPGEAHALDGIDLTISGGEFTLVGGAGGSG
FT                   KSTLLHCLSGLLRPTKGTVRIDGPAALSIQFPERALFADTVLDDIAFGPLNTGLEKGEA
FT                   RTRALEAAGKVGLDAGLLSRLPRTLSHGQRRLAALAGVIAMRPRYLFLDEPTAGLDMAA
FT                   KERVVETLVRLNREGTAVIVASHDLAHFMDACSRMLVMSRGKVVFDDRPDGLVSLDDTM
FT                   GLALPPSLIVARWLRTRGIEAPWNIGPSEAAAHIRRAHEGLD"
FT   CDS_pept        385964..386542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0382"
FT                   /product="putative cobalt ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0382"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60454"
FT                   /db_xref="GOA:D1YVI2"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVI2"
FT                   /protein_id="BAI60454.1"
FT                   /translation="MKAWIKILALAAMSVLIVALPLPWVFIMAPAIVLFIAILKASPVL
FT                   LIRMLLPALPFIIILSTLQALLQGDITLAALSALRMLLLYLAGSAVTATTGESEFSRAI
FT                   ERALSPMDRLAGTRIGKDIAIMTMLALAFIPIVHEEYVSIKIAQQARGVRYGAIRGIVA
FT                   VMIPLMSSLSRRADDIAMAMEARCYGLDR"
FT   CDS_pept        complement(386524..388503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0383"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains one Protein of unknown function DUF255
FT                   domain (IPR004879)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0383"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60455"
FT                   /db_xref="GOA:D1YVI3"
FT                   /db_xref="InterPro:IPR004879"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR024705"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVI3"
FT                   /protein_id="BAI60455.1"
FT                   /translation="MNRLAGESSSYLKNAAGQPVDWYPWNDEAFEKARIEEKPVLLSIG
FT                   AVWCHWCHVMAHESWEDPETACMVNELFVPVKVDLDERPDLDKTYQEAVGMLTGQGGWP
FT                   LTVFLTPDKEPFYGGTYFPKAPIRGMPAFKEVMQAVSKAYKEQRGAIRQTAEQLKALMA
FT                   KVPAKKEAIDEDMPGLVTGNIISSFDTANGGFGRSMKFPYSEILLFLMQQYGSSRDAGV
FT                   WHVVDKTLRYMAAGGFYDQVGGGFHRYAVDPAWKVPHFEKMLNDNAMLLRVYLNAYRLS
FT                   GAAYFKQVALETTDFVFRRMAREPAGFVSSVDADLHGEEGSYFTWTEAEIREVLGDGAD
FT                   AFIKAYHVEQDGNFEVPGKNVLFVPGEHDKSRFAAEKRKLLEARHGRELPFIDMAVHAS
FT                   WTALMAGSLAVAYDVLGDRRCLDYAKKTLDFMMDPMYRDGTLYRIYTDSPSVDGFLDDY
FT                   SCTVEALIDVFRASQEPLYLDMAIRLAADCDAKFYDREHGGYFYVQEKDRTPMSMDKPI
FT                   VDLSVPASNPQMALSLMKLHYYTGERGYLDRAKELLEIFTAEASMHPIGCGTYFSALDY
FT                   YLQRPLEAVVVAGRDEGQNLVRLINSRVDKAVVLMDYGQERRLPAFEGKSTLDGKPTVY
FT                   FCREGTCEAPMNDLKNIEAYLSRP"
FT   CDS_pept        388816..391269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0384"
FT                   /product="copper-transporting P-type ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0384"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60456"
FT                   /db_xref="GOA:D1YVI4"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR006122"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVI4"
FT                   /protein_id="BAI60456.1"
FT                   /translation="MVIAEAPEKKTLLKITGMTCASCVKRVEDALREQKGVTEANVNLA
FT                   NEKATVTYDPSQVSVENMVSAVKDAGYGVMVETVTLPVQGMTCASCVKRIEDALRGKDG
FT                   VIDVAVNLATERVTIKYSPTEVTLPELKKTITDAGYTVIETKTEKEFVDTERSARQKEM
FT                   RDLTLSFILSGIASAVIMILMFFGSSLPVVKTWPMEWITYISFILATPVQFIIGWRFYR
FT                   GAWAALKHGTADMNVLIAVGTSAAYFYSVVATFVPHLVMVGGRMPDTYYDTSTMIIALI
FT                   LLGRLLEARAKGQTSEAIRRLTGLRAKTARVIRDHTEEDIPVEDVKVGDAILVRPGEKI
FT                   PVDGVVTEGYSSVDESMITGEPIPSSKKEGDNVMGATINKTGSFRFKATKVGRDTVLSQ
FT                   IIKMVEEAQGTKAPIQRLADQVAAVFVPVVIGLAILTFLAWYFIGGEPLFALLNFISVL
FT                   IIACPCAMGLATPTAIMVGTGKGAQYGILIKGGESLENAYRIDTIVLDKTGTITKGEPS
FT                   LVDVVPMAGFTEADVIRYAASAEKGSEHPLGEAIVKGAKAGNIPLTGATKFDAVPGKGI
FT                   VAEVDGHIVMAGNAKLMELEEVPLEEMQKAFERLSAEGKTPMYVSVDEKPAGVVAVADT
FT                   IKEGSMEAIAEFRRLGIEAIMVTGDNRRTAEAIARQVGIDRVMAEVLPQDKAEVIKSLQ
FT                   AEKKNVAMVGDGINDAPALAQADTGIAIGTGTDVAIESSDITLMRGDLRSVVTAIRLSK
FT                   ATIRTIRMNLFWAFFYNVIGIPIAAGILYPWFHILLNPIIAAAAMAFSSVSVVSNSLLL
FT                   NRFKP"
FT   CDS_pept        391279..391590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0385"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains one Rieske [2Fe-2S] regiondomain
FT                   (IPR005806)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0385"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60457"
FT                   /db_xref="GOA:D1YVI5"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVI5"
FT                   /protein_id="BAI60457.1"
FT                   /translation="MAEFTKLVRKNDVTPGKMKSVYVSAVSANITVANIDGKYYAFKDE
FT                   CPHMGVRLSNGSIENGIITCPEHSSKFDVTTGKPLSTQNDPLVTYEVKIEGDDVLVKV"
FT   CDS_pept        complement(391592..392179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0386"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0386"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60458"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVI6"
FT                   /protein_id="BAI60458.1"
FT                   /translation="MADVASTPELRKRLFDIKRDHSHDEAVILIEAMLKEEYSRLEPII
FT                   KKEREAYLRMDVDDAGQQNDIADLRLSAVEAYQPSYIIENFLADMKVDILPLLPKYEGR
FT                   FEVSSRGGDIWTLSVASLKENAMRTLGGHCNVVGDVIVLERLLYDHAYLAAVMKLTDDY
FT                   EPGKPSYVEFDFYTVVFDEEVQALVKVPLDAK"
FT   CDS_pept        complement(392236..392916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0387"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0387"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60459"
FT                   /db_xref="GOA:D1YVI7"
FT                   /db_xref="InterPro:IPR006977"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVI7"
FT                   /protein_id="BAI60459.1"
FT                   /translation="MKFVERVMGMFTKPGETIKDILKEPRTEEPLVIVGVFALLVMISG
FT                   YISAGSLGGGSMTILSLLISVVVVLIGWPIATGVVHVMALFLGGQGKYNPEMLNAIGYT
FT                   YIVKYIPMLISMAILFFVPAMNTAAFQVTPTMSQDQIMDAMRQMVTEMERYYTNPLFIL
FT                   SQVVMYLGLLWSCYLGSIAVQHGDNVSRTSSLIAVFVPAIFYIVLSVGMTFGSLILMRT
FT                   LYGL"
FT   CDS_pept        complement(392919..393263)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0388"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains one Protein of unknown function DUF372
FT                   domain (IPR007179).; Contains one Protein of unknown
FT                   function DUF381 domain (IPR007181)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0388"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60460"
FT                   /db_xref="GOA:D1YVI8"
FT                   /db_xref="InterPro:IPR007181"
FT                   /db_xref="InterPro:IPR027508"
FT                   /db_xref="InterPro:IPR036839"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVI8"
FT                   /protein_id="BAI60460.1"
FT                   /translation="MSVTPRDKAVFEAGIKLGALYHQFVGSPISLKTVDSLEKAIAQSI
FT                   SVQPFVRSITVQIDREMVKQNLSAFGYTELKGPMLTVDAVIKYENYEVSVGMALKDGYP
FT                   LMHVKDVKEV"
FT   CDS_pept        complement(393308..394474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0389"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0389"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60461"
FT                   /db_xref="InterPro:IPR009351"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVI9"
FT                   /protein_id="BAI60461.1"
FT                   /translation="MKPVSVEDVNRLVLRKQHLSDDSRAERLVEMVWDIGGLHATSAIG
FT                   PYISAFLRCKDFRREDLDRELYVNKSLGQLRCMRFTMYIQPTGAFAMYHSAMKRTFETG
FT                   YLSRLKRVAMPEKEYERLERSILALLRDGGKTAAEIKKALGVDTSLFQVLNAMCDTGLL
FT                   AKGMPKGSWKSNLHTYHLFGDYYPDVDLEMEEKLATASLALHYLKAFGPATEADIAWWT
FT                   GLRRSDIREAIESLEARTDRIDVSGLGNDMIVDYVDIRSIQGARAPKKPAVRLLPSLDP
FT                   YLMGYKDRDRYLDKKHYGCVYDRSGNATTCIMVDGRIAGVWDIDEKAIGVYLFEEAPES
FT                   VLREIRRQAEEMSVFLLGKPLPIKECSSMVPLSDRPPGAVMTPLKGQI"
FT   CDS_pept        complement(394471..394692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0390"
FT                   /product="putative HTH-type transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0390"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60462"
FT                   /db_xref="GOA:D1YVJ0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVJ0"
FT                   /protein_id="BAI60462.1"
FT                   /translation="MRTRIKEFRARYNLTQEDLANLVGVRRETIVFLEKGKYNPSLKLA
FT                   HDVANALHSSIDELFLFDEAEADIVEER"
FT   CDS_pept        complement(394689..395102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0391"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0391"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60463"
FT                   /db_xref="GOA:D1YVJ1"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVJ1"
FT                   /protein_id="BAI60463.1"
FT                   /translation="MVQDPVKNYNLTMLIGIFELLMLAAILIMRSSANFPEYDAIALVA
FT                   AIGLITFGGNLFYFLGMRKPVLDERTRKIGTIAMTYSWYATMIAICILVMIYYASPFRV
FT                   MLDAGQIFGIILFVMVVSMVAFIVYFNAKGDVE"
FT   CDS_pept        complement(395115..395504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0392"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0392"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60464"
FT                   /db_xref="GOA:D1YVJ2"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVJ2"
FT                   /protein_id="BAI60464.1"
FT                   /translation="MNTSFYKYVLWLSSAVVFVSLGWMFFLNRIDLIALVLFAVGIVLV
FT                   VGTLSRYNQCNSPEDERMRKVAAFSMMNSWVSGVTLLAMLLVMQYLNWWRYVLSGLQVI
FT                   CLTIAVLLLTYYGWYIYYSSRGDIA"
FT   CDS_pept        complement(395501..395908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0393"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0393"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60465"
FT                   /db_xref="GOA:D1YVJ3"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVJ3"
FT                   /protein_id="BAI60465.1"
FT                   /translation="MSIVTDETRLGIVKLSMWLGYLVMIGLGLALAVFEWSDGNATLAM
FT                   IFCVVIFTGNFFGYLGMEKGSQDERARKIGTYAATYSWFITLVAMCFLFIWDVAFNMHM
FT                   SVARFLGITLLVMVVSMMLINVYKAHRGDVE"
FT   CDS_pept        complement(395924..396331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0394"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0394"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60466"
FT                   /db_xref="GOA:D1YVJ4"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVJ4"
FT                   /protein_id="BAI60466.1"
FT                   /translation="MSDKNKPADPWLYRVSLWLGSAALVIAGIVLIIWKSMDDVLAIVV
FT                   LSGILVLLSNFFAYIGMEKPLKDERVKKIGTISATYSWFITLAFMGFLLISGYWSHRVF
FT                   TPEELFGLIFVVMLLSMLVINAYLGGKADVE"
FT   CDS_pept        complement(396482..398062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serA"
FT                   /locus_tag="MCP_0395"
FT                   /product="D-3-phosphoglycerate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0395"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60467"
FT                   /db_xref="GOA:D1YVJ5"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR006236"
FT                   /db_xref="InterPro:IPR029009"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVJ5"
FT                   /protein_id="BAI60467.1"
FT                   /translation="MKVLITDPISDEGIKILKAEPGVQVDVETKLTKEQLLEKIKGYEA
FT                   LIIRSETQVTKEVIEAADSLKIIGRAGVGIDNVDVPAATAKGIIVANAPEGNTIAACEH
FT                   TIAMMFAMSRNIPQANSSLKGGKWERSKFMGVEVLGKTLGIIGMGRIGGEVTKRARCMG
FT                   MEVLAQDPFTTPERARDLGAKLTTREEIYQKADYITVHTPLIPETRHMISTPQFDMMKK
FT                   GVRVINCARGGIIDEAALLEALKSGKVAGAALDVFEKEPPVGSPLLEQPNVIVTPHLGA
FT                   STKEAQISVAVIIAEQVLNAFKGLPVTTALNIPIMKPETMEKIKPFLPLAENLGKFTAQ
FT                   MVDGRIQEVDITYSGDITQKDVSLITIAAIKGILDFKKGELVNYVNAKAIAKDYGIKVV
FT                   ESKSGEVGDYTNLITVTIKTDSMQRKVQGTIFGNKDARIVGIDNYRIEANPAGYMIVTM
FT                   HKDRPGVIGNVGTILGKNDINIAGMVVGREAVRGEAIMILNVDDAVPQPVLKEMIEKAG
FT                   LYDARYVKL"
FT   CDS_pept        398208..400118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrS"
FT                   /locus_tag="MCP_0396"
FT                   /product="threonyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0396"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60468"
FT                   /db_xref="GOA:D1YVJ6"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002320"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR015011"
FT                   /db_xref="InterPro:IPR023509"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVJ6"
FT                   /protein_id="BAI60468.1"
FT                   /translation="MQLLLIHSDFIEYEVKKSTPVAEKIGDDLKSGRMEDALAAFITVE
FT                   KPDEANPQYVIDRGVESIVKMAEQVKATRVMLYPYAHLSSNLSSPKTAIEVLTGLEAAL
FT                   KAKNFEVKRSPFGWYKAFTVKCKGHPLSELSRNIVPEGSTINICAGEKPEVVSEAVKNE
FT                   EKLKSYFYVMDVDGTLKDPKTFDYKGHEKLKAFVDYEMAKKRAVDRVPPHVELMRRLEL
FT                   ADYEPGSDPGNMRFYPKGRMVKNLLENYVLMEAAKKGAMEVETPIMYDMEHPTLKKYLD
FT                   RFPARQYTVIADKKNLFLRFAACFGQFLMSHDMTISYKNLPLKMIELTRYSFRKEQRGE
FT                   LVGLRRLRAFTMPDMHTLCADMAGATSEFRDQYEMCINTLDTIGLTLKDYEVAIRFTRD
FT                   FYDQNKGFIKGLVKRAGKPVVIEMWDQRFFYFVLKFEFNFIDSLDKASALSTVQIDVEN
FT                   AERYDITYVDQDGSKKYPTILHCSPSGAIERCIYAQLEKQFMESEKGQVPMLPVWLSPT
FT                   QVRIISLSDRHADYCRRLAGELRPNRVDIDDREETVSKKVRDAGKEWIPYVVTIGDAEI
FT                   GKDKFPVVVRSESQPNKPLKVEMTVEELKARLAKDTDALPARPLPIAESLAKRPKFVGS
FT                   I"
FT   CDS_pept        400585..400989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0397"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains one Helix-turn-helix type 3 domain
FT                   (IPR001387)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0397"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60469"
FT                   /db_xref="GOA:D1YVJ7"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVJ7"
FT                   /protein_id="BAI60469.1"
FT                   /translation="MYAPEWMFDNAKIIAGEIVNAQDRGTIIQIHRGKMDLTQEELSRI
FT                   MRLRRETISRIEHGKVTPTLSFIHTFSGIATLMEAVRSYRSMNRAVEYLYFIRIGAELG
FT                   VPRDYVVSIVDTAVKNYDRKRKKAIRYLER"
FT   CDS_pept        400986..403316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppsA-1"
FT                   /locus_tag="MCP_0398"
FT                   /product="phosphoenolpyruvate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0398"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60470"
FT                   /db_xref="GOA:D1YVJ8"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR002192"
FT                   /db_xref="InterPro:IPR006319"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVJ8"
FT                   /protein_id="BAI60470.1"
FT                   /translation="MIVAAKTKSVSKEAVRPSNRLVVWLEDVRNSDIPIVGGKGASLGE
FT                   MINAELPVPRGFVVTAQAFREFIEVTGIMDRLFKMLEVNVDDPKALDRASADAKKLIMD
FT                   TPMPKNIEKAIRDYYATLCKREGEEVYVAARSSATAEDLPEASFAGQQETFLNVKGADD
FT                   LVRDVQKCWASLYGARAIYYRVEQKFPHEQVSIAVVVQKMVDAEEAGVMFTNHMTTGED
FT                   VTIIEAAWGLGESVVSGAVSPDTYLVDNKTFEIRQKKIATKQTMITRDKKSRKSKQIAV
FT                   PEAKKNVQVLPDDVIVKLAKLGQIVLDHYGKPQDIEWAVKDGELYLLQSRPITTIQKRE
FT                   AKEGLASGEVILEGLGASPGVVSGTVKIIHGRDELDKVLEGDILVTKMTEPDMVPAMKR
FT                   SAAIVTDEGGMTCHAAIVSRELGTPAVVGTREATRLLKDGQMVTVDGQKGHVLLGALKT
FT                   TEEKPSEEAKVTAVAVATKPITATEVKVNVSIPEAAERAKATMADGVGLLRIEHMILGL
FT                   NTHPQVYIKGGRSDEYVNELVKGIRTVADAFYPKPVWVRTLDAPTDEFRAMKGGEGEPY
FT                   EHNPMLGMRGIRRDLRETEHFKLEMAAFKKLFDLGYDNIGIMLPLVQHPVELKRAKQMM
FT                   LECGIDIEKVDVGIMVEIPASALIIDDFIKEGIDFVSFGTNDLTQYTLAVDRNNELVAD
FT                   LYNELHPAVLKLIEYVIERCNKAGVKTSICGQAGSRPEVARRLVGMGITSISANIDAVE
FT                   AVREMVARTEHEIILDAARKRVV"
FT   CDS_pept        403320..404453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mfnA"
FT                   /locus_tag="MCP_0399"
FT                   /product="L-tyrosine decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0399"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60471"
FT                   /db_xref="GOA:D1YVJ9"
FT                   /db_xref="InterPro:IPR002129"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020931"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVJ9"
FT                   /protein_id="BAI60471.1"
FT                   /translation="MREHGVDEDTIIRELKGACARNVPYERVLSSMCTTPHPIAIKAHK
FT                   EFIVSNLGDPRLFPGTASLEHACIGMLGELLHLPSAVGYITTGGTESNIQALRTARQLK
FT                   HVDPGKANIVLPESAHYSFDKAAQMLGVSLRRTPLDDEMKADMDAMAGLVDKNTIALVA
FT                   VAGTTEFGQVDPIPAISKLALDENIFLHVDAAFGGFVIPFMKDPSKYRFDFELPGVMSI
FT                   AIDPHKMGMSTIPSGGLLYRDERHMKSLEISAQYLTSQVQSSLAGTRTGASAAATYAVM
FT                   RHLGMDGYRRVVSECMDNTMFLRDSLVDMDIELALEPIMNIVTAKLPDAQSTRKKLCDM
FT                   GWFVSTTSRPEALRMVVMPHVTRDVIEAFMADLKKIS"
FT   CDS_pept        404534..405109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="apt"
FT                   /locus_tag="MCP_0400"
FT                   /product="adenine phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0400"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60472"
FT                   /db_xref="GOA:D1YVK0"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR026597"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:D1YVK0"
FT                   /protein_id="BAI60472.1"
FT                   /translation="MLKNLRETMRTAPIVRRGTYNYFIHPISDGVPVVKPELLREVIAC
FT                   MVKNADLDVDKIVTIEAMGLPLGAALSTMTDIPFIIIRKRKYELPGEIAVHQTTGYSRG
FT                   ELYLNGINKGDRVLIIDDVISTGGTMKAVIKALEKAGAVIKDIVVVIERGDGKKSIEEL
FT                   GYDVQTLIKIDVDENGVKILGCIDEECQ"
FT   CDS_pept        405164..406084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0401"
FT                   /product="putative ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0401"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60473"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVK1"
FT                   /protein_id="BAI60473.1"
FT                   /translation="MTSPLNIGHLSTVYHTSFILEGTDWLRKAGIEANWRLFASGPDIV
FT                   KAFENREIDMGYIGLPPVIIGVARGIPFKCIAGGHVEGTVMLAQKQYKTLDELGDVGLV
FT                   LKQFEGSAIGTPPKGSIHDVIARDLVERLGLSIEVKNYPWADFVLDALVDGEIPAAAGT
FT                   PPLAVAARRFSGARIVIPPHRLWPNNPSYGIVAREELFDSPGIVMKFLEMHERACNFIR
FT                   EKPAEASKIVAGLTEIVDPEFVREAYRISPKYCSALSPEYVASTMRFVDVLRRMGYISR
FT                   PVQEEEIFDFRFIRKAHPGPPHYDL"
FT   CDS_pept        406157..406999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0402"
FT                   /product="conserved hypothetical protein"
FT                   /note="Belongs to the Uncharacterised conserved protein
FT                   UCP004929 family (IPR009181)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0402"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60474"
FT                   /db_xref="InterPro:IPR009181"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVK2"
FT                   /protein_id="BAI60474.1"
FT                   /translation="MITMDEHVIEGLGKARIVVRDGKVVEVGEPMISYCPIFDKHRGIK
FT                   KFDREVIANNIEFRIKDFGMCTPDRVLTMKDFLSFGVSEIICTAIRQKKVDAAVMVCEG
FT                   CGTLVVTDPDMVQGIGGRVSGLVSTTPIPALIEKVGAKNVLDPKTAKIDQAAGVKKAIA
FT                   MGYKNIAVSIIDGTMAKQMRDIEKQHPGVNVYTFVVHVTAMPKEEARLVFEYADVATGC
FT                   ASKYIREEGTKKAVCKVGDSVPIFGVTPRGQALIEERIKFMGKPIVPKPNAPQPDKLI"
FT   CDS_pept        407282..408781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0403"
FT                   /product="peptidase S8 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0403"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60475"
FT                   /db_xref="GOA:D1YVK3"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="InterPro:IPR037045"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVK3"
FT                   /protein_id="BAI60475.1"
FT                   /translation="MLLASALLVNASIPLTKPSTDLSSGTYIVVFNDSQGMAGALSDQV
FT                   SAFAVENNATVKYRYDLINGMAIDVPTADAAAKLSTLKGVKYVEKNIVFHVTLDTGRSI
FT                   VGAPQVWDLGYTGKGMKVAVVDTGIDGTHPDLKGRIVDFKDYVSGKTTAYDDFGHGTHC
FT                   AGIIGGSGAASNGKYKGVAPEVQFIGVKVLGKDGSGSLDAIIAGLNYAAKSDAKVISMS
FT                   LGSDEHSQSMDDAVNNAVKAGKVVVCAAGNSGPGSKTIGCPADTPSALTVGATDKSDAI
FT                   ASFSSRGPNRDGTVKPDVSAPGKDIISCRATGTNDQKAIDTYYLSMSGTSMATPMVSGS
FT                   VILLLQKKPDLTPAEVKDIMEKTAKQLGSGVPNNNFGYGRISIVNAINYLDGKYTPPTT
FT                   PSPTPTPSPSPSPSPSPNPGNPGNPGYPGYPYPGYPYPGYPYPGQPTPTPTPTPTPDPG
FT                   NPGYPGYPYPGYPYPGYPYPSYPGYPYPGYPYPGYYGISDE"
FT   CDS_pept        408913..409065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0404"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains one YHS domain (IPR007029).; Contains one
FT                   TRASH domain (IPR011017)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0404"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60476"
FT                   /db_xref="GOA:D1YVK4"
FT                   /db_xref="InterPro:IPR007029"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR011017"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVK4"
FT                   /protein_id="BAI60476.1"
FT                   /translation="MMVKDPVCHMNVNEEKPGAKENFHGKTYFFCSNKCKATFDKNRDR
FT                   FAKEE"
FT   CDS_pept        409152..409523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0405"
FT                   /product="putative HTH-type transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0405"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60477"
FT                   /db_xref="GOA:D1YVK5"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVK5"
FT                   /protein_id="BAI60477.1"
FT                   /translation="MRPPCELTVWYVIPTIRAELSKELIKLGLSQKEVSERLGITQSAV
FT                   SQYVKDKRGKGVPVNKEVRKAIKALARDIAAGNAGKGVIPGICAVCAIVKQSGSLCDLH
FT                   RQEDADLEGCDMCLNISGG"
FT   CDS_pept        409618..410283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0406"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0406"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60478"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVK6"
FT                   /protein_id="BAI60478.1"
FT                   /translation="MRLRVIAILALLLASLTVLSAAQTPDYGGKAKVVLKLTKMPDMPA
FT                   MPQNEASGSTATFGLATADLATPEVPQGTMAQGEVLYSGDPAVKAGQAYTLYINYDSGH
FT                   APAGFLAGLIDNLKSGAVIGVNDYALSGNIITVTVGPSDDWSKKIFILDLSGTDGSKNP
FT                   FLIDLSGFRQFSAFPAFNYTTELKPMLNMSIPGMGLNTSFPGFQQTSGLFSMFSHFFG"
FT   CDS_pept        410368..410877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0407"
FT                   /product="truncated threonyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0407"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60479"
FT                   /db_xref="GOA:D1YVK7"
FT                   /db_xref="InterPro:IPR015011"
FT                   /db_xref="InterPro:IPR023509"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVK7"
FT                   /protein_id="BAI60479.1"
FT                   /translation="MRILAIHASHISWRATKKAKFAEEITKKDGSMDGCVVLFSCVEKQ
FT                   DEVEPARVVEGATREIRKRLGMLKVNKVVVFPFAHLTSALGRPEIALQVLKDLEKSLAG
FT                   HGYEVERAPFGWYKEYDLKSTGHPLSELSMSICPYEGKSCDASCPYCSHPINISELSKV
FT                   APTEDI"
FT   CDS_pept        410918..412093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iscS-1"
FT                   /locus_tag="MCP_0408"
FT                   /product="probable cysteine desulfurase"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0408"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60480"
FT                   /db_xref="GOA:D1YVK8"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR010240"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="InterPro:IPR017772"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVK8"
FT                   /protein_id="BAI60480.1"
FT                   /translation="MKRIYLDNSATTKVSPEVLDAMLPFFTENYGNPSSLHTMGQEANV
FT                   AVQAAREQVAKAIGADAGEIIFTSCGTEADNLALVGTAYANRKKGDHIITSSVEHPAIL
FT                   RTCEYLEKEGFKVTYLPVDNYGMVSPASVEAAITPQTTLISVMAVNNEIGTIQPIKEIG
FT                   NIAKDHKIYFHTDAVQGVGKIPLNVKNDNIDMLSLAGHKIHAPKGVGALYVKKGTRIQA
FT                   LIHGGGQERNMKSGTENVPGIVGLGKACEVGIRDFDKNVAHMTKLRNKLMEGILKIDHV
FT                   HLNGHPTIRSPNNVNASFNFIEGESLVLFLDMAGIEASTGSACSSKNLKASHVLLACGM
FT                   NPEEAHGSLRFTNSELNTGEEIDYVLETLPGIVDRLRAMSPLYKKAAKTVT"
FT   CDS_pept        412106..412561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0409"
FT                   /product="putative iron sulfur cluster assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0409"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60481"
FT                   /db_xref="GOA:D1YVK9"
FT                   /db_xref="InterPro:IPR002871"
FT                   /db_xref="InterPro:IPR017787"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVK9"
FT                   /protein_id="BAI60481.1"
FT                   /translation="MMYSPKVMQHFSNPQNVGEIPDADGVGEVGNPVCGDLMTIYIKVK
FT                   DNKLSDIKFKTFGCAAAIATSSIITTMAKGMTLEDAVKISRNDVAKELGGLPPQKMHCS
FT                   NLAADALKLAIENYRRKLQGLPPRTGVTEGEEEHAEDGASCPPEEHK"
FT   CDS_pept        complement(412603..413835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0410"
FT                   /product="putative ABC transporter"
FT                   /note="Belongs to the SufBD family (IPR000825)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0410"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60482"
FT                   /db_xref="GOA:D1YVL0"
FT                   /db_xref="InterPro:IPR000825"
FT                   /db_xref="InterPro:IPR037284"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVL0"
FT                   /protein_id="BAI60482.1"
FT                   /translation="MLEPVRLSEIKKKAEAAMNKRPAYGNDIDLEKYEKAVPVREKITS
FT                   LDQLSSSVKERALHAGVDASMRQRSGSYFQLDQSVVHTATSMEGVELMDINAALEKYDW
FT                   LQDYFFKLIQPDQDKFTAYGATHPFGGYFIRALPGAKVTFPLQACMYIGREGMIQNVHN
FT                   ILIAEEGSELHVITGCTTDTHVSQGLHIGVSEFFIKDNAKLTYTMIHNWAPEVVVRPRT
FT                   NTVMGKNSVFLSNYVSMTPVKDAQMYPGCTMQGENGVARFNTVVYAPKGSHLDLGSKAV
FT                   LKAKGCKAELIARTISKGGYIASRGLIQGDVPDIKAHLECRGLLLSGDGTIYAVPELLG
FT                   TVPGVDLSHEAAVGKIAEEEIQYLMSRGVDSDTATALIVRGFLDVDIHGLPPELQAEIK
FT                   KTIDLGEQSMM"
FT   CDS_pept        complement(413820..414569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0411"
FT                   /product="ABC transporter ATP binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0411"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60483"
FT                   /db_xref="GOA:D1YVL1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010230"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVL1"
FT                   /protein_id="BAI60483.1"
FT                   /translation="MLSIEHLTVEVDDKRILNDVNMFIGEGETHALFGPNGSGKSSLLF
FT                   TMAGVPKYKVKSGKITFKGKDITDAPMDERAKMGIGILFQHPPVLRGVKLNDMVKVSME
FT                   QLNHKKVSDQDVAELARKLNLENFLSRDVNLGFSGGEIKRSELLQLLAQRPDLVLLDEP
FT                   DSGVDLVNIGLVGNTINELLQKDKKTVHRSKSGLIITHFGNILDYVKADKAYVMMKGTV
FT                   LCQGNPVELLDDIRHRGYSECLSCLNR"
FT   CDS_pept        complement(414706..415896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argD"
FT                   /locus_tag="MCP_0412"
FT                   /product="acetylornithine aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0412"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60484"
FT                   /db_xref="GOA:D1YVL2"
FT                   /db_xref="InterPro:IPR004636"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVL2"
FT                   /protein_id="BAI60484.1"
FT                   /translation="MAQTKAKVRLSEEEAIAKDARYVVQTYGRQPIVLTKGKGALVWDV
FT                   NGREYIDCVAGIAVNNLGHCHPKVVAAIQEQAAKLMHTSNLYYTDIQPELAERLAQITK
FT                   MDRIFFANSGTESIEAAMKLARKRTGKKGFIAAEHCFHGRTMGALSITHKSKYREPFEP
FT                   LVPGARFVPYGDADAIRRALNGDVAAVVLEPIQGEGGVQIPPKDYLAEVREICDKAGTL
FT                   LIFDEVQTGMGRTGKWFAKEHSGVEPDIMCVAKGIAGGFPMGIMAAQEGIASAFRKGDH
FT                   ASTFGGNALGCAAALATIKAIEGEHLLERSREMGDYLKKELSIRCKQDFVDHVRGVGMM
FT                   VGVQMNKDGNALVDKAREKGVLINVASDTVIRFVPPFVITKEEVDRVVGVVSELAL"
FT   CDS_pept        complement(415998..416912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaAB"
FT                   /locus_tag="MCP_0413"
FT                   /product="GMP synthase [glutamine-hydrolyzing] subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0413"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60485"
FT                   /db_xref="GOA:D1YVL3"
FT                   /db_xref="InterPro:IPR001674"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR025777"
FT                   /db_xref="InterPro:IPR026598"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVL3"
FT                   /protein_id="BAI60485.1"
FT                   /translation="MDVDSFITDAVADIKSKVKDGRALIALSGGVDSSVCAILAHRALG
FT                   ERLVPVYVDTGLMRKGETDRIRDIFSFMNPRIVDASGQFFNALKGATDPEKKRKAVGET
FT                   FIRVFEQVARDINADYLIQGTIYPDRIESEGGIKSHHNVGGMPSVMEFKGVVEPIGDLY
FT                   KDEVREVARALGLPLEISERMPFPGPGLSVRVIGEVTPEKVAIVREANAIVEEELVQQF
FT                   HPWQCLAALLEKGTGVKGDNRCHGWIVAVRAVESRDAMTANHMELPWETLNRISSRITS
FT                   EIPSVARVVYDITPKPPATIEFE"
FT   CDS_pept        complement(416975..417442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0414"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0414"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60486"
FT                   /db_xref="GOA:D1YVL4"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVL4"
FT                   /protein_id="BAI60486.1"
FT                   /translation="MKTLIACYSFTGNTSKVAESLKEATGADFTRIEPVKDANYLMKCL
FT                   SALFKRRTPIKPCATDLKGYDAVIVCSPVWADSVPAAINQYIDELKGCEGKKFGIIVTY
FT                   GSTGQNRVSGQIMAALEKKKMTFIDSIWVTQDEARAGDYAEKVKQLAAELN"
FT   CDS_pept        417489..417785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0415"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0415"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60487"
FT                   /db_xref="GOA:D1YVL5"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVL5"
FT                   /protein_id="BAI60487.1"
FT                   /translation="MAAEVSLLYGRRFLGCTMKLKMSDRMLRLVRLLWLPVLLVILIVA
FT                   DSYLKISESSYSWAFIGLQIALFLVYTYFLFKDRQKYVAPANRVMKGKRKTKK"
FT   CDS_pept        complement(417801..418397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0416"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0416"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60488"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVL6"
FT                   /protein_id="BAI60488.1"
FT                   /translation="MNSKYSVILAILVVLTAMAAAGCTTTSPAATATPAASQAPATSAT
FT                   ATASATTPASSMPTLDFNSLKVLEYKITSDVDGQSTSMNMRWEFGASDVRMKITSEGMT
FT                   VMDMTVPRDQASGTEGSGALGDAMSDDFSTTLVNAGPDVVTVPKGQYTCTKYTVTDGNA
FT                   VSTYWIANNVPLPIKMTQSENGKETMTMELVDYQV"
FT   CDS_pept        complement(418521..419042)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0417"
FT                   /product="putative flavodoxin"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0417"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60489"
FT                   /db_xref="GOA:D1YVL7"
FT                   /db_xref="InterPro:IPR001226"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVL7"
FT                   /protein_id="BAI60489.1"
FT                   /translation="MADRPNILIVFTSWSGNTRALAEAIAEGAKGAGNGNVDVTVKRAR
FT                   DTKRSDIESASAVAFGSPTYYSYMSGELKALFDIALPFKNSFYRKPAVAFATGEGGQLK
FT                   CIQSIEGILELFEVSFVQRSDILSAGLAVQGRPDEGAIRQAKAIGRKLGDAGVAYACSM
FT                   GRKNIIAGKT"
FT   CDS_pept        complement(419096..419449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0418"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0418"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60490"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVL8"
FT                   /protein_id="BAI60490.1"
FT                   /translation="MEQAAEAIPVQKPASVMTMQNLAALGLALAIDFTDAVPSELLFLI
FT                   GLPPVAMGIESGVSVVEAAYLSYLGVPVVKWLAMSGVDLLPIVDIIPWCTLAVLDRRFN
FT                   LKIPLVTKLFNYS"
FT   CDS_pept        419723..421435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acsA"
FT                   /locus_tag="MCP_0419"
FT                   /product="acetyl-CoA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0419"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60491"
FT                   /db_xref="GOA:D1YVL9"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVL9"
FT                   /protein_id="BAI60491.1"
FT                   /translation="MIGDCNVCYDEACGSGFCFDDVRKEFDWYTTGKVNIGYEAIDRHA
FT                   KSWRKNKVALYWEGADGSDRKYTFQEFKIRTDKFANVLRKAGVKKGDRIFVYLPRIPEL
FT                   YASAISIAKLGAIFAPLFGGFRAEAVRDRINDAEACMVITTPEMKRLGIDPIRKDIPSV
FT                   KTVVLCNIPRNYDLEPGDLSYDAEMIYASEEFEPEWCDLEDPVIMHYTSGTTGKSKGVV
FT                   HVHNAMIGHYITTKWVQDLRDDDVYWCTADPGWVTGTSYGIFGPWLNGASQVVYAGRFS
FT                   PEAWYWIIDKYKVTVWYTAPTALRMLMKGGEDVVKKYHLDSLRYITSVGEPLNPEVIRW
FT                   GMRVYGLPIHENYWMTETGCNVIANFYGMPLKIGSMGKPFPGIEAAVIDDKGKVLPPGV
FT                   PGNIAIKPGWPSMMRSIWNNPAKYNEYFRISGWYITGDSAFMDADGYFWFTGRIDDVIK
FT                   TSGERVGPFEVESALLEHPAVAEAGVIGKPDPLYGNVIKAFISLKPGYDGTEELKREIS
FT                   ESVKKSLAAHAFPREIEFKASLPKTRSGKIMRRVLKAMELGQPLGDLATLDDE"
FT   CDS_pept        421550..422326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0420"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains one Methyltransferase type 11 domain
FT                   (IPR013216)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0420"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60492"
FT                   /db_xref="GOA:D1YVM0"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVM0"
FT                   /protein_id="BAI60492.1"
FT                   /translation="MITDDFDYLAPGGRSYTLASGRLSGIKKNSRVLEIACGRGAAACA
FT                   LAEAYKCRVDAFDIDPVMVEHSMETSNKLGFGEFTNFFVKDGRDMDFGEGKYDLVLAEG
FT                   GALTYIGREEGIARAADLLKEGKCLALTDLIYLRDDVPQPVRDAYEEGVYTYLTEIRYR
FT                   KLLEAYDFEVVFASMLPQSAWDRYYAQMRRQVMNPKNRFTKDFKDSMMREIDVYYNYGG
FT                   MFSVGYFYAVARLSRNKRVKPAGEGLRIPLAFSYGH"
FT   tRNA            422405..422479
FT                   /locus_tag="MCP_t0009"
FT                   /product="tRNA-Glu"
FT   CDS_pept        complement(422806..423195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0421"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0421"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60493"
FT                   /db_xref="InterPro:IPR007374"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVM1"
FT                   /protein_id="BAI60493.1"
FT                   /translation="MDVLLSIKPKYANKIIDGEKKFEFRKIKLDKRKIGHIYIYSTSPV
FT                   KKIIAKIAIGDIIEDSPERLWKRCEKHSGISKEEFFSYYAEKEVGFAITIKKVEPLDVP
FT                   IDPYVKIENFTPPQSYYYLKDGSLF"
FT   CDS_pept        complement(423173..424441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0422"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0422"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60494"
FT                   /db_xref="InterPro:IPR002740"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVM2"
FT                   /protein_id="BAI60494.1"
FT                   /translation="MIGNPQLDSHSIIDAQLLNAVYKNAVHVFITEDKEIHRFASKLGI
FT                   ENRVLDIVTALADFDNKAARMHDHFRIKPDFMYNIDYLDPFFDSLREDYGIVKFNDWFL
FT                   KKSRDGRKCWVHRTNHKLKAILILKDEDEEIALINKAPLRRKPRLKIATLKVACKGYRV
FT                   GELLLKLAIGYSIDHNYDEIYLTHFVRENDDLLKLITKHGFEYIGERNCIDQKGEYEKV
FT                   FLKSLFPDNAINYDPAEVNKRFYPSFIDSIRVNKYIVPIQPEYHDRLFQDYKKRQTLLS
FT                   DFSTDIPQGNTIRKAYLTNSHIKKIKPGDLLLFYRSKDQHQITSIGVVEQVYYQLDDTD
FT                   KIWYTVEYNRSVYTYDEVKGFKKPATVIIFRHYFNLKKPLGIKELIKHGILSAHPQSIS
FT                   TLTPDQYDYIKRNGGIDGRFTFD"
FT   CDS_pept        425159..425614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0423"
FT                   /product="putative MarR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0423"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60495"
FT                   /db_xref="GOA:D1YVM3"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVM3"
FT                   /protein_id="BAI60495.1"
FT                   /translation="MVGKVKRDTLSLNLKKLEESPGGYLMHVAQKWEREVDNVLDGFDT
FT                   TCTQIELLSCLVKLMKEGNPVTQKDIAEYLRRDKNTVSEVMRSMEKKGYITRSVSENDM
FT                   RAKYILLTDKGYDLLEKAVSEIVRMDERFFTDYNENHELRKLLEKYL"
FT   CDS_pept        425746..426519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0424"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0424"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60496"
FT                   /db_xref="GOA:D1YVM4"
FT                   /db_xref="InterPro:IPR025495"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVM4"
FT                   /protein_id="BAI60496.1"
FT                   /translation="MSFDTGHINGFIRRKTGDFETIVISNPNKNLARAAGILYLVMIVC
FT                   GMAAQLIRGSLIVPGNGVVTTGNIVASESLFRVAFISDLFMATGFLLFAWALYVLLKPV
FT                   NKNIALLFVLLATASVAILCLNLLNQFAILILVNDAGYLAAFGAVHLNALVMLFADLHY
FT                   YGYYIAQISFGLWLAPLGYLVIKSGFLPRILGILLIIATFGHLFGFLAAFLLPGYESFG
FT                   DLPAFLEIPFGLWLLVKGVQGQQPVKNPNQQAAIS"
FT   CDS_pept        426684..427196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0425"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0425"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60497"
FT                   /db_xref="GOA:D1YVM5"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVM5"
FT                   /protein_id="BAI60497.1"
FT                   /translation="MVQNGNDLKDRLPEKTLLVVFSYHHMNTEKVAKVFANVLDAQVKT
FT                   PRQVNPGELGDYDLIGFGSGIDSGRHYKELLDFADALPRVAGKKAFIFSTSAIVGADKV
FT                   WKDHSALREKLQAKGYVIVDEFACKGYNTNSFLKYIGGMNKGRPNAEDLKQAEEFALGL
FT                   KQKLKEM"
FT   CDS_pept        427285..427740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0426"
FT                   /product="MarR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0426"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60498"
FT                   /db_xref="GOA:D1YVM6"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVM6"
FT                   /protein_id="BAI60498.1"
FT                   /translation="MAEKVDWESLSLRYDRMGERPWRYLTVVIKKWEREVGVVLESFET
FT                   TRAQLEFLMCIAKFMKEGRTVTQKDVANALGRPKNTASGVFKSLEKKGYIVRSVSEDDL
FT                   RSKHIVLTEKGLLLVEKALSAVMVVDERFFPDARDNAELIKLLKKYF"
FT   CDS_pept        427833..428579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0427"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0427"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60499"
FT                   /db_xref="GOA:D1YVM7"
FT                   /db_xref="InterPro:IPR025495"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVM7"
FT                   /protein_id="BAI60499.1"
FT                   /translation="MKGIVMDTEIRAESPVKYAPRLLGAAFLFVILTSLAGGLLLKSAA
FT                   GSGSIADVLVNVSQNPTLFRIDILDGLLNSTGIVALAGLLYVVLRQQNKPLARIALGLW
FT                   LAEAIFYAIIQMGLLALIPLSAEFVAAGAPAGSFYLTLGDFLYNGVYAQGMTIHMWFYC
FT                   MGGLIWYYLFYRSNYIPRAISLFGLLAVILGLGSVVFQLLGYEVPILVSLPLLPFELAI
FT                   GAWLLFLGIREQATAVNPSRQPAVQG"
FT   CDS_pept        428682..429095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0428"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0428"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60500"
FT                   /db_xref="GOA:D1YVM8"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVM8"
FT                   /protein_id="BAI60500.1"
FT                   /translation="MTRSKEIWRKAFILAIAGGAAFWVANLAISLTPIAAEYRAALSIS
FT                   YLPMLLEALVGGLIIGFCISYFLLRYFDKIPTMSPIFKSVILSFAALCIIEAFTIFVNL
FT                   NNAPVYLFLLIGAGMNVPRFLALGLVIGYLYKR"
FT   CDS_pept        complement(429773..430114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0429"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0429"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60501"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVM9"
FT                   /protein_id="BAI60501.1"
FT                   /translation="MVSFTDWAIEGSARFTGPKGTTFADVSMAFVGPATMPSSNSGKSI
FT                   LNFSELITDMLALLNSIIVNAVFALGNPKATLSVVKNGNDISEKAIAGWAVAANVNMTI
FT                   ANAMDTLTG"
FT   CDS_pept        complement(430609..431226)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0430"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0430"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60502"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVN0"
FT                   /protein_id="BAI60502.1"
FT                   /translation="MVFTLIVFSSAMFAGMQAEKAEANANLTAYKTVPPNSWEPMGYNM
FT                   TGTAPYFITHTLNWSNTRIMGNLGIGDGSVRTLNDTSNRDVNYTDNNFMAADISMAPWD
FT                   PGRLTALNPLAGTTNATQAVVNETGNATNETVGNVTESSSINFNRPLSDPYHPILMGRP
FT                   VDDLLYEYPLATPINMYARLLGLRMPGGSCLNMGVKCLGYGY"
FT   CDS_pept        431524..431853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0431"
FT                   /product="putative nitrogen regulatory protein P-II"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0431"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60503"
FT                   /db_xref="GOA:D1YVN1"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVN1"
FT                   /protein_id="BAI60503.1"
FT                   /translation="MKMVQAIIRPERLDGVKKALEEKGFIALSITEMRGRGEQKGIRLS
FT                   HRGRPLEVDVLPKVKLELVVDDEHVDPIVSIIRGSARTGKVGDGKIFVLPVDMMCKVRT
FT                   DEVWK"
FT   CDS_pept        complement(432134..434566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0432"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0432"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60504"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVN2"
FT                   /protein_id="BAI60504.1"
FT                   /translation="MEDYEKLGSFYLGKAYDLSAQKAKDELLLYDSKDLVTHAMCVGMT
FT                   GSGKTGLCISLIEEAAIDGVPAILIDPKGDLCNLLLTFPQLRGQDFLPWINVDDARQKG
FT                   MSPEDYAAKQADMWKNGLASWGQGGERIQRLRDAAEMRIYTPGSNAGIPVSILKSFAAP
FT                   GPAIRDDNDLFRERIGTTVMSLLGLAGINADPMQSREHILLSTILDNAWRQGQDMDLAR
FT                   LIQQVQTPPMNKIGVLDLESFYPAKDRFGLVMALNNLLASPGFNAWMQGVPLDIGQILY
FT                   TPAGKPRIAIFSISHLSDSERMFFVSLLMNQVLGWMRAQPGTTSLRAIVYMDEIFGYLP
FT                   PLANPPSKLPMLTLLKQARAFGIGMVLATQNPVDLDYKALSNMGTWFIGRLQTERDKAR
FT                   LLDGLESATAGAKFDRQAIEKVLSSLGNRVFLMNNTHEDAPELFQARWALSYLRGPLTR
FT                   DQIKVLMDPFREAPSAAPVAQATAAPEAASPTVPAASGQPTLPPGIQAFFLPLRGGMKS
FT                   GSRLVYQPKIVGAAKISFADSKTKINTARSQVFITPVTNGAIPVSWESAEEIAVPAAEL
FT                   EKSGQNGGQFGELAPAASREKSYASWTKDFTSWVYGTQRLELFRSPSLGEVSQPGEAER
FT                   DFRIRLQQKARESRDEKVEALRKKYGPKIATLQERLRKAQANVEKQQSQARQAQMNTAL
FT                   SVGATILGAFTGRKALSTGTISRASTAAGRAGRAMEEGKDVERAGETAEAVQQQLNDLQ
FT                   AQFKEEANALAEKIDPMTEALEAISVKPKKADISVQLVALAWAPYWVDAQGGLTPAW"
FT   CDS_pept        434716..435417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0433"
FT                   /product="aspartate racemase"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0433"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60505"
FT                   /db_xref="GOA:D1YVN3"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR004380"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="InterPro:IPR018187"
FT                   /db_xref="InterPro:IPR033134"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVN3"
FT                   /protein_id="BAI60505.1"
FT                   /translation="MKTIGLIGGMSWESSIEYYRIINEAVREQMGGLHSAPIVMHSVEF
FT                   EDIRALQDKGEWAELTNIMADMARGLKWAGADFILICTNTMHIMADDVQRRAGIDVLHI
FT                   ADATGLEIRRAGLKKVGLLGTRFTMEKDFYTGRLKDGFGIEAIIPEEAERQEVHDIIFK
FT                   ELCAGVIRPESKARLKEIIAGLSSRGAEGIILGCTEIPLIIGQGDVPLPVFDTTRIHAM
FT                   AAVGRAMPQAG"
FT   CDS_pept        435494..435712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0434"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0434"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60506"
FT                   /db_xref="GOA:D1YVN4"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVN4"
FT                   /protein_id="BAI60506.1"
FT                   /translation="MDNLTQRRIIAVIGIIIAFGGLCSFLWGMLNKDSVLQLIGFFSII
FT                   IAYVLMLAVKKIREKGMAEKQQESKVE"
FT   CDS_pept        complement(435698..437218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfcL"
FT                   /locus_tag="MCP_0435"
FT                   /product="replication factor C large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0435"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60507"
FT                   /db_xref="GOA:D1YVN5"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR023935"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVN5"
FT                   /protein_id="BAI60507.1"
FT                   /translation="MSEERCMDWAEKYRPVSLSGVLGNDAAVKALRKWAETFGSGKKAA
FT                   ILYGGPGIGKTSAALALAHDMGWDYIEMNASDQRTKDAINKVAGSASKTGTFGGTNERR
FT                   LLILDEADNLHGNYDRGGEAAIINVIKNTNQPIILIANDFYALSKPLRDAAEPIQFRAL
FT                   LSTSIVKALKKICAAENIKCQPEALMKIAERTNDMRSAINDLQAAAMGREEVTLADVST
FT                   GERDVPESIFKVMGLIFRGDDPGKARRAVMDLDESPEDLIGWVDENLPREYHDGDLERG
FT                   FDALSKADLFLARVRRRMDYGMWRYASFMMVAGVNRARKRRYGGYSKYSAPTYWQKLGR
FT                   ARGTRAVRDSLAAKIGKYCHTSKREARAVFIPLLRVLFRDEGYAVGITARLKLEEDEIA
FT                   FLLDAEKSSKKVGKVYEKSRDLIEKEVEHEIDVFARFAPKEPSAHKVEETAAEPAAEPA
FT                   PKPKRKRKTARDGGEVPAPAIVVEPLVEEPKKEEAPSEPKRQRTLFDF"
FT   CDS_pept        437336..438322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0436"
FT                   /product="putative thiamine-monophosphate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0436"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60508"
FT                   /db_xref="GOA:D1YVN6"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR011413"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR017668"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVN6"
FT                   /protein_id="BAI60508.1"
FT                   /translation="MKLEILAGALRDYLGTTRKHTIKNIVGIFDEKGTNPSFGEDAAII
FT                   DNGEYALLLAADGIWDKLMRVDPEWSGYCSVLVNVHDIAAMGGRPLGMVDVFSSNSDEI
FT                   TQRVLKGMKAGIDKFGVPIVGGHVHPDTPYAALDVAILGIAKKDTVIYSSTAKPGDDVV
FT                   LAIDMDGRVHPSCDLNWDTTFLKDASIVRQQVGSMVELAERKMLTAGKDVSNPGIIGTL
FT                   GMLLEVSGVGADVDMSAMPKPESLEWEHWLKMYPGMGFIVTCKPENTEQVLDIYRNHKL
FT                   NATKVGKIVSAPRLDLVKGKERATVFDFTKHEITGLGPARGRWCNNH"
FT   CDS_pept        438332..439345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0437"
FT                   /product="isocitrate/isopropylmalate dehydrogenase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0437"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60509"
FT                   /db_xref="GOA:D1YVN7"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVN7"
FT                   /protein_id="BAI60509.1"
FT                   /translation="MAKKVAVIKGDGVGPELTDLMMKTVKAAGSKAGFVECEAGAGWWE
FT                   KHGGNSLIPEETWKALSNTDACFKGPTTTPGGAGSPKSVAVSIRQKFDLYANVRPIKSY
FT                   KGTAAPLGEVDFVCVREGTEGLYVGEEVQLTDDVYIAIRKITRPSCRRIAKYAFEEAKR
FT                   RKWKSVVAIHKSNILKKTDGAFLEECEAVKKQYKGIELEEYHVDNVAQQLIKNPANYNQ
FT                   KVLLSTNLFMDILSEECSSLVGSIGLIYSANIGDKYAMFEPAHGSAPKYAGMDKVNPVA
FT                   TVLAGAWMIDYLGEKKQSQAIFKATEKVIAEKKHVTYDMGGKAKSSQMVDAIIKHL"
FT   CDS_pept        complement(439527..440765)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgk-1"
FT                   /locus_tag="MCP_0438"
FT                   /product="phosphoglycerate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0438"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60510"
FT                   /db_xref="GOA:D1YVN8"
FT                   /db_xref="InterPro:IPR001576"
FT                   /db_xref="InterPro:IPR015824"
FT                   /db_xref="InterPro:IPR036043"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVN8"
FT                   /protein_id="BAI60510.1"
FT                   /translation="MDRDYCTMDDFDLDGKTVILRAEFNSPIGPDGKILDDKRIRESVP
FT                   TIKGLEGSKVVLIAHQSRPGKKDFTTMEQHAKRLQRYVKQSVHYVDDIFGSHARAAIVE
FT                   AEPGDIVMLENVRFYSEEVLELKPEAAAKTVMVKKLAPLAQVFLNDAFGASHRSQDSLV
FT                   GFTPILPSGSGKLMQKEIDSLTEALRGGGEVVYVLGGAKVDDSISVTKNVLEKGIASRV
FT                   LVTGVVANVFLAASGMNIGNPNYEFLEKNELTGEIPNAKEVLQKFDGKILMPSDVAINK
FT                   DGKRVEINVRQLPADYPIMDIGHETIANFSDIIRHSDKVILNGPAGVFENPEFGTGTRD
FT                   ILMAATKAKFSVVGGGHSSAAVEEMGIEDKITHVSTGGGAAIDFLSGKPMPAIDALKAA
FT                   KKRMMEHVGAKTH"
FT   CDS_pept        440941..441555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0439"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0439"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60511"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVN9"
FT                   /protein_id="BAI60511.1"
FT                   /translation="MTLWKPAAVLALFAAMLFIGYFWPFQIWLDDVRPHLPESLDDWVQ
FT                   SILDRLPPDKDKNLKLPLPEVKYECDFYYDPVVGTGEFNSTQWILNNTASDDKFVADIF
FT                   GAELIMGMTCRVSTVGGDWANAPDPISMMVHTNDIYKTDNATYAYELAKMEKADYVFLP
FT                   YRGLYTGWWVPKEEVNYTKFNDTRYFEQVFAEDNVTIYRIL"
FT   CDS_pept        complement(442138..443718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0440"
FT                   /product="Na+/solute symporter"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0440"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60512"
FT                   /db_xref="GOA:D1YVP0"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVP0"
FT                   /protein_id="BAI60512.1"
FT                   /translation="MAVDTLTFAVMALVYLVIVLALGYLGYKQTKQAEDYMLAGRKVHP
FT                   ALIAISYGATFISTSAIVGFGGQAGYMGMGLIWLTFLNIGVGILLAFVVFGKKTREIGS
FT                   KLRAVTFPDLMGKVYNSSFMQYVCGLVILVGMPLYAAAVITGAGRFIETTFAINYNLAL
FT                   LAFAIITAVYVILGGLLAVIYTDTFQGIIMLIGMTVLLAFTFISIGGVTNGFQALTDLA
FT                   STAPASLTKTGFNGWTQMPTLGSPLWYSMITSIVMGVGIGVLAQPQLVVRFMTAKNNKS
FT                   LNRAVPIGGFFILMMTGVAFTVGALSNVYFQQTAGTTAMAAAGNNIDSIIPAYINAAMP
FT                   DWFVVLFMLTLLAAAMSTLSALFHTMGTAAGNDILGKWKKQKPSILMNRASVLVMLVIS
FT                   VIVAYIMPTSFIAAATALFMGLCAAAFLPAFAHALYSKRPSQLAAKSSVVVGSLVWLFW
FT                   AVFVHAKYAGIVGLAKLIFGTNLLGAPWQTIDPFIPGLIVSTITMAAVWMLDRRPEVEE
FT                   EVKVKQVKA"
FT   CDS_pept        complement(443708..443866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0441"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0441"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60513"
FT                   /db_xref="GOA:D1YVP1"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVP1"
FT                   /protein_id="BAI60513.1"
FT                   /translation="MRIVRLIWRVMNMLGIDDPWILLGYICTLGIALVCILYGLVKWNE
FT                   GGDADGS"
FT   CDS_pept        443924..444745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0442"
FT                   /product="putative TrmB family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0442"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60514"
FT                   /db_xref="InterPro:IPR002831"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVP2"
FT                   /protein_id="BAI60514.1"
FT                   /translation="MNQPFDEKTLSKMSMFGLTEYEARVYLTLIVKGGLEASKVSKYAD
FT                   IPRPHTYSVLKSLQMRGLVTVIPEAVNRYRAVPLDEGMDLLMEEQEKQLSYLRDAREEL
FT                   LSEIKPKEAIPTNHQSIVLLYYGRQNVYKLVDEMFARCEHTCDIMTTANGLVRFYKYFS
FT                   DKASEFRNKDIKVRFIAPVTPQVEDFALKLSQLVELRHIDRLPYIRVVLLDEKEVLFAE
FT                   FFDDDFKSTGRETGIWINQAELTKMMKTMFENTWQNTVPYEKKGEPSPSSD"
FT   CDS_pept        444783..445307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0443"
FT                   /product="hypothetical protein"
FT                   /note="Contains at least Tetratricopeptide region domains
FT                   (IPR013026).; Contains at least three Tetratricopeptide
FT                   TPR_1 repeats (IPR001440).; Contains for Tetratricopeptide
FT                   TPR_2repeats (IPR013105)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0443"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60515"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVP3"
FT                   /protein_id="BAI60515.1"
FT                   /translation="MCEDPHPSSPGPKKPKKLSEEMDADSHIREGNALLLVGRIDEAIE
FT                   EYRAALDKDPENAEVHYNLGLIYRKTMQLDDAIREYREAIRVDPGNMKYHNNLAAALVV
FT                   KGQKSEAVKEYEEALRIEPKNATLHFNRGFALDEMGELQEAKKEYEEALRIDPGFDHAM
FT                   FYLGMLKKKLK"
FT   CDS_pept        445341..446189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0444"
FT                   /product="aldo/keto reductase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0444"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60516"
FT                   /db_xref="GOA:D1YVP4"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVP4"
FT                   /protein_id="BAI60516.1"
FT                   /translation="MDIRTSRFGKTGRQVTIAGLGGEGVLRTYGRTQEAVAVIDEAVRQ
FT                   GIRYFDCAQAYAGSEGYYGHYWPAHPDARAKVFQASKSASRDKEGALADLDNTLKTMGI
FT                   DYLDLWQIHDVRTREDIDEIEGKGGTLEAFLEAKKSGKVKHIGVTGHHDPAILTYCIEN
FT                   WPVESVMMPVNPVEGALGGFLTEALPAANKKGIAVIAMKVLGHGGYVIPDAKISAGTLI
FT                   RYALSQPVTVAIVGCMDPDEVRELAGAGREFQPMPPEEQAQLVDIYHPYARKLAYYRGT
FT                   F"
FT   CDS_pept        complement(446186..447157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadE-2"
FT                   /locus_tag="MCP_0445"
FT                   /product="NH(3)-dependent NAD(+) synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0445"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60517"
FT                   /db_xref="GOA:D1YVP5"
FT                   /db_xref="InterPro:IPR003694"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVP5"
FT                   /protein_id="BAI60517.1"
FT                   /translation="MAENSLKECLAFNPEKARAEIVDFIRSQIRRFNKKGTMIGLSGGL
FT                   DSSTVAFLCVEALGKEKVMGLILPERDTTPKNTEDGIDLAEKLGIPYKKIDISPILEGL
FT                   GAYTLFPKEVTSSRSAMEEAVDRMKRMTGKQSAFAESFSSIYTPGGAQEDHYVGRMHAF
FT                   MTAKTRARMMTIYFHAIIMDYLVVGTDDLSELTIGFYDKYGDGACDISILSHLFKTQIK
FT                   ALAAHIGVPEHIVNKPSSHDLWGEGMPNEETIGLPYEKLDMVLCGLMEGLWEADIADMA
FT                   GVRLDDIVAVKKSIASERVRRSMPISVNIEPQAAEEEQLMKR"
FT   CDS_pept        447405..448799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0446"
FT                   /product="putative pyruvate carboxyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0446"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60518"
FT                   /db_xref="GOA:D1YVP6"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVP6"
FT                   /protein_id="BAI60518.1"
FT                   /translation="MMRRYDEMPKIKLPNAKDIKISDTTIRDGCQMPGIVMKKSHKLKI
FT                   FEYLHDMGVEKLETFIYNDRDKDAARAMMDYSYDFPEVTGWARANPADIDEVLKVGGIR
FT                   ETGILMSISDSHIYDKMGLKSYEEAEKKYLNALQYAVDHGLKTRCHIEDTSRANYAFVY
FT                   PFIRKCIEIDPHTIIRVCDTLGYGVPFPEEEEPYGIPIVVKKLKEIGVKHIEMHVHDDF
FT                   GLGVANTLAGLWYGADWANLTFLGIGERAGNSELEKIMAFLITRVEGFDKYDLRTVTEF
FT                   AQYMEDEVGLRVPRNKAIVGKNIFSHESGIHTAGIIKNPFTYEPFPPELVGGKRNLMIG
FT                   QTSGTEVVRLKAEEALNELLGIEVHVEKSDSRIKSIHNEIQKMYDAEERRSSVSDEEMK
FT                   DYVRKYFLYQVDGWEEELEERKAKKKLNLTLVNPEFMPLDGIPAAATSLTDKSVKKVKN
FT                   GSSKKK"
FT   CDS_pept        complement(448820..449509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0447"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0447"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60519"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVP7"
FT                   /protein_id="BAI60519.1"
FT                   /translation="MIYLAMDDTDNLESRGTGRLARAIAVELSRRYHVMGVTRHQLFVH
FT                   ESIPFTSHNSCAVIHIQGDSGMDDIFDTAKKLMLDDFVEGSDPGIAVASSRQVNSGVVA
FT                   FGQDAKCIVVNQERARSVAANAGIRLEGLGGTEGGVIGSVAGIGLAASGSDGRFLLRGR
FT                   NRELIGPQPVWALLSSGIDQVMTIDGRLVNDGMIAIRKSPTPSFVQGRAVLFVEESDGG
FT                   YVALKRP"
FT   CDS_pept        complement(449602..450243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acdB"
FT                   /locus_tag="MCP_0448"
FT                   /product="acetyl-CoA synthetase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0448"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60520"
FT                   /db_xref="GOA:D1YVP8"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVP8"
FT                   /protein_id="BAI60520.1"
FT                   /translation="MMLSELEAKELLAGYGIPVNEGRAACSAIEASEAARHIGFPAVVK
FT                   VLSEKIVHKSDLGLVALNLCNPSDVGRNAERILAKAHTIDPDAKVVVESMAPQGTEVIV
FT                   GARRDPQFGPTILFGLGGIFVEVFKDVSIRVAPVDRAMAMDMIDDVKGYAILKGARGKK
FT                   GVDIEALADIIVNTSKLMMEQDRVMELDMNPVMAYENGAMAVDARALVRD"
FT   CDS_pept        complement(450240..451616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acdA"
FT                   /locus_tag="MCP_0449"
FT                   /product="acetyl-CoA synthetase alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0449"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60521"
FT                   /db_xref="GOA:D1YVP9"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR032875"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVP9"
FT                   /protein_id="BAI60521.1"
FT                   /translation="MTDSSLNPMLRPRSIAVIGVSREPSKWGYKVFHNIVSNAYKGKAY
FT                   PVNPSTPDIDGIKCYARVGDILGEVDLAIIIVPASAALQVVDECGAKKVKALCVITAGF
FT                   SEVGPDGAVLEEKLKQKAASYGMRMLGPNTMGFVNNSISLNASIVPRMPPKGEISFITQ
FT                   SGALGLSLVDWAIGSNLGMNCVVSTGNKADVSEADLLEFFEQDKGTWTIAMYIEGLKDG
FT                   RKFMEAARKVKKAKLAIKAGVSQAGARAAASHTGSLAGSDAVYDAAFRQCGVVRVEGVE
FT                   EMFDAAMALSTQPKANGNRVAILSNGGGAAIMASDACERRGMKVPELTRHTKAGIARLL
FT                   PAFASVKNPIDTVAKSDYDIYREALKMLIDDKDIDCVMVIYAHAGFTSAAEPARAVIDA
FT                   LKEKYPKPVVACWMGGREVNAVAGMFRRNRVPFYPAPERAAEALSALIRYNGFLKEAGK
FT                   "
FT   CDS_pept        complement(451658..452521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0450"
FT                   /product="putative cobalt ABC transporter ATP binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0450"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60522"
FT                   /db_xref="GOA:D1YVQ0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVQ0"
FT                   /protein_id="BAI60522.1"
FT                   /translation="MLEYDSHCACPVKRNDDIIHVDCASHIYPDGVQGIHNMCFHVHER
FT                   EIVAVCGGNGSGKSTLLEHLNGLLLPSSGRVYVMGEELTGATKNEIWRYVGLVFQRPED
FT                   QLFAPTVLDDVMFGPLNMGMSMPEARKAAVEALESVGATGMDDRLPAYLSGGQKRLVAI
FT                   AGVLAMKPRVIAMDEPTSDLDTWHSELIERIIVRLRNEFGISVVMATHDLDMVARLADR
FT                   VCILKRGAIVGEGTPRDIFYNRALVEGSGLAVPKVVEIYHDYCYHFNKEPDMRPLNVHE
FT                   LIEAMR"
FT   CDS_pept        452608..453066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0451"
FT                   /product="conserved hypothetical protein"
FT                   /note="Belongs to the Protein of unknown function DUF1284
FT                   family (IPR009702)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0451"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60523"
FT                   /db_xref="InterPro:IPR009702"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVQ1"
FT                   /protein_id="BAI60523.1"
FT                   /translation="MAHTKNIMAREAGRGKFRGIPLRAHHLLCLLGFQGIGYTADFIRN
FT                   FQKVKRMIDQHPDLQIEVVDTSDMICIACPNMQNNECFRSGLKLNQKVKDIDRRVMERL
FT                   GIKPGDRFKAAEFYALVKEKIKPGDINEICQGCEWLNLGFCPRGLANL"
FT   CDS_pept        complement(453501..454157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroD"
FT                   /locus_tag="MCP_0452"
FT                   /product="3-dehydroquinate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0452"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60524"
FT                   /db_xref="GOA:D1YVQ2"
FT                   /db_xref="InterPro:IPR001381"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVQ2"
FT                   /protein_id="BAI60524.1"
FT                   /translation="MEFPPKVVATVTSLDEAKEAISLGADIIEIRVDLLDEGPQPLVER
FT                   IYKLNKPLIITVRPTWEGGAFKGSDRDRVKIFKALVPVADYIDVELRAPNVEELVALTG
FT                   GTDALSIISYHDFEKMPSKKEMMDIVVQCHEKGDIAKLAVTPASLRDVLRLFEVTLKSK
FT                   RPLCTIAMGEMGAHSRIVGPVYGSQFTYGYVRKPVAPGQIRVDKILEGLRLLGLR"
FT   CDS_pept        complement(454168..455610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0453"
FT                   /product="dihydropteroate synthase-related protein"
FT                   /note="Belongs to the Dihydropteroate synthase-related
FT                   protein synthase-related protein family (IPR005236)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0453"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60525"
FT                   /db_xref="GOA:D1YVQ3"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR005236"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVQ3"
FT                   /protein_id="BAI60525.1"
FT                   /translation="MRILLVTGRLAYPVVKELAGDADVLMLDVGVAAFITPKLLEKAIA
FT                   PVKGDYDLVLVTGLAASDFSGLEKKLGVKIRLGPKQAYDIPLALAAAGRVEFSSKVPAD
FT                   MLLANVKRESALKELGDIEAGASCAFSLKGVKIGGTSTMKVVAEVADATKLTDVELVSK
FT                   IESYAAADVIDLGVPLESSEDAVRHAVRVARSVTRKPLSVDTLIPEYIRAGIGEGAGLV
FT                   LSLNGSNLDEVGPLVAEKGLAAVVIPNDESLDELFVNIEKARALGIKSILADPILSPVG
FT                   HGLADSLERYREFRRREPDMPLFFGAGNVTELMDADSVGINALLAGIAMELGVSALFTT
FT                   EASHKTVNCAYELKTACDMMALAKKHKGSPKDLGIDLLIIKEKRARRDMVEPGPTVIEA
FT                   KRHELKLDPAGNFNIYVKDGRIYVNNGSVTVVGDEPMTIIETLADMGLMSMLDHAGYLG
FT                   KELEKARLAIRFKRSYLQDDPF"
FT   CDS_pept        455640..456320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0454"
FT                   /product="putative phosphatase, PHP family"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0454"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60526"
FT                   /db_xref="GOA:D1YVQ4"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVQ4"
FT                   /protein_id="BAI60526.1"
FT                   /translation="MMLMLRFDLHVHSNFSKDGLSSVEDILRAAAAKGLAGLAITDHNT
FT                   TAGGRRALEIVDKVAPGLIVIPGEEVSTKQGHLIVLGITQDIPPGMTVDDTIKEARRQG
FT                   GLVVVPHPYNRPRHGMNIPEGADAVEVYNSRYILGMHNRMARRGAKARKLPEVSGSDAH
FT                   QASLVGSAITLIKAEKNPKAVLEAIKEGKTGIDVRRTPLHIYALQMANGWAKKLRAFFI
FT                   KISK"
FT   CDS_pept        456387..456836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0455"
FT                   /product="AsnC/Lrp family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0455"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60527"
FT                   /db_xref="GOA:D1YVQ5"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVQ5"
FT                   /protein_id="BAI60527.1"
FT                   /translation="MDSIDNTIIDKLSKDSRTHCTEIASELGVATSTVHKRVNQMYSEG
FT                   VIEQFTVILDPKKTGMPLTTFIGINVDENYKAEIVTKLKSLKNVLEVYEILQPYDIFVK
FT                   VRTSDMSELKDSVLRVLDNTDGVISSSSIITTIRHKEKTCILGDQ"
FT   CDS_pept        456833..457141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0456"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0456"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60528"
FT                   /db_xref="GOA:D1YVQ6"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVQ6"
FT                   /protein_id="BAI60528.1"
FT                   /translation="MMLTVSIVEAVAAFLMYILGGALVLFIYESYTRTKQKNLMYMALG
FT                   FFLIIFGSNLNTLIVMLPTMIGGSIPIDDSISRTASLLIQLSGILTLLYSALNPYAS"
FT   CDS_pept        457154..457672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0457"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0457"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60529"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVQ7"
FT                   /protein_id="BAI60529.1"
FT                   /translation="MDKYVNFAKTWKSVGVTNRLRWQQNNSLGRFNKYLLIRFIDRYGE
FT                   KALEVISETGLAVGYDDGKKIVDNLNLDSNSLRALLIPMEAISLLAGVDSDILVESSYG
FT                   PGTICLKVGDCIYATLFDGMNVGADFKTNACVSYSTGLTHAVSERSKVKVVKRRCAGDK
FT                   YCEFVVSLG"
FT   CDS_pept        457669..458436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0458"
FT                   /product="conserved hypothetical protein"
FT                   /note="Belongs to the Abortive infection protein family
FT                   (IPR003675)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0458"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60530"
FT                   /db_xref="GOA:D1YVQ8"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVQ8"
FT                   /protein_id="BAI60530.1"
FT                   /translation="MRRGLKLLAVFLFYLLNAWLVVSFSSLAGILTYPLIIILSVFFIA
FT                   VFELQVPWKGFAEGAIFAAVPMGLVLAVLLLSGAITPGPIREDFSYYLLLGVFVQLLVS
FT                   FGEELGFRAAIFQGLFDELGLWPAALLSAAGFAALHLPSMGIVGLGRQSDLIALGTIFL
FT                   AGIVLALLYRYGGLLNAIAFHFVWNFIEYNLFELGPLEGAILVSKPGPDIITGGAFGPE
FT                   ASVVTLAVTALLIVAVWLYYNKVRKPANSLSAP"
FT   CDS_pept        458936..459112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0459"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0459"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60531"
FT                   /db_xref="GOA:D1YVQ9"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVQ9"
FT                   /protein_id="BAI60531.1"
FT                   /translation="MALVWSQELMLILMVFVLALFLIAFVIALLYGLWNRRRDDRLKKI
FT                   EERLKAIEERLHK"
FT   CDS_pept        459178..459507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0460"
FT                   /product="putative sec-independent translocase protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0460"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60532"
FT                   /db_xref="GOA:D1YVR0"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVR0"
FT                   /protein_id="BAI60532.1"
FT                   /translation="MVLGLGPTEILLIFVVIVLLFGATKLPELARSMGQSMGEFKVGQI
FT                   EAEKKYENMKSQVNPPAQNADDIALTRAQRMAKNLNIDIKGKSDEQLLAEIEKKLAEQE
FT                   VGAKK"
FT   tRNA            459615..459689
FT                   /locus_tag="MCP_t0010"
FT                   /product="tRNA-Met"
FT   CDS_pept        460248..460820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0461"
FT                   /product="peroxiredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0461"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60533"
FT                   /db_xref="GOA:D1YVR1"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017559"
FT                   /db_xref="InterPro:IPR019479"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVR1"
FT                   /protein_id="BAI60533.1"
FT                   /translation="MVNKGNGQQAHGLKINERLPALEADAYYKNNITRINLSDYQGKWL
FT                   VFIFYPADFTFVCPTELEEMASLYKNFTEQGAEVFSVSRDTPYVHKAWHDSDPRINKVE
FT                   YPMLSDTTGELCKAFGTYNESNGLSQRASFIFDPDGNLKAMEIHDDGFGRNTRELLREL
FT                   EALKFVRENKGKVCPAGWKPGDEAIQP"
FT   CDS_pept        complement(460834..461721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0462"
FT                   /product="putative methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0462"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60534"
FT                   /db_xref="GOA:D1YVR2"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR026669"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVR2"
FT                   /protein_id="BAI60534.1"
FT                   /translation="MTATLNGGFPYFRTFSALPGTDISRKYNNIGNILNCRTRKMFNMV
FT                   SVKKPYYGNWVSKRLVLMPVLIGLALLVIALLFPMLVLLAIVFLLIAAYFAYARRMFSA
FT                   RGGNVQNKIYDLVLANLAWNGQGKLLDIGCGSAALTIKLAKKYPNARLTGVDFWGHNWS
FT                   YSKKICEKNAAAEGVSDRVTFQKASAMKLPFEDETFDAVVSNLTFHEVRDAKDKKELIR
FT                   EALRVLKKGGKFTFQDLFLVKKAYGTPEELVKTIKGWGISEVKFVDTHKESFIPRALRM
FT                   PFMVGPIGIITGKK"
FT   CDS_pept        461654..462454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0463"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains one Alpha/beta hydrolase fold-1 domain
FT                   (IPR000073)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0463"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60535"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVR3"
FT                   /protein_id="BAI60535.1"
FT                   /translation="MSVPGKAENVRKYGKPPFSVAVIHGGPGATGGMAPVARELSVRRG
FT                   VLEPLQTASSIDGQVAELHDVLLENAALPVTLIGHSWGAWLSLIFASTYPQHVKKLILI
FT                   GCGPLKEEYASQIMETRLSRLSDEEKDTLYSLAEALNDSHILDKSIAFAEFGKLMSKAD
FT                   SYALLPGDGPDLMMRADINARVWGEAEVLRRSGELLRIADRIRCPVVAIHGDRDPHPAV
FT                   GVKKPLMGTIKDFRFILLEKCGHEPWRERFARGLFFEILERELA"
FT   CDS_pept        complement(462446..463012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0464"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0464"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60536"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVR4"
FT                   /protein_id="BAI60536.1"
FT                   /translation="MLDITVLSDSKSRAFEQFFDAYGFSCQQMVPALFGTPYCQPSKLL
FT                   IIPSAFAVRQYYRMLPALEGCRGRIEEFVERGGIVLAYGAGIEGYKYGWLPGAPVYHHI
FT                   FKIGEQFRQSEVRLLRSACPEGLTFEPGPRNCDAYFTGFNGDVAMATGDGRAVMVHKSL
FT                   GKGHVIVSGIFDYPDEKLLKRACSR"
FT   CDS_pept        complement(463028..463558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0465"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0465"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60537"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVR5"
FT                   /protein_id="BAI60537.1"
FT                   /translation="MKLDKEPCGLRILTEIVINRSGINYDDYLLGRTCRRCKRLMLEGN
FT                   ITKIPEDSNFRIVVKTPDGMPNILKGSELLTVSCKCGATYNIIFYGPVQYNSAGIVAYT
FT                   IIQMNGAEVELSDALDDMRKHKDAPADVDRWIVETLADEFNDAVRIVNEKGVSLVEEDW
FT                   TESKYSTGWIEEE"
FT   CDS_pept        463755..464279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0466"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0466"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60538"
FT                   /db_xref="GOA:D1YVR6"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVR6"
FT                   /protein_id="BAI60538.1"
FT                   /translation="MNTDPECNFCKKNKQIYLTDHEYEHPEPTFIKRLPASVAALSYEQ
FT                   DYPGRSVVILRDHETSLTYMLEHKFLLFMAFMEDVSAVSEAIYETLDPVKINYMILMNQ
FT                   NDHFHMHLIPRYTNEGDKMHTPPVFRGTPGLVPGFDYRSLALKIRHHLPTKKSEFSVCI
FT                   EELINSGLPEK"
FT   CDS_pept        complement(464852..465121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0467"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0467"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60539"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVR7"
FT                   /protein_id="BAI60539.1"
FT                   /translation="MMLKLNIFNRRPQPQKKCYFEKDRTCDRECRAFDRDKERCTIVVR
FT                   LKEEADAGEAARMLKALCAIDSDPEMIAEAFPELVPPPRLVYED"
FT   CDS_pept        complement(465121..465993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0468"
FT                   /product="ABC transporter ATP binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0468"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60540"
FT                   /db_xref="GOA:D1YVR8"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVR8"
FT                   /protein_id="BAI60540.1"
FT                   /translation="MIKLTGVTKSYKDFEAVKDLSLEVRDGEILGIIGHNGAGKSTTLK
FT                   MMVGLISPTSGTVEVMGRDMARDGTYVKRFLGYLPEESPLYENMTVNEYLRFFSELYDM
FT                   PPAKAKERIDLLLDSLKLPERNKLTGELSKGMKRKVAIARALLHDPKLLVLDEPSSGLD
FT                   PLTSFFIVDYMRRLRNEGKTIVLSAHNLFHVEYVCDRVAIMKNGRLVVCDTMENIRKDL
FT                   GKREYEVKFMSDQRLDYDKKDGNYIYRTADVGEIASLLRNISENNWALVDMSMKESALE
FT                   DIYVKLMAE"
FT   CDS_pept        466032..467783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0469"
FT                   /product="putative ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0469"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60541"
FT                   /db_xref="GOA:D1YVR9"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVR9"
FT                   /protein_id="BAI60541.1"
FT                   /translation="MGSMSKILQVAKRELGRFRTRFSGRSQPVVLALIVISLIVSYFVA
FT                   QQGLVIGKGIYTIGISPDGPAIGDMRFNVLSLDREAGQKMLRDGSIDLYMDGETALTRS
FT                   DDRSQYAAGALRQYLENAETTLLIEQYDINRSFPLRVEVGYLYATATPAPTPTGVASIA
FT                   PTAAPSNDTGAAVKAQIEELKNGGSTRFKAEFVSENEVLIPSLMTSSVPLAQVVLAFLY
FT                   IVPVLFMGIFFNSSFMEEKTNRKLNVLMSAPLAPLDIIAGKMLPYISFSLALVIVITLA
FT                   LAGDLLLALAIFLPIILFIFAIYLMVALVYRTFKDQTFFSMAAMTFVIGYLVLPALFTG
FT                   INDVSYISPLTLAVQMYRGESFSMAQYALSTAPMYLVFGVAMFVGVRIFNEEYLLGFGP
FT                   LYRKLADAIYLAIDQNHLYVSIGFISLLMIPAVFMVQMIIAILSLMIPVSLPTMVYMAI
FT                   LLVLCVIVEEVAKSVGIATLLENKKVSSTKTLLILAACSAVGFFIGEKVLLYLSLSVVS
FT                   NIMLLEAIGSAGLLIIPLIAHFIFTSIVCLLTQKMGTKYYPLAIMAGSLVHFLYNFFIL
FT                   AQEMGMV"
FT   CDS_pept        467783..468820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0470"
FT                   /product="putative ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0470"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60542"
FT                   /db_xref="GOA:D1YVS0"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVS0"
FT                   /protein_id="BAI60542.1"
FT                   /translation="MGGFYAIMNKELVSVMKEKTIVLAILIQLLIAAFSSVILVGLMSF
FT                   YDPNSIAENTNIHFSVGVSGDSDGVFSSYLRDSNFVVSAYATEEEAKEAMRSGIIDAVI
FT                   AIPASEGVVDMQLYMPQSDTSATVFTMLIKEPLKKYENYLREKNGIHVMYTGMSGRQST
FT                   TFEFLYSFIVPLLMLFPAFIAGSMIIDSISEEVENKTLDTLLSAPVSLNAVLFGKVAAT
FT                   LFLAAVQCVLWLVLLSLNRLYVQSPLEVLLLALIITAFVTFGSGIISLYFKDRERSQFA
FT                   YSMLLLAAAGASLFFDPSPLSLMARLAMGDLHVGLSDVAIFVVPLIVLIGAFTLASRRL
FT                   IAMKA"
FT   CDS_pept        complement(468826..469635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0471"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains one Beta-lactamase-like domain
FT                   (IPR001279)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0471"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60543"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVS1"
FT                   /protein_id="BAI60543.1"
FT                   /translation="MSEIVFLGTAGGRMVVANQIRKSGGMWLDLDGNAILLDPGPGCLV
FT                   RCVELGLKPSRLDCIVLSHRHIDHSNDVNIMTEAMSGGGFKPKGMLIAPWDCLEGNDPV
FT                   VLKYVRKYIRNNVFALKEGAKYRLNGVSIEGALRLKHSDVESYAIKFRFENKTLGYIAD
FT                   TKYFDGIGEAMKDCDYLIINMVRITYDDRFQHLIPGDVEKVLKVAKPGMAILNHFGMQV
FT                   VKAHPRDIAFRIEKTTGVKTIAAEDGMRLKLDRARAEEDSTLERFIK"
FT   CDS_pept        complement(469685..470035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0472"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains one Dinitrogenase iron-molybdenum cofactor
FT                   biosynthesis domain (IPR003731)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0472"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60544"
FT                   /db_xref="InterPro:IPR003731"
FT                   /db_xref="InterPro:IPR036105"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVS2"
FT                   /protein_id="BAI60544.1"
FT                   /translation="MKICVPMKSTMVHNHFGKASEFMLLMVEESKVVSRETIKNPGREK
FT                   GAVLELMPAHGVTHVISGGMGERVKGIMRERNIVVVTGALGSIDNAVERFLKGELKPVE
FT                   APCCGENLCGKK"
FT   CDS_pept        complement(470085..470402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0473"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0473"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60545"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVS3"
FT                   /protein_id="BAI60545.1"
FT                   /translation="MNRIILNIVDKKTEFSRRIVIETSIPLQSCDFITIGEDIMFDRDT
FT                   DFFTFGFDIDTGSRQLAIVTGEFIPLPPAELIDSIKKSLEGRYEVVSDEDAQLWLREKA
FT                   P"
FT   CDS_pept        470491..470889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0474"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains one Pyridoxamine 5'-phosphate
FT                   oxidase-related, FMN-binding core domain (IPR011576)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0474"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60546"
FT                   /db_xref="GOA:D1YVS4"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVS4"
FT                   /protein_id="BAI60546.1"
FT                   /translation="MVKLTQEVKDSMQGVKTIFLATCSRAGVPNVVPMGAYKVLDDETM
FT                   LLSDQFMQKSLSNMQENPRVALTYWSEKGGFQIKGTVTLHKDDQVFKDDVAWVKGMKPT
FT                   LNPKTAIVMKITDVYVVKPGPDAGKKLL"
FT   CDS_pept        complement(470886..471563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0475"
FT                   /product="putative response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0475"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60547"
FT                   /db_xref="GOA:D1YVS5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR040541"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVS5"
FT                   /protein_id="BAI60547.1"
FT                   /translation="MARTSRKLILITDDEPDVADVIAEKLESIGYRTLKAHSGAECIEM
FT                   ARKSHPDLLFLDIRMEPMNGWEVADAMKNDGNLRDIPVIMVTGVELTLRDIMDRAHLIE
FT                   NYIMKSDASLDKLREAVEDVLTAKTDVERIMGMAGKSGVQKEMLTELKDRYLRKFTQYR
FT                   SLKKKYSLYSQMYGENGGEQSTAMLSSLKKGLEQQAEDLSHIEKMLMATQPVKRAKRPK
FT                   KKI"
FT   CDS_pept        complement(471741..472124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0476"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0476"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60548"
FT                   /db_xref="GOA:D1YVS6"
FT                   /db_xref="InterPro:IPR010279"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVS6"
FT                   /protein_id="BAI60548.1"
FT                   /translation="MIFAPHMAVQAWWFAMVEYSAKKDELASSMEQSAARLEDTGARTA
FT                   GKVAGSMRNLADDIRSFNINEYRDKMMSKVDTARTEVDKNVDNVKMNIRDHPFESVALA
FT                   AGAGILLGAMIALMGRRSVRSRM"
FT   CDS_pept        complement(472247..472684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="echF"
FT                   /locus_tag="MCP_0477"
FT                   /product="Ech hydrogenase subunit F"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0477"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60549"
FT                   /db_xref="GOA:D1YVS7"
FT                   /db_xref="InterPro:IPR010226"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVS7"
FT                   /protein_id="BAI60549.1"
FT                   /translation="MLKILENIFKNITSKPYTSNYPFTPYQHFPGTRADVTFDGTKCIL
FT                   CQLCQRSCPAECIIIHKEETTVEYLNTQCIRCGYCVRVCPTNAISQNEVYTKPSKERLT
FT                   VYTLVTNENAPIIKKRKAEAAKKAATAEGKPVTDKPEEAKK"
FT   CDS_pept        complement(472690..473772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="echE"
FT                   /locus_tag="MCP_0478"
FT                   /product="Ech hydrogenase subunit E"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0478"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60550"
FT                   /db_xref="GOA:D1YVS8"
FT                   /db_xref="InterPro:IPR001135"
FT                   /db_xref="InterPro:IPR001501"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="InterPro:IPR038290"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVS8"
FT                   /protein_id="BAI60550.1"
FT                   /translation="MRTTIQFGPQHPVWIEPLRLKLTTDGELIKDVDLEAGYVHRGLEK
FT                   KFEWDYNKAAYLSERVCAICTQHHSTCFCLGVEGTMAGLELPRRAAIIRTIMLELERLH
FT                   SHFLAIGLTLEAIGFENMFMLCFRHREQVLDVFERTTGNRVLHGINIVGGVTRNIGPEM
FT                   AKEILDFCDDIEKRAHEIERIIVSSYTIKQRMQGVGVMTEKMAKELGVVGPVARGSNVP
FT                   YDVRHAAPHLLYREVKVTPIVEKDGDCWARSLVRVRELFQSIDLIRQLVPLLDGTPDEL
FT                   FAKSKAMPEGENIARVEAPRGELFYYVRGKKSKELDRVKVRTSTYGNGLGIAPLIKGSH
FT                   IADVGLITITFDPCIGCFDR"
FT   CDS_pept        complement(473774..474109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="echD"
FT                   /locus_tag="MCP_0479"
FT                   /product="Ech hydrogenase subunit D"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0479"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60551"
FT                   /db_xref="GOA:D1YVS9"
FT                   /db_xref="InterPro:IPR001268"
FT                   /db_xref="InterPro:IPR037232"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVS9"
FT                   /protein_id="BAI60551.1"
FT                   /translation="MEAKTVTQAELQGIVNGLKAKDARLITIVGADTGENIEVIYFFHT
FT                   GIGQTENYRIIVPKAGGNEEIESITPIIPAAYIAENELCEMFGVRVKGVPGRFFLHPSV
FT                   NAPLRRK"
FT   CDS_pept        complement(474110..474580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="echC"
FT                   /locus_tag="MCP_0480"
FT                   /product="Ech hydrogenase subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0480"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60552"
FT                   /db_xref="GOA:D1YVT0"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVT0"
FT                   /protein_id="BAI60552.1"
FT                   /translation="MSLTEISRKKSPWVIHVGTGGCNGCDLEILACLTPRYDVSRFGVM
FT                   STGNPKHADVMLVVGPVTIKYKEIIKNLYDQMPDPKVVISVGTCASTGGIYQGCYGHCG
FT                   GVDKVVPVDVYVPGCNVRPEAVIDGLVLALDILNEKERKILEEKKAKAKGAA"
FT   CDS_pept        complement(474577..475476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="echB"
FT                   /locus_tag="MCP_0481"
FT                   /product="Ech hydrogenase subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0481"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60553"
FT                   /db_xref="GOA:D1YVT1"
FT                   /db_xref="InterPro:IPR001694"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVT1"
FT                   /protein_id="BAI60553.1"
FT                   /translation="MADNILITYGVPLLLLILSPIIGGLLIGIDRKVTARIQNRSGPPI
FT                   VQPFYDTFKLFGKEDKIVNKTYLVFGAAYLLTVILSLALLLFQYDLLITTFIFGLSFIF
FT                   LVLAGYSTRSQFGNVGATRELMQMLTYEPILLFAVFLIRLVTGSFEIESIYSAAQPLLY
FT                   TLPLALLAIFIILPIKARKSPFDIAEAHQEIAQGPETEYSGKYLGLLLTAHFFEMFFIL
FT                   WFVSLFFVKDVALGGLVIPGVIMQVLMMLVAYVFLIVVDNATARLRVDQMLKQVFIVGM
FT                   VLLIINLIYIIVTGRWIA"
FT   CDS_pept        complement(475478..477379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="echA"
FT                   /locus_tag="MCP_0482"
FT                   /product="Ech hydrogenase subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0482"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60554"
FT                   /db_xref="GOA:D1YVT2"
FT                   /db_xref="InterPro:IPR001516"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVT2"
FT                   /protein_id="BAI60554.1"
FT                   /translation="MDGSLLLLLMTIVPALFGIVCYLIPGFELKKYVVILCALVLMVAS
FT                   LLVLTGGAQTLSVESIGLGGLSMPLSPVILVLDYLLLLTFLYFGIKDKEYKAVLLAILQ
FT                   LIPLTYLEFFMPKAEHAAGITFVMDNLAIVMCLIVSIIGSLILIYSVGYMKGDRRASPF
FT                   FLIMMVFLGDMNALVFANDLTWMFFFWEVTTLCSFLLIRHYHDEASIKASDRALWMNLL
FT                   GGVSLICGIVLIESSYGTMFLSELSGMKATLPGFLSFLPASAALLPFAFMAFGAFTKSA
FT                   LMPFNSWLTGAMVAPTPVSALLHSSTMVNAGVYLLIRIAPLIVGSFLSTLIAVIGGFSF
FT                   MFCALLALSQTDTKRILAYSTISYLGLIAMCTGINTGLALTAAVALLMFHAVSKGLLFL
FT                   CVGEVQHETGARDIESMEGLVNRMPLVAYIMVIGLISLMAPPFGVFVGKWLAFQSVSTF
FT                   TTISLSLLDIFFIIFGSIFSVFYYARWAGKLLATKPFEAPKKEHHDWFMELPLIVLVLG
FT                   VFVTVALSTLFFSSLITLPSVYGSGPIEIGWSIQSAIGGFSPLGFLILFLIILLVPLVA
FT                   IRVPKTAVTHTYACGTGEEPEIGGGYFQSIIGESVVLKYLDPVGVLLLVALFIAAVI"
FT   CDS_pept        477515..478174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0483"
FT                   /product="phosphoglycolate phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0483"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60555"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVT3"
FT                   /protein_id="BAI60555.1"
FT                   /translation="MAIKLVISDFDRTFTDESLSVGPELREAIRIIQAKGIGFSIVSGR
FT                   NYDFLLEFCRELDGLVDSFVAENGCLGFFRGKKYLLGDSRLRGELLRRLERLSVPYGQG
FT                   EVIVAVDVQQEKGLVEALNGMGGAFHIIRNVDSLMILPAGISKSSGAGWLSGMYGVSRD
FT                   ETAAIGDAQNDVAFKDSCVLLGAVSNAIPEMKAAADYVCRQGYGRGLQEFIEFIGR"
FT   CDS_pept        478219..479979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0484"
FT                   /product="putative glycoside hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0484"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60556"
FT                   /db_xref="GOA:D1YVT4"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR011613"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVT4"
FT                   /protein_id="BAI60556.1"
FT                   /translation="MYGVVGNGETCAFISIFSSLDWLCLPRFDSPTMFARALDSVNGGS
FT                   ITLSREQAGTSTPFERGEQRYLEDTNLLETTSLVGADTARAIDFMPFGKHKLWRILGVS
FT                   GPDNFKLVLDVDPRPDYNRSKPTINILDNGLMICSPGQALMITCSEKAVVKKKSITFDV
FT                   QPPMTIPLLLTYGSTPEEARKAAASSNYEREYQADLKLWRNYTACAFPVFDLSPRMHYY
FT                   YMRSLLVLKLLMYDRSGAILAAPTTSFPEIVGEDKNWDYRFCWVRDGAYSAEALALAGL
FT                   FGDSRQIIDFLLSIVQPEGKPYPYPLVSIYGDLTGTEEEEVDTLAGFGNSRPVRIGNKA
FT                   VDQKQNDLEGEVIHAIYTLNKYSGCAGYVEENFLAIERIVEHVAGHWREKDAGIWEFRR
FT                   QYMDYVHSKTMCWAALEYGARLATLVDRRHLASKWGLEAEKVKVDIVKNGWSEKRKCFK
FT                   RAYEDDAYDASVLAIPLMNMLPMEDPMVRMTIKSITDNLGTGGLLKRFAEEPNAFMLSS
FT                   LWLAQVLMKRGKTVNALDIINRAARYASSDLGLFAEEYDMYYQRLVGNIPQSFSHEEFV
FT                   KSINYLLGKE"
FT   CDS_pept        complement(480003..481307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0485"
FT                   /product="putative glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0485"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60557"
FT                   /db_xref="GOA:D1YVT5"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVT5"
FT                   /protein_id="BAI60557.1"
FT                   /translation="MKICVVSQSFYPYIGGVTRYLQSLGRKLTARGDEMVVVHLRSSDM
FT                   PEYEVVDGVRVYRMSGDEGMQESIDGYFKFKELIIDVTHGRKVSSLEDRFSNGYTEYLG
FT                   FNLNMYEKVRQVYDIEKFDVLHVHDFQVMPLAFLIKSDIGVPAIFTWHIPFTRDTPAEW
FT                   REFLVRYMRYYDRVIFSTDEYVRTAVESGMNPDKVSKINPFIDTDEYVTDGENDFREKY
FT                   NIPGGDDLVLCVSRIDPRKGQEYLIKAMAVVIKKHPDTTCIFIGNGSLTKKFIGRTNRL
FT                   EELEAMVQELGLGGKVRFLGKVSQEDLMKAYDACDMLVQPSINEGFGLVISEAMCFGKP
FT                   VVGSNVGGIPEQIIDGFNGLLFQPKDHKALARQICRMIEDPAMRKLMGERGRQIACERF
FT                   CVDRGFREHCDIYDNICLGKGFEEPSGAGESLLTG"
FT   CDS_pept        complement(481570..482865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="asnS"
FT                   /locus_tag="MCP_0486"
FT                   /product="asparaginyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0486"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60558"
FT                   /db_xref="GOA:D1YVT6"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004522"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVT6"
FT                   /protein_id="BAI60558.1"
FT                   /translation="MYARIKDVLSGRFADGEEVEVGGWVVKNRSSGKIVFTLIRDATGE
FT                   MQVTARKGNVCDEALKVADALSLECSIIVKGKVRSDPRAPGGKELSATDLKLIGASRDY
FT                   PIFGEEEHNPEVLLDLRHLDVRSKQLVAIMKVKDSVLSAAREWFRNHEFFEVTPPIIIS
FT                   SACEGGSTLFELKYFEDKAYLSQSAQLYLESLIFGLEKVYSITPSFRAEKSRTTRHLAE
FT                   YWHIEGEMAWMGLYEMIDMLEQLVCYVCNRVGEERAEEIRLVGGDPEYFKGLKAPFPRI
FT                   TYDEAVKVLQADGFEFKPGEDFGTHEERQLSTHYDKPLFITEYPAEVKAFYMKDAGNGK
FT                   VLNVDMIAPKGFGEIIGASERETDLAILEERIRKQGEDPAKYAWYLDLRRYGSVPHSGF
FT                   GMGTERLVRWICGLEHIRDTIPYPRTISRSYP"
FT   CDS_pept        483053..484387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0487"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains at least two Regulator of chromosome
FT                   condensation, RCC1 repeats (IPR000408)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0487"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60559"
FT                   /db_xref="GOA:D1YVT7"
FT                   /db_xref="InterPro:IPR000408"
FT                   /db_xref="InterPro:IPR009091"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVT7"
FT                   /protein_id="BAI60559.1"
FT                   /translation="MRGFRLILLILICSFSLVLIMPCVTAWSPAVVSIAASNSTSVALL
FT                   DDGTVWQWGYVSDGVEYATPQKVEISVVRKIAAGYGHVLALKGDGTVWAWGSNKYGQLG
FT                   DGTYNDSAGPVQVAGLTGVKAIAAGKDISLALKGDGTVWAWGSNSYGQVGEGSLNYKGT
FT                   AVPIQVKGLNNIQAISAGGSHCLASQGDGAVWAWGDNRHGVLGDGTNESRFTPVRSKIY
FT                   NVMGLDAGDAHALAVMVDGNVWSWGYNYNGQLGMGGTSLNDLGRLSFGPEADSFNPDIV
FT                   RGLSGVKSVAVGASHSVALADNGTVWTWGSNSDGQLGVGKTGGSDMTVPVRVSGINGIT
FT                   AVDAGLYHTLALKDDGSVWAWGSNAEGQVGNRSASAGSPALVLMQTQILPSPTSTPIIV
FT                   TASPTTPESGPNYMLIGSIALLAVIVIVVVTACVLLLRSRKKGSG"
FT   CDS_pept        complement(484829..485848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0488"
FT                   /product="putative small-conductance mechanosensitive
FT                   channel"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0488"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60560"
FT                   /db_xref="GOA:D1YVT8"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVT8"
FT                   /protein_id="BAI60560.1"
FT                   /translation="MAEALTAAIVLAIFLALSWIVRRFITDIAPRLVSKTRSSIDDELL
FT                   KAIRTPVQVLIIVAGVYFACNTLNGLSPGIVGAIDKLAAIALILVGAYLVSNIISAFIR
FT                   WYVADVAPKTGSDLDDHLLPFLQKVVVVLVYVIAGIMVLDLFIEVTPLIASLGVVGIAV
FT                   AFAAKAMLMNIFGAMAILTDRPFKIGDRLYLDGIGATDVEDVGLWSTRVRTMDGRIVVV
FT                   PNEKMASSHIVNISQPEVKLRVQLKVRISYASDAEKACAILESIASGTPGVSADPKPRA
FT                   YLSELGDFAVTIMLLAYVDNYDNDLSVSDSIYRNALATFKKEGIVIPYPTVNVRPRVR"
FT   CDS_pept        complement(485984..487177)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0489"
FT                   /product="putative aspartate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0489"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60561"
FT                   /db_xref="GOA:D1YVT9"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVT9"
FT                   /protein_id="BAI60561.1"
FT                   /translation="MKIAKKVIELPPSGIRKYFDIASTIKDVISLGVGEPDFITPWRVR
FT                   EASIYGMEKGKTTYTSNWGLLELRELISKYTFEGSGGDYSPNNEILVTTGVSEGIDLAI
FT                   RAITDPGDEILVVEPSYVSYKPCVIMAGGVPVPVSTRAENDFKVRREDIEKRITRKTTA
FT                   IIMNYPNNPTGAIMTRKDLEEVADVAIEHDLMVLTDEVYEKLTYDGRHASIASLNGMRD
FT                   NTILLNGFSKAFAMTGWRLGYACGNADVIEAMMKIHQYTMLCAPIGAQLGAIEALKNGQ
FT                   SDMQDMVREYNRRRRVIVRGFNALGMDCFEPKGAFYSFPSIRSTGLSSEEFSERLLYDQ
FT                   GVVTVPGSVFGESGIGHLRCSYCSSMEDIKEALARIGRFLDTLKTEKAPTIKKRVKR"
FT   CDS_pept        complement(487174..487695)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0490"
FT                   /product="AsnC/Lrp family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0490"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60562"
FT                   /db_xref="GOA:D1YVU0"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVU0"
FT                   /protein_id="BAI60562.1"
FT                   /translation="MATSKVRKGSSDESMREVLELLENDSRLTAREIAEQTGLKEKDVQ
FT                   RFIKEMEARGIIRHYKTLIDWEKYGDDSVYAIIEVQLNPERNVGYDAVAERISKFPEVV
FT                   TCMLVSGDHDLHLVIKGKTMKEVAFFVAEKIAPLSQVTHTATHFMLRSYKREGEIMFEK
FT                   EEDSRLVIHP"
FT   CDS_pept        complement(487824..488036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0491"
FT                   /product="archaeal histone"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0491"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60563"
FT                   /db_xref="GOA:D1YVU1"
FT                   /db_xref="InterPro:IPR003958"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVU1"
FT                   /protein_id="BAI60563.1"
FT                   /translation="MTEISKAPIARLLSQAGGDRISAEAVDEMVKYTEDYVLKVGTEAS
FT                   KLCIHAGRKTIKADDIKLAVERLRL"
FT   CDS_pept        complement(488852..489409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0492"
FT                   /product="putative transcriptional regulator"
FT                   /note="Contains an extra Cystathionine-beta-synthase domain
FT                   (IPR000644) in the C-terminal region."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0492"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60564"
FT                   /db_xref="GOA:D1YVU2"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR017158"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVU2"
FT                   /protein_id="BAI60564.1"
FT                   /translation="MELPTPESIKKKRVKLGLTQSELAARAHVSQPLIARIESGDVDPR
FT                   LSTVKSIITALDDMEKSRITAKDLMTAPVISLSPDESVDQAVKIMEKYGFSQVPVLENG
FT                   VPIGSISESALVQAMGSRDIQRISNARVRELMEDSFPAVAPGTDMGTISALLEANHAVL
FT                   VMEMGKVVGVITKYNIMRLLNK"
FT   CDS_pept        489565..491103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0493"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0493"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60565"
FT                   /db_xref="GOA:D1YVU3"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVU3"
FT                   /protein_id="BAI60565.1"
FT                   /translation="MVFAIIQGVRAVKLSGQNAILPATAALLILLYLMPVAAAQSTTGL
FT                   SLSNSSDSDGRAIYVEGYITGGDEVHDKTTYPIPGAIIYFIKDQQVVNQTKSNAIGYYN
FT                   VVITSGTYSVVTAAAGFQTLMDEQEFKGTRTLNRQLKKVPYAGIVPYAVNPVLETSPGR
FT                   EAACTICVENSQLQDQYVSFGLQTPEVDGKNWAGWCPEGQMLGIRSGSQREITFMFQYN
FT                   GDQRGAYVWYVLVTGGSFYAKIPVVVVVKDMPYESLDLYSNYPSRTVKAGDTARFVFSV
FT                   NNGYARDKPLTLEIQKPDGWGATTGNGTLYYAARAEVASSDFWVYVPQDTPPGPYTVNL
FT                   TLKGQDVSSNMLTLYLQVEGTPAYEAVIKGYKASAQGYPSINLTDGDAFDIPVRVYNDG
FT                   EFPIDIMVTAEVGENWAYYMSGAPWDKITVEPGSGSDLIIRSRVPNGTTGNYTAKIYLD
FT                   GGGQTKTLMALLNVTSSESPPIKSDALGGLLLAGGTAGVITVSLLATARKRRRY"
FT   CDS_pept        491266..491655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0494"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0494"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60566"
FT                   /db_xref="InterPro:IPR026350"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVU4"
FT                   /protein_id="BAI60566.1"
FT                   /translation="MEPIPEEIEKIVTQIIDAAYNVHAYTGNGLLESAYEACMLIELEK
FT                   KGLTVENQILLPIIYDGHIIPNAYRLDILVNKCVIVEIKVVEDILPVHISQVLTYLRFT
FT                   DLRIGLIINFNKKYFGDAVRRVKRK"
FT   CDS_pept        complement(491764..492264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0495"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0495"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60567"
FT                   /db_xref="InterPro:IPR009183"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVU5"
FT                   /protein_id="BAI60567.1"
FT                   /translation="MYKVVETTKGLSPLLKTFKAQMAALGMQRAHKIVFLGSAGTCVPF
FT                   IELFAYTIRNDHVEMFLVPDAILEETRSVWHVPGIGMQAGGAADPHGADFVIVLGGLSM
FT                   PGSKVDAAGTAERIKAILKPGGKVMGICFMSMFEKAGWYGKVPFDVVIDANIDPIQVQK
FT                   FEP"
FT   CDS_pept        complement(492265..493245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrpR-2"
FT                   /locus_tag="MCP_0496"
FT                   /product="NrpR transcriptional repressor"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0496"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60568"
FT                   /db_xref="InterPro:IPR002846"
FT                   /db_xref="InterPro:IPR013668"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036984"
FT                   /db_xref="InterPro:IPR038982"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVU6"
FT                   /protein_id="BAI60568.1"
FT                   /translation="MPDAETQRKLIEILRILSESNGEVGARKIAEELNRRGYNLGERAT
FT                   RYHLRMLDERGFTKKHGYLGRVITPLGEEEMKHALVTDRLGFVSTRIEEYEFKTTFDPA
FT                   TDTGEAVVNICYINKSDLDRSIDTLKRVVEAGYAISPRLKVVDEGQEILENDVPEGQVA
FT                   LATFCSITIDGVLLKRGIPVNLKYGGLIRVKDHNAERFTEVIDYHGTSINPMNVFVSRK
FT                   MTSVLKVLETGSGYVLANIREIPVNARENARQIISQLESADIHGIFSGCENMRPLLGVP
FT                   IETGKCGIASYSGINPFAALTEMGIKTRIIPLSAVMNVNELKRLD"
FT   CDS_pept        complement(493318..494955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrG"
FT                   /locus_tag="MCP_0497"
FT                   /product="CTP synthase"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0497"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60569"
FT                   /db_xref="GOA:D1YVU7"
FT                   /db_xref="InterPro:IPR004468"
FT                   /db_xref="InterPro:IPR017456"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033828"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVU7"
FT                   /protein_id="BAI60569.1"
FT                   /translation="MKYVVVTGGVMSGLGKGITAASTGRILKNKGYKVTAIKIDPYINI
FT                   DAGTMSPFQHGEVYVLKDGGEADIDLGHYERFMDINLTSEHNITTGKIYKTVIEKERRG
FT                   DYLGKTVQIIPHITNEIKERIRHIAKKSGADICLVEVGGTVGDIESMPFLEAVRQMRAE
FT                   EAEEDLTLIHVTLVPIDTMDEQKTKPTQHSVKELRELGIQPDIIVARCKKPLARSTKQK
FT                   IALFTDVREEAVISCHDSDDIYKVPIQLEHEGMPNVLMRHMNLPPLDDSKSWNEMVGRL
FT                   VAADKSLTVAILSKYGIEDVYLSVKEALKHAGIATGAKIKIKWVESEELEKADDLSKFF
FT                   TDVDGILVPGGFGTRGIEGNIKGIQYAREHNIPYLGLCLGFQLATIEFTRNVVGYKDAT
FT                   SSEFSTTGTHVIDFLPEQKDVKNMGGTMRLGEHKLWIKDNTLAHRLYGATKISERHRHR
FT                   YEVNPDLIDEIESHGLVYSAKNDNRMEILELPSHRFFMGTQFHPEFKSRPERPSPPFLG
FT                   FVQAMLDAKKPEAGKIVARNSREPLTSN"
FT   CDS_pept        complement(495020..495625)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tmk"
FT                   /locus_tag="MCP_0498"
FT                   /product="probable thymidylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0498"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60570"
FT                   /db_xref="GOA:D1YVU8"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR018095"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVU8"
FT                   /protein_id="BAI60570.1"
FT                   /translation="MTRKGRLITIEGIDGTGKTTQVQLLKEWLERHGVEAVALKEPTQG
FT                   KYGQEIARRAHAGSFGPRDELRLFMEDRREDVEKNIRPALESGKSVIMDRYYLSNMAYQ
FT                   GARGLDPERIRLENEAFSPVPDLIIILDLAPEKSMARVNTRKNVVGHFENEAYLEKVRK
FT                   IFLAIGKQPNAVVINTEAPVADVHERIVDAVRDRLRLQ"
FT   CDS_pept        495725..496096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0499"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0499"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60571"
FT                   /db_xref="GOA:D1YVU9"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVU9"
FT                   /protein_id="BAI60571.1"
FT                   /translation="MPVSLSLRAAGILSVAVVLAASALYMPETVPADPYQATMRLSAGI
FT                   LLAWGSLSLSRSIGRTLLGNGGNGAFKALYCSGFVSAGAGLSGAASAFYAMNLPLAASL
FT                   AAASFSGAGLMLLQFQKGG"
FT   CDS_pept        496101..496364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0500"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60572"
FT                   /db_xref="GOA:D1YVV0"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVV0"
FT                   /protein_id="BAI60572.1"
FT                   /translation="MDITILYIVAGAACIVISLLVYRSLRAPFFLYLSAALLMACAFII
FT                   TCIVAPEVRALSDLSLALSGASMGAASLQLSYSFGLAGGHRD"
FT   CDS_pept        496357..496737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0501"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0501"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60573"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVV1"
FT                   /protein_id="BAI60573.1"
FT                   /translation="MIKQLVDTVRGADGYAGMAVYRGDGMLFSEGLEPAYTDMIKALFE
FT                   EIGGHFSARGVSLVIRGYTVRAFLAEDKLVICRSEGRFMAMPVLRDREPEYAAGQAPPG
FT                   LITKEEARKEAAAMLKLLMSSG"
FT   CDS_pept        496798..497295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0502"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0502"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60574"
FT                   /db_xref="InterPro:IPR002831"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVV2"
FT                   /protein_id="BAI60574.1"
FT                   /translation="MAKSYSDIIQEREAILGTFEALFKARGLGALHGRVFGAILLAVDP
FT                   VTQDEISEFTGYSVPAVSSALEELVRVGLVARQKRQESRKNYYSSRANLDEIMRMVLKT
FT                   IHDDYVLVVLNRLQYSKADAEGTQDPKLSEHVEFIENYEARLRDLESYMNRLLDVPLEE
FT                   KK"
FT   CDS_pept        497292..497471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0503"
FT                   /product="ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0503"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60575"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVV3"
FT                   /protein_id="BAI60575.1"
FT                   /translation="MITVNRYRCGYCGACVSVCPRDALDLVETYIEVDDKCSNCGICTK
FT                   VCPMGALELVEDEE"
FT   CDS_pept        497461..498639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0504"
FT                   /product="geranylgeranyl reductase"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0504"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60576"
FT                   /db_xref="GOA:D1YVV4"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR011777"
FT                   /db_xref="InterPro:IPR023590"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVV4"
FT                   /protein_id="BAI60576.1"
FT                   /translation="MKSNYDVIVVGAGPAGSIAARTAAEQGLDVLLIEKRQEIGDPVRC
FT                   AEGTGKMGLSQFIEPDPRWICAEVTGARIFAPDGTCIELNEKLAGKEVGYVLERKIFDR
FT                   AVAKTAARAGAEVQVKTQATSLIKENGVVCGIKGKHRGEDFEARAKVVVGADGIESKVG
FT                   KWAGINTTLKPKDIETCAQFLVTDIDIRADSCDFYMGNLRAPGGYVWIFPKGKREANVG
FT                   LGMLGSRFTGKHPIDYLHEFMAWKFPEGKIIETVVGAVPASGMLKQLSTSGLVLVGDAG
FT                   RVSDPITGGGIYNGMVSGRIAGNVLADAIKANDLSVKKLQRYDREVREALGKQLDRNYK
FT                   AKEFVVKAEDSLMNSVARSLHGVNFEEMSVPKLLKEIITRNPSMFLELAGLF"
FT   CDS_pept        498784..499149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0505"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0505"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60577"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVV5"
FT                   /protein_id="BAI60577.1"
FT                   /translation="MKLNDIVASMSGYLSEQTIVDFIMYSKAFDDTRYSVLKTKAVDKV
FT                   SIALLAAAKNSELFYDVVQWGEDTGVASKATFSRRKDFLVNLNVLFEESVKTPFGRPKI
FT                   RLKLNDCKLKECFGIPA"
FT   CDS_pept        complement(499214..499681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0506"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0506"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60578"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVV6"
FT                   /protein_id="BAI60578.1"
FT                   /translation="MNGEFALGPDEILFLFDGDNTVGIVKAGHLKRVFIETEDEELVQF
FT                   LGPEDLIAASCFEGGEKAREMVRSMLFLVREGGTPLLVLRKSHPATQRLKLVVSAGDRI
FT                   VLSGCIVPGTHPEQDVLCGKGAMDGIVLEAGEGRVLARGGGSPHAEKGRFL"
FT   CDS_pept        complement(499678..499833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0507"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0507"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60579"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVV7"
FT                   /protein_id="BAI60579.1"
FT                   /translation="MCTTGGMPADIEISEVKFKRYKCKDCDNKFKGAGKRPVCPSCGGE
FT                   DVELIE"
FT   CDS_pept        complement(499857..500438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0508"
FT                   /product="putative fumarate hydratase class I beta subunit"
FT                   /note="Similar to L(+)-tartrate dehydratase subunit beta
FT                   TtdB in Escherichia coli. (P0AC35)"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0508"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60580"
FT                   /db_xref="GOA:D1YVV8"
FT                   /db_xref="InterPro:IPR004647"
FT                   /db_xref="InterPro:IPR036660"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVV8"
FT                   /protein_id="BAI60580.1"
FT                   /translation="MEYHLTTPLSKEPLKALRAGDVVYITGEFITARDKAHARMAEYFK
FT                   GHRQLPFKLEGAAIFHGAPIVKKEGEEWKIVAIGPTTSARMNDLEPAVIGHGAAAIIGK
FT                   GGMGPDVLAALRDNGAVYLSMTGGTAVLGARMVKKVLGLIWEDLGMSEAVWLLEVENFG
FT                   PLTVTMDAHMGDLYEAVRRRASENIKDMRL"
FT   CDS_pept        complement(500439..501311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0509"
FT                   /product="putative fumarate hydratase class I alpha
FT                   subunit"
FT                   /note="Similar to L(+)-tartrate dehydratase subunit alpha
FT                   TtdB in Escherichia coli. (P05847)"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0509"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60581"
FT                   /db_xref="GOA:D1YVV9"
FT                   /db_xref="InterPro:IPR004646"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVV9"
FT                   /protein_id="BAI60581.1"
FT                   /translation="MSSYMEDRLIEETAIALLRRSVAVLPPDVLAALEGSLLLERDPTA
FT                   KRELERIIANVKEAGACTLPMCQDTGLPVFFAKMGFAVPGFEEAVARGVRRATEEIPLR
FT                   KNAVHPITRRNTGDNTGKGMPYIYYSFEASDHIDLTVMPKGGGSENMSALAMLNPSAGI
FT                   AGIKRFVLETVVNAGSKPCPPVIVGVGIGGTADECMALAKKAVLRPVGSRSPEPEVARL
FT                   EMELLYAINRTGIGPMGLGGDTTALAVHIEYAYCHTASLPVAVSFQCYAARRAHARIYK
FT                   DGSVEMGGE"
FT   CDS_pept        501379..502431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0510"
FT                   /product="conserved hypothetical protein"
FT                   /note="Belongs to the Protein of unknown function UPF0118
FT                   family (IPR002549)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0510"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60582"
FT                   /db_xref="GOA:D1YVW0"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVW0"
FT                   /protein_id="BAI60582.1"
FT                   /translation="MSLTVGGLLDELNKNRFLLAAILLAAVVALLSAYYVLPLADGIIF
FT                   GVFFFFVTRPIKIFLDRYTKYSPYIATFCILLPLIAIIAYGVVSVLGEAEWVFQHSGEL
FT                   GDMIIGTIEGLGLPFDVNAGLDTGLKGLYDYTITFLKSLPIGRTFSGIISLAMNALVSL
FT                   FVCFYLLKDGGSFTAIVREVVPARHKPALDMFLTEADRILSGIFTGTFYTALYIAVGAL
FT                   VLFVIFGIPYKALLTAFVFIAAMVPILSGMMVFIPVAIYLYMFRSPIIGLLFLGLAVVF
FT                   IYLPPDYVIRPYIINRASNLHPLLIILAFIGGGVAGGLSGFFAAPMAIGLATALYRTYK
FT                   KTKGNDEDIH"
FT   CDS_pept        502415..503635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0511"
FT                   /product="putative 2-methylthioadenine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0511"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60583"
FT                   /db_xref="GOA:D1YVW1"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR006466"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVW1"
FT                   /protein_id="BAI60583.1"
FT                   /translation="MKIYIETHGCTANASDSQAIRNSVLASGGEVVGTPEEADTVVVNT
FT                   CAVTEFTSKSMLKAIKKYSGKRVVVAGCMAAAQPYLLKGIRNIQIAEAPGAEAVARMLG
FT                   IMPAAGRPFIKGTSAVVSIAEGCRGHCSYCIVRLVRGPLRSAPVEEVVHSIKTALRMGA
FT                   REILLTAQDTGAYGLDAGERLPALMKEILSIEGDYRIRLGMMNPFSIADILGDMARIFN
FT                   DPRVYRFAHIPVQSGSDRILGLMERPYTESQYRDIVARLRQEVPGITLSTDYIVGFPTE
FT                   TDEDFALTMDDLRSTRPLKVNITRFSPRPGTPAACMENLPFRIKKERSRALTQLHHGIT
FT                   SEYMRDSAGRRLSVLVTEEGKPGTSVARDDCYHMVVIPEEISPGTRLDVKICGASTTYM
FT                   VGKPIDK"
FT   CDS_pept        504344..505675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mcrB"
FT                   /locus_tag="MCP_0512"
FT                   /product="methyl-coenzyme M reductase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0512"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60584"
FT                   /db_xref="GOA:D1YVW2"
FT                   /db_xref="InterPro:IPR003179"
FT                   /db_xref="InterPro:IPR008924"
FT                   /db_xref="InterPro:IPR009024"
FT                   /db_xref="InterPro:IPR015823"
FT                   /db_xref="InterPro:IPR022679"
FT                   /db_xref="InterPro:IPR022680"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVW2"
FT                   /protein_id="BAI60584.1"
FT                   /translation="MPKFKDKIDLYDDKGKLLEKDVPLEAISPVINPAIRKIVNLTKRT
FT                   VAVSLEGIESALKTGKVGGKGRQVLGRSLDLSIVKDADKIAKVVADTVRINKSDDTAVK
FT                   VIGGGKSLLVQVPTQRVEAGAEFVASLSCTASAVTEAIIDMYKVDMFDGPFVKNAVWGM
FT                   YPQTMDLVGGNVKMILEIPQKDEGVGYALRNILTNHCVVIAKRNTMNVAALSSIFEQAG
FT                   VCEMGDAVGPWERYQLLGFAYQGLNANNLVYSTVKENGKNGTIGSVVASVIGKAIEDKV
FT                   IKVEKTLPSGYKLYTTDDIPLWNAYTAAATMAATMVNCGALRGAQAVSSTLLYTNDLIE
FT                   RETGLPGCDFGKVEGTAVGFSFFSHSIYGGGGPGVFNGNHVVTRHSKGFAVPCVSAACS
FT                   LDAGTQMFSPEATSGILGIFGEIAEFREPLSHVAKGAAEVKGKV"
FT   CDS_pept        505703..506197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mcrD-1"
FT                   /locus_tag="MCP_0513"
FT                   /product="methyl-coenzyme M reductase operon protein D"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0513"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60585"
FT                   /db_xref="GOA:D1YVW3"
FT                   /db_xref="InterPro:IPR003901"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVW3"
FT                   /protein_id="BAI60585.1"
FT                   /translation="MVSPVTGKKRLLQLEIFPSRLLTVETAQKLLNELNKISGITRMVV
FT                   YGPGLPKDDPKDLLEGKFEAQKRYLNILGEQVELTVQVGRVWVEVEDIAVKDKIREACE
FT                   KTLPFSFDINEGLYLRTRKTITDYVRKGGNVDDISLGMFDPKSRRKPSCCGPRSDKHMD
FT                   E"
FT   CDS_pept        506218..506850
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mcrC"
FT                   /locus_tag="MCP_0514"
FT                   /product="methyl-coenzyme M reductase operon protein C"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0514"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60586"
FT                   /db_xref="GOA:D1YVW4"
FT                   /db_xref="InterPro:IPR007687"
FT                   /db_xref="InterPro:IPR026327"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVW4"
FT                   /protein_id="BAI60586.1"
FT                   /translation="MPIDRETQVVDCRESMGLDKGGGLAQRGTLSETGRPDVIAIAMTP
FT                   GRRHITKPVCEVTHGLRREGIQVSVLVLFSGGGVPSDSKDAAIGRGPKFGLSEKEIEQI
FT                   NRHKLALIHLGNVKSHVIYKARDILRFVTIPAIIVCQTPVDFEDFAKIGVKTRVVNPEP
FT                   DKVETQGTIVEIVTGITRGQTCSRDKLNEIVKDIISINPQKLATQGV"
FT   CDS_pept        506855..507613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mcrG"
FT                   /locus_tag="MCP_0515"
FT                   /product="methyl-coenzyme M reductase gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0515"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60587"
FT                   /db_xref="GOA:D1YVW5"
FT                   /db_xref="InterPro:IPR003178"
FT                   /db_xref="InterPro:IPR009024"
FT                   /db_xref="InterPro:IPR036994"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVW5"
FT                   /protein_id="BAI60587.1"
FT                   /translation="MAYKAQYYPGKTSVAQNRKKFMDPSYKLEKIRSLSDDDVVIMLGH
FT                   RAPGSAYKTIHPPLKEGGEPDDPIRKIVEPTAGAAAGDRIRYCQFTDSMFYAPAVPYLR
FT                   SWMAATRYRGVDPGTLSGRQIVEARERDVEKITKELMETEVYDAARSGLRGCTVHGHSL
FT                   RLNENGMMFDMLQRVVLDKNGNVYAVKDQVGDPLDRKVNLGKPMSDAELKKRTTIYFIG
FT                   GVPFRSDAEVVGWVQRIHNERTKCGFAPKL"
FT   CDS_pept        507630..509303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mcrA"
FT                   /locus_tag="MCP_0516"
FT                   /product="methyl-coenzyme M reductase alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0516"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60588"
FT                   /db_xref="GOA:D1YVW6"
FT                   /db_xref="InterPro:IPR003183"
FT                   /db_xref="InterPro:IPR008924"
FT                   /db_xref="InterPro:IPR009024"
FT                   /db_xref="InterPro:IPR009047"
FT                   /db_xref="InterPro:IPR015811"
FT                   /db_xref="InterPro:IPR015823"
FT                   /db_xref="InterPro:IPR016212"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVW6"
FT                   /protein_id="BAI60588.1"
FT                   /translation="MSVKETQKRFIKAMKKKFAGEDPTSTTTVYKYEGYTQSKRKVEFK
FT                   KAGDAIAKKRGISAYNPMVHMGGIPLGQRQLTPYVVSGTDVVVEGDDLHFVNNAAMQQF
FT                   WDEIRRTVIVGLDTAHATLEKRLGKTVTPETISNYLAILNHAMPGAAVVQEHMVETNPA
FT                   LTDDCFVKVFTGDDELADSIDKQYVLDINKAFPKDQAAALKKAVGKSLYQAVHIPTTVV
FT                   RTCDGGTTSRWSAMQIGMSFIDAYKMCAGEAAVADLAFAAKHASLVEMADILPARRARG
FT                   PNEPGGLSFGFLADIVQTNRKYPDDPCKSSLEVVAAGCMLYDQIWLGSYMSGGVGFTQY
FT                   ATAAYTDDILDDFTYYGYDYAKGKYKIGQTKPTMDIVNDLSTEVTLYGIEQYEKYPTTL
FT                   EDHFGGSQRATVLSAAAGVTTAIATGNSNAGLSGWYMSMYLHKEAWGRLGFFGYDLQDQ
FT                   CGATNVFSCRSDEGAIDELRGPNYPNYAMNVGHQGGYAGIAGAAHFGRGDAWTASPLIK
FT                   ICFADKSLAFDFTEPRKEFARGAIREFMPAGERTLVIPAK"
FT   CDS_pept        509447..509926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0517"
FT                   /product="putative dTDP-4-dehydrorhamnose 3,5-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0517"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60589"
FT                   /db_xref="GOA:D1YVW7"
FT                   /db_xref="InterPro:IPR000888"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVW7"
FT                   /protein_id="BAI60589.1"
FT                   /translation="MSQRSIDGVMTRQLRLNVDERGSLMEVMRPDWDVFERFGQVYVTS
FT                   AYPGVVKGWHYHKKQYDNFVCVRGMMKVALFDSRDNSPTKGLLNEFFIGERNPLLVKIP
FT                   PYVYHGFKCIGTNEALIVNVPTGLYDYNEPDEYRLPPDTKEIPYDWGLTPGLMHG"
FT   CDS_pept        510030..510515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdaD-1"
FT                   /locus_tag="MCP_0518"
FT                   /product="pyruvoyl-dependent arginine decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0518"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60590"
FT                   /db_xref="GOA:D1YVW8"
FT                   /db_xref="InterPro:IPR002724"
FT                   /db_xref="InterPro:IPR016104"
FT                   /db_xref="InterPro:IPR016105"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVW8"
FT                   /protein_id="BAI60590.1"
FT                   /translation="MPKKVFFTTGVGRHKEMLESFEMALRDAGIEKFNLVTVSSILPPG
FT                   CIIVERSEGLKELVPGEIVFTVMSRNSSNEPSRRIAAAIGCAIPADSQADFGYLSEHHS
FT                   YGESEECAGKYAGELAREMFYTWKNEYPLRISYAARSAEVDEDGNWATVLAAAVFIL"
FT   CDS_pept        510563..511057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0519"
FT                   /product="conserved hypothetical protein"
FT                   /note="Belongs to the Protein of unknown function DUF134
FT                   family (IPR002852)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0519"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60591"
FT                   /db_xref="InterPro:IPR002852"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVW9"
FT                   /protein_id="BAI60591.1"
FT                   /translation="MVRKVKRRVSCLPKATYYKPREIPMCDLEIVNLSIEELEAIRLCD
FT                   LLQVEQNEAADMMGISRKTFWNDLQKARQKVVDALVNGKAIEISGGEYVNSGECKVEFF
FT                   CRDCGNLWESPCGSGRPGACPSCSSKSIYRKGGDGRGRRLLDNGYRCPKDTKEGTKNGS
FT                   E"
FT   CDS_pept        511044..511433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0520"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains one Dinitrogenase iron-molybdenum cofactor
FT                   biosynthesis domain (IPR003731)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0520"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60592"
FT                   /db_xref="InterPro:IPR003731"
FT                   /db_xref="InterPro:IPR033913"
FT                   /db_xref="InterPro:IPR036105"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVX0"
FT                   /protein_id="BAI60592.1"
FT                   /translation="MEASNTTRIAIPSMTEGGLESDICAHFGSCEFFTLVDISNGKPVG
FT                   VNALSNASPDGVHNCAAPAILLKESGVDVVIVSGIGGRPLVSLTSKGIRVYGGAFGRVS
FT                   DALQDFSSGALNELSDQGTCNCSHH"
FT   CDS_pept        511446..512309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0521"
FT                   /product="nucleotide-binding protein"
FT                   /note="Belongs to the Mrp family (IPR000808).; Contains one
FT                   Cobyrinic acid a,c-diamide synthase domain (IPR002586)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0521"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60593"
FT                   /db_xref="GOA:D1YVX1"
FT                   /db_xref="InterPro:IPR000808"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVX1"
FT                   /protein_id="BAI60593.1"
FT                   /translation="MSSSTKSSACESCSSKTSTCSPDSCGNAEKNEQELRIKNNMARIK
FT                   YRIAIVSGKGGVGKSTVTAGLAIALAKSGYTVGVLDADVSGPNMPHLLGIEDEKMTGDE
FT                   NGFLPVEAPHGIEVASVESIISASDAPVVWRGPMRSSLVNQFLADVQWGQLDFLLVDLP
FT                   PGTGDEPLSIMQTMPLTGLVVVSTPSNLSLLDVSKIVNMAKMLNTRILGVVENMAYFEC
FT                   PGCHEKVFPFGEDTVKRLCEKYGLDMLGSIPMDASNRGSDVITEGSGIEKYTGDIARKI
FT                   TGILER"
FT   CDS_pept        512316..513899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atw-1"
FT                   /locus_tag="MCP_0522"
FT                   /product="putative methylcoenzyme M reductase system
FT                   component A2"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0522"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60594"
FT                   /db_xref="GOA:D1YVX2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017669"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVX2"
FT                   /protein_id="BAI60594.1"
FT                   /translation="MATLVDIKDLTVTYDGDKVLDNVSLSIEEGEMIGIIGRSGSGKTV
FT                   LLNVLRGLDESIPATGQIVYHGAACDWCGRVEPPGKAGGSCPKCGGPLSPISEDILNGA
FT                   DPVKKRNISRRVAIMIQRTFGIYGDDSVIENVMKALDDSGYGGDRIMRAADIIDQVKLS
FT                   HRMMHIARDLSGGEKQRVVMARQLAREPMMLLADEPTGTLDPKTAQVVHQNLKKLSKEL
FT                   GITVLITSHFPGVIEEMATRALLLENGRIKMLGRPEDVIKAFTGGIEAVERKEVQAGGS
FT                   VIKVEGLYKKYFSVDRGVINAVNGVSFDIREGEIFGIVGTSGAGKTSLTNILTGNLEPT
FT                   SGMVEMKVGDDWINLCEPGYYARGRAKPYIGLLHQEYDLYPHRTVIENMTDSIGLEFPA
FT                   ELAQKKAIHTLQISGFDEKRSRDILGKYPGELSEGERHRVALAQVLIKEPHVIFLDEPT
FT                   GTMDPITKKYVINSILSARQDIGETFVIVSHDMDFVRTICDRAAYVKGGKIVSMGKPEE
FT                   VLPLIQEIMK"
FT   CDS_pept        513896..514975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0523"
FT                   /product="[NiFe]-hydrogenase large subunit"
FT                   /note="Similar to Ech hydrogenase, subunit EchE in
FT                   Methanosarcina barkeri (O59656)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0523"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60595"
FT                   /db_xref="GOA:D1YVX3"
FT                   /db_xref="InterPro:IPR001135"
FT                   /db_xref="InterPro:IPR001501"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="InterPro:IPR038290"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVX3"
FT                   /protein_id="BAI60595.1"
FT                   /translation="MRTVIQFGPQHPVWIEPLRLKLSLDGEIVRDAELEAGYVHKGLEK
FT                   KFEWDYNKGAYLSERVCAICTQHHSTCYCMAVEGTMGLEIPRRAAIIRTIMLELERLHS
FT                   HLLAIGLTLESIGFENMFMLCFRNREMVLDVFERSTGNRVLHGINIVGGVIRNIGPEMA
FT                   KEISDFCDAMEKKCHDLESMIVNSYTIRQRMQGVGVMSEKLAKDLCVVGPVARGSNVPY
FT                   DVRHAYPYLLYKEVKVTPVTEKDGDCWARSLVRVRELFQSIEIIRQCLPLLEGTPDELF
FT                   AKSKTLPDGEYFARDEAPRGELFYYVRGKKSKELDRVKIRTSTYANGIGIVPLIRGSHL
FT                   ADVGLITITFDPCIGCFDR"
FT   CDS_pept        514981..515877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0524"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0524"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60596"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVX4"
FT                   /protein_id="BAI60596.1"
FT                   /translation="MTDPCASFGDGFVKAHDGVGLYYRQWSPPVEVTSFVLFIHGIGLH
FT                   GSSPPYGEKILIRQLLDRGTAFYSIDLRGHGMSGGSIDGISRDTLIKDIDSHVEHIHEQ
FT                   YSSARIFLYGHNFGGILALYYASRCPKNLRGIIMSEYSTRIRDEVKKIREPTAAIALKE
FT                   RLVEKLYKRSKKLEILSPDDYEQLCDKYRIPMDAGIMRSLETSGSGRKCMLYGKDFFTA
FT                   CGVGQDAAIAGAVRLPFLTIFSRNDPFFDIRGAYDILTRVQSYDKELTQVDAAGHYGII
FT                   EASKDIVGKWVLSRTTK"
FT   CDS_pept        515947..516288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0525"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains one Dinitrogenase iron-molybdenum cofactor
FT                   biosynthesis domain (IPR003731)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0525"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60597"
FT                   /db_xref="InterPro:IPR003731"
FT                   /db_xref="InterPro:IPR036105"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVX5"
FT                   /protein_id="BAI60597.1"
FT                   /translation="MEICITATSDDLESKVDGRFGRCKFFILVDPSTMKYRAVRNSAAD
FT                   ESGGAGIKAANTVIKYAPAAIITGLIGDNAFNVIKAFGVKLYSCGNVNVREAVGQYSAG
FT                   KLRTIDAPK"
FT   CDS_pept        516521..517387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0526"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains one Cobyrinic acid a,c-diamide synthase
FT                   domain (IPR002586).; Contains two 4Fe-4S ferredoxin,
FT                   iron-sulfur binding domains (IPR001450)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0526"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60598"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVX6"
FT                   /protein_id="BAI60598.1"
FT                   /translation="MRIAIASGKGGTGKSTVACNMALALAKAGSGITLADCDVEEPNLH
FT                   LFLPDGEASVEEVFISVPVIDRSRCNYCGKCADFCKFNAISIFPGTALTFPGLCHSCGG
FT                   CLLVCPQSAIKEVSRKVGVVKTSRPAGGIELITGMLDEGEHSSVPVIRSVKKRLPEGGT
FT                   SIIDCSPGTSCNMVAAVNGCDYCILVTEPTPFGLHDLALAVDVLVAMEVPHGVVVNKHT
FT                   GDNALIEDYCTGRGIDILEKIPYDDKIARTYSGGIIAVNALPRLAPMFISIYEKVQRRV
FT                   GQACQCK"
FT   CDS_pept        517372..518256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0527"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains one Cobyrinic acid a,c-diamide synthase
FT                   domain (IPR002586).; Contains two 4Fe-4S ferredoxin,
FT                   iron-sulfur binding domains (IPR001450)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0527"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60599"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVX7"
FT                   /protein_id="BAI60599.1"
FT                   /translation="MPVQVTVISGKGGTGKTTVTASLGMFFNHPTFADCDVDASNLHLL
FT                   LKPEVKEKKPYSGHKFPVVDESACVACGACETYCRFNAVSMREHAAIDPTACEACGVCV
FT                   AVCPAGAISLVERPCGEVYVSDTAYGPMVHARLDPGVGTAGKLVTMVREEAIKVAGEDG
FT                   IVLIDGPPGIGCPVIASLAGADIALLVVEPTVSGYSDFKRAMEVVRRFKARPCVCINKY
FT                   DLNEPYSKMIESYCGQSGVPVIGKIPYERKIFDCLSQGRIPVSCAGKEIRGLYRQMYDN
FT                   LYKLIEKVRSENQ"
FT   CDS_pept        518253..518582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0528"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains one Dinitrogenase iron-molybdenum cofactor
FT                   biosynthesis domain (IPR003731)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0528"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60600"
FT                   /db_xref="InterPro:IPR003731"
FT                   /db_xref="InterPro:IPR033913"
FT                   /db_xref="InterPro:IPR036105"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVX8"
FT                   /protein_id="BAI60600.1"
FT                   /translation="MKVCIPIEGTMVSQHFGHTPEFLIVTIEDGKAVSRKVEKSPGHEP
FT                   GLLPKLMASWGVTHVITGGLGRRALDMFEERNIRVISGVSGTADEALESFLGGKLVAGE
FT                   NMCDH"
FT   CDS_pept        518645..518758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0529"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0529"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60601"
FT                   /db_xref="GOA:D1YVX9"
FT                   /db_xref="InterPro:IPR000962"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVX9"
FT                   /protein_id="BAI60601.1"
FT                   /translation="MFRSVKCPKCGEMISEARARVRDGGFIFIPCSGEYDR"
FT   CDS_pept        518882..519211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0530"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains one Dinitrogenase iron-molybdenum cofactor
FT                   biosynthesis domain (IPR003731)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0530"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60602"
FT                   /db_xref="InterPro:IPR003731"
FT                   /db_xref="InterPro:IPR033913"
FT                   /db_xref="InterPro:IPR036105"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVY0"
FT                   /protein_id="BAI60602.1"
FT                   /translation="MSICITADGAYINGKVSEFFGRCKNFMLIDLETGELDIVPNMAAY
FT                   LNNAGLRAAADIIKHKPSAVIAGRIGKNALKALRKAGIEVLMAKNMTIREALEQYRSGK
FT                   LEKLR"
FT   CDS_pept        519229..519450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0531"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0531"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60603"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVY1"
FT                   /protein_id="BAI60603.1"
FT                   /translation="MPDKDGTGPTGEGPAGRMMGPCSHPKEERELTEGADAGNPEGQGG
FT                   KPRGRGRGHCGGRQHHGHGRMRRCCEEI"
FT   CDS_pept        519509..519886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0532"
FT                   /product="conserved hypothetical protein"
FT                   /note="Belongs to the Protein of unknown function DUF134
FT                   family (IPR002852)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0532"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60604"
FT                   /db_xref="InterPro:IPR002852"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVY2"
FT                   /protein_id="BAI60604.1"
FT                   /translation="MRERRCAGRPRSKRCLSGGHFRCMMPACRREGQMDTVTLLPEEIE
FT                   AIKLADLLDLEQEEIAARMGVSRKTAWKDLHSARKKIADAVINGKILQIEGCETAGSRA
FT                   CGMRQCRSGRGDESCNGDEMP"
FT   CDS_pept        520259..520486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0533"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0533"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60605"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVY3"
FT                   /protein_id="BAI60605.1"
FT                   /translation="MPEKDSTGQPGESSDGNDLDPGKSPEDPMASGTPENEDKDKAMVQ
FT                   EGRSPICASGHCCGRRKARKIPISQYFGDN"
FT   CDS_pept        520550..521377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mptH"
FT                   /locus_tag="MCP_0534"
FT                   /product="putative dihydropteroate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0534"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60606"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR041712"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVY4"
FT                   /protein_id="BAI60606.1"
FT                   /translation="MSVERVFCLCDNLVPSGSGYWGEHGLSFYIESGGLRILFDTGQSG
FT                   DVLLHNARLSGVSLSGLDYIVLSHGHYDHTGGLMKVIGLNEGIPLIMHPAAFQEKFARR
FT                   GGELKAIGLPFMRDELEVRCELRVEAGPIDLGGGVYTTGEIERITPYEMPQPDLLVESE
FT                   GTLSPDPMADDQSLVIRDGDSLVLLCGCCHAGIVNTIECVKRQYGMYPGIIAGGLHMEK
FT                   ASPGRLLSTLGMLKSSGVKKVIAGHCSGDSIVSSLASAGMDAKRLSAGMPIIP"
FT   CDS_pept        complement(521383..522816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0535"
FT                   /product="putative histidine kinase"
FT                   /note="Contains one PAS domain (IPR000014).; Contains one
FT                   PAS-associated, C-terminal domain (IPR000700).; Contains
FT                   one ATP-binding region, ATPase-like domain (IPR003594).;
FT                   Contains one PAC motif repeat (IPR001610)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0535"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60607"
FT                   /db_xref="GOA:D1YVY5"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVY5"
FT                   /protein_id="BAI60607.1"
FT                   /translation="MYNAHKNPYPLSLGMYNQVVLALIIVACVFVTLYANFLLGIDAVY
FT                   THLYYLPIILAGIWYHRKSIYLALFLGLAHVSIGYYLAGSIVPSTLIRAVMFLVVAAVV
FT                   SLLSERRHTLYNETRLLLESTGEGIYGIDLEGRCTFINDSAARMLGYAPDEMIGKSTHD
FT                   LIHSRKMDGTPCVPEHCGVLQSIWTGEGCRISDDIFWRKDGTAIPVEYSSYPIIEDGLV
FT                   RGAVVTFNDISERKKSEEEIREAKRRSELFLDIMAHDINNMNQVGIGYLGMVLGALKPG
FT                   DKVDEDNIVMLERSLSSLENSSRLISNVRTLQEVETGKVRLKPINLCDVLSDVRDRYSR
FT                   VPGRNVSINYANSPECMLEANELLKDAFSNLVSNAVKHSDPAKPLTVDITQTRISDGGN
FT                   EYYMVTIADDGPGIPDDLKSKLFTKFQRGQTHAQGKGLGLYLVKSLVEDFRGRVWVEDR
FT                   VPGDHTKGARFVVMLPASA"
FT   CDS_pept        complement(522821..523912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0536"
FT                   /product="putative histidine kinase"
FT                   /note="Contains one ATP-binding region, ATPase-like domain
FT                   (IPR003594)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0536"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60608"
FT                   /db_xref="GOA:D1YVY6"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVY6"
FT                   /protein_id="BAI60608.1"
FT                   /translation="MIAVYVNICNNTSIVYTHLFYVPIILASIWYRRLALLVAVCLGIL
FT                   HVVINLSLNSFTYEPIIRAVFFVIVGYFASSFAESNFALLNRSRASEAKIWGIRDELEE
FT                   LVEERTRELKNANESLRNEIHAKRQVEKALRDARDQAELYVDLISHDIGNMNQAIMGYL
FT                   EIALALINPRGEERDLIVRPLEIINNSSKLIGNVRKLQRAQAGEIPPEACDLGEVLSEV
FT                   KASYSRVPGRDVTIDYAPAGKRTVMANELLKDVFSNIVENSIKHSSGPLTISIGLATMQ
FT                   RDDAAYYVVSIEDNGPGISDAQKKKVFMSFSQNKEKPTRRGFGLHLVKTLVEIYKGSVW
FT                   VEDRVPGDHTKGCRFVVMLPSRG"
FT   CDS_pept        complement(524244..524495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0537"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0537"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60609"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVY7"
FT                   /protein_id="BAI60609.1"
FT                   /translation="MGMLVTFEVMEKKGELVAVHDGSLGLLVALGNDWDMLRDTINETV
FT                   SDALGEVTADVEIELFIDANHRTRFKYVYDRAVADRTG"
FT   CDS_pept        complement(524595..524933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0538"
FT                   /product="conserved hypothetical protein"
FT                   /note="Belongs to the Protein of unknown function DUF202
FT                   family (IPR003807)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0538"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60610"
FT                   /db_xref="GOA:D1YVY8"
FT                   /db_xref="InterPro:IPR003807"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVY8"
FT                   /protein_id="BAI60610.1"
FT                   /translation="MSTTTLAMQRNIMANERTFSAWLRTGLALIVAAIALPRIIHFVYW
FT                   AWTLKLIGLIFIAIATTVFIVAYWRYEAESKKLMCAGAVMTPAWLIKVLTILLMATSVI
FT                   SVALLLHE"
FT   CDS_pept        525361..526260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtrE"
FT                   /locus_tag="MCP_0539"
FT                   /product="tetrahydromethanopterin S-methyltransferase
FT                   subunit E"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0539"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60611"
FT                   /db_xref="GOA:D1YVY9"
FT                   /db_xref="InterPro:IPR005780"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVY9"
FT                   /protein_id="BAI60611.1"
FT                   /translation="MVEPTIVLSLGTAALMGACATIAGAAEDLESDFGSQSNANSQVQL
FT                   APQVGYLHRYYNKAVSGEPVAYGFLCCTGAAIALALMMAFKVNPVIALAFGALAASLMY
FT                   GVYATTAYMGRLTGQKRFGQPIYLDILLTTTPAIIAHAFIAAMAIGTFSYLMNWILGQP
FT                   FPFPILAMLWGVIVGGMGSAVGDVHYGAEREYQNKPFGMGLPAAQSGKIVQKGEAGLRN
FT                   SIDVAGYCVKHGGPLTGFGLGITVFSDAWREILFTQYWNGWGAMVAGLLLVLIWVIFNR
FT                   ILEMWTRKNYPAYKAAEE"
FT   CDS_pept        526262..527074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtrD"
FT                   /locus_tag="MCP_0540"
FT                   /product="tetrahydromethanopterin S-methyltransferase
FT                   subunit D"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0540"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60612"
FT                   /db_xref="GOA:D1YVZ0"
FT                   /db_xref="InterPro:IPR005779"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVZ0"
FT                   /protein_id="BAI60612.1"
FT                   /translation="MDPITLIIVLLAITIGGLLIGLGVHFVPVGGAPAAMAQATGIGTG
FT                   TTMLAFSSGALGLISAGFTVNDIYRGSLKTAYPGFATAMNDGTLLSISGISSNLMAILL
FT                   VFVAGIVGAMIMMVILGVTANILYSFAIGVPLVSAKVKYDPITGDRQDLWVTRGTEGHG
FT                   TPTVAIISSLIGGLLGGLGGAMLYLAFMAGGLGNFDKLGVAGIAAAAFLTVGIFFVNSV
FT                   LASYNITGTIEGFHDPKFKRVPRAIIACTVASFVMGVWAVALIYLGVV"
FT   CDS_pept        527076..527888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtrC"
FT                   /locus_tag="MCP_0541"
FT                   /product="tetrahydromethanopterin S-methyltransferase
FT                   subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0541"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60613"
FT                   /db_xref="GOA:D1YVZ1"
FT                   /db_xref="InterPro:IPR005865"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVZ1"
FT                   /protein_id="BAI60613.1"
FT                   /translation="MSEVKELDWYMLAALGIVGGLIAIYLAYFLNTYMKVGYFSFLGAV
FT                   GAILAIVWGADAVRRICKYGIGTGVPSIGMLAFGMGLLATLLGLKIGDYVGIVYVGPIA
FT                   AIVLSLVQGAIIGFIANSVLKMKIPTMQIGMVFIAGAASIILMGFTTTIAGSFDYASMM
FT                   KYVFETGFIAPLFMIGALPMLHPFNACLGPDEDQRRTLTLAVEAGLLSTIMFGLMSLYT
FT                   FQANILPALITVVLGLLGWIYAYLAYFNKVKESGVTVLATGVLPKKEA"
FT   CDS_pept        527892..528203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtrB"
FT                   /locus_tag="MCP_0542"
FT                   /product="tetrahydromethanopterin S-methyltransferase
FT                   subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0542"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60614"
FT                   /db_xref="GOA:D1YVZ2"
FT                   /db_xref="InterPro:IPR008690"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVZ2"
FT                   /protein_id="BAI60614.1"
FT                   /translation="MAAIKVLPEYGLVYDTETGKIAPESGNMVKYTMGSVNTALDKLDK
FT                   YADDLVNSLAPTGSFLESFPGREKSLYYAGIFTNVFYGFIFGLIAAFVIVFLRAGGMI"
FT   CDS_pept        528205..528954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtrA-1"
FT                   /locus_tag="MCP_0543"
FT                   /product="tetrahydromethanopterin S-methyltransferase
FT                   subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0543"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60615"
FT                   /db_xref="GOA:D1YVZ3"
FT                   /db_xref="InterPro:IPR005778"
FT                   /db_xref="InterPro:IPR030688"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVZ3"
FT                   /protein_id="BAI60615.1"
FT                   /translation="MVDKKEPAKGWPVVKGEYDTGDAKSPVAVATCGSHFNLFPIKAGA
FT                   AISGPFKTENLGIEKIVANVISNPNIRFLVICGSEVKGHISGDALICLYKYGLKDGRIV
FT                   NAKGAIPFIENLDANAVKRFQEQVQIFEMVDVEDEAKITQVIKDCLAKDPGAFAGEPML
FT                   ITIKEKEEEVEVGAAIKPVSGELAIIQSRLRAIKDDVKDIGYLNKFTMGWYAGKMEGIA
FT                   IGVVLCVVLLALLFPGGIDWTKLLLKP"
FT   CDS_pept        528966..529181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtrF"
FT                   /locus_tag="MCP_0544"
FT                   /product="tetrahydromethanopterin S-methyltransferase
FT                   subunit F"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0544"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60616"
FT                   /db_xref="GOA:D1YVZ4"
FT                   /db_xref="InterPro:IPR013347"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVZ4"
FT                   /protein_id="BAI60616.1"
FT                   /translation="MAESIAVAATQAPPESAFVPMIDEICYRAQLTARNQKLSSAVGAT
FT                   KVLGFLIGALFALGMVLIPLALLGGL"
FT   CDS_pept        529183..529389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtrG"
FT                   /locus_tag="MCP_0545"
FT                   /product="tetrahydromethanopterin S-methyltransferase
FT                   subunit G"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0545"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60617"
FT                   /db_xref="GOA:D1YVZ5"
FT                   /db_xref="InterPro:IPR005866"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVZ5"
FT                   /protein_id="BAI60617.1"
FT                   /translation="MIPAAAVDPAEFSAVQKRLDDIEGKVEFTNSEIQQSSGRTLGREV
FT                   GILYGFLFGVLIYVAYSIIMSIV"
FT   CDS_pept        529405..530355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtrH"
FT                   /locus_tag="MCP_0546"
FT                   /product="tetrahydromethanopterin S-methyltransferase
FT                   subunit H"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0546"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60618"
FT                   /db_xref="GOA:D1YVZ6"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR023467"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVZ6"
FT                   /protein_id="BAI60618.1"
FT                   /translation="MFKYDTPQKVYEVGRAKVGGNPGEYPTVLAGSIFYNKEPIFASKE
FT                   DSAKGIFNKEGAEKLIRQQEEMSDITGNKVWVQIVSETEESMIKYIEWYSNVGKDAFLV
FT                   DSTVASARIAGAKKADEIGISDRVIYNSINAAAQQAEMDAIKPLKFTSAIILGFNAVDM
FT                   SVKGRMEMFTKGGAGQAKGMLTLGTEKGITRPLLDVAATPLGSGSGATYRSIFAVKSQL
FT                   GEPVGGGYHNIPSAWAWLKKFKKQPGKEGAYMPSDIGSNLVAITLGCNFCLYGPIEHSV
FT                   EVFPAVAMNDIIVAEAAKDLGTAPLSEVNPLTKLA"
FT   CDS_pept        530478..531803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0547"
FT                   /product="Na(+)/H(+) antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0547"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60619"
FT                   /db_xref="GOA:D1YVZ7"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVZ7"
FT                   /protein_id="BAI60619.1"
FT                   /translation="MSSTEDFVLVTLLTLCLLLFAAKIGGELARRFGIAAVVGELFAGI
FT                   ILAPTLLGGLHVMGMQLIVVNDEVKMFAELGAILLLFLVGLETRFADFTKSGLLATIVA
FT                   CGGVIVPFVLGYALVIAWGYPYKEALLVGAALTATSIAITVKVLKDIGRFQTKESGILI
FT                   GAAVIDDVLGLIVLAIVLGLVEGGELNLIDIGIVTVQSVGVWLALTIVGVFGIAKLIDR
FT                   LCPRKECPRMSGIQGELYGPNSPGIHCILKCDGTQEASAIALCFSYAYVAGLAGLAPIL
FT                   GAFAAGMTIAETKILATIQDVTEKINFLMAPLFFVVIGTYVDLSGLTVDSLIFASILIA
FT                   LAMVGKIIGCGLPLYVMNRDPARAIIVGLGMMSRGEVGLIIAGIGATSGIFSNEVFSAV
FT                   VLMVVVTTVVTPIALSQAYKRLKFTTPVTLPCISDEECARSP"
FT   CDS_pept        complement(531813..533270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0548"
FT                   /product="Trk system potassium uptake protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0548"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60620"
FT                   /db_xref="GOA:D1YVZ8"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVZ8"
FT                   /protein_id="BAI60620.1"
FT                   /translation="MLSGGDLKIILSNLKGLFIIIGAIMLAMATISALTGRPGTADGFF
FT                   YGAVIGIGAGLALNTIYPKSGEPELRHAMVIAAIAYIIVPAISALPFMVTGHMSPIDAF
FT                   FESISGWTSTGFTMITGPEQADPIILLWRSVTQWFAGLGVILLMVTILIRPGTSTFMLY
FT                   QSEGRRDKILPSIRSTLKVIWVLYLALTIVSFVLLLVAGMPVWPAVNTALVAISTGGFS
FT                   IDSDSIAAFHSIPIELALLPIMIAGALPFAVVYRAIGKGVLSLFRDPQVKVFLIIIVIG
FT                   ALLLSLENFYYYNDILASIRYSVFQFITAITGTGLQSADVSQWSQSALFLISIAMIIGG
FT                   CAGSTASGIKVARVIFIWNEIKLWLARMFQSKNSIVAIKISGKRVTEDTIDQEMAEASL
FT                   ISFLWIFSIVISMFLLSHIAGAQYNLIDILFDVCSAQGNVGVSCGVINPEMPAIGKVLV
FT                   ILNMWIGRLEIIPVMVLVRYAIKGFRI"
FT   CDS_pept        complement(533271..533939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trkA-1"
FT                   /locus_tag="MCP_0549"
FT                   /product="Trk system potassium uptake protein TrkA homolog"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0549"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60621"
FT                   /db_xref="GOA:D1YVZ9"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006036"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVZ9"
FT                   /protein_id="BAI60621.1"
FT                   /translation="MHIIIIGLGGIGQNLARIAVAEKHNVVVIDNNAKKCNDIVTKYDL
FT                   ISVNGDATSATILDEAGVSETDAVIATTSSDAVNLLALLQAKDKGVKNLRSIVNEFEHE
FT                   DIFQREGITIHKNPSAIVAEDIYNNMLRPGINDFVTIGAGKAEIVDILIKEGTKAAGRS
FT                   IKDIGLPSNVLVIAVERGDDVIIPDGNTVVLPGDSVFVFIRKNLADKVFNTFSVGNLVR
FT                   "
FT   CDS_pept        534095..535618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0550"
FT                   /product="conserved hypothetical protein"
FT                   /note="Belongs to the Uncharacterised conserved protein
FT                   UCP016937 family (IPR008303)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0550"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60622"
FT                   /db_xref="InterPro:IPR008303"
FT                   /db_xref="UniProtKB/TrEMBL:D1YW00"
FT                   /protein_id="BAI60622.1"
FT                   /translation="MISMQLKPLSRLLGPKPHIADSPYLSLVPKTGSPGMSAKIDLSTT
FT                   SYYVVASVEMGNTTTKCILTATNLETGKTYLLNKTVKMSRDVRPPKEGEKVFGKTLDGK
FT                   KLTRESVGELVRQTLEEAHKAAGLTISQDLNFVVRSTGVVAGFDKPEDVGSFILALADG
FT                   CITAGVPPKNMTPAMNKDNLNPPRLRKFSQLDKVYFDGAVASVLPPMGSSGVEIVANEM
FT                   EGELATAGIKEAAKWAGVDFRNPVCSIDFGTTLKGRMTNDLAPYSRTIGNFCGLAGAVP
FT                   DAIVRGSGLVDSEFGNVLDITTKERPGLLAEIMNSKGIEEHAKWAHEMVQIDVVPDERR
FT                   WWGSVPVNPKAARNNGVTLIGCEVGENGKDLPKLNEVGASLIKKYNVNTMLATLDLVSA
FT                   MIAERLLKKALENNLISSKTTIGITGRAGITGDKPALILQKVTEMGIFDSPNDHLVFCD
FT                   DGLARGAAVMARCMNSYGTPKNPLGGLRGGKCILGARMKLQNKDKKTEA"
FT   CDS_pept        535623..535961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0551"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0551"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60623"
FT                   /db_xref="InterPro:IPR012031"
FT                   /db_xref="UniProtKB/TrEMBL:D1YW01"
FT                   /protein_id="BAI60623.1"
FT                   /translation="MACLNDYDYDILLSHQTYAESEKFILSKYWETYYVEPGYTVLNLR
FT                   ILGSEYVPIAVEDNTDNLILPYTKPCMGTFVVRIKHVPQEVERIRKSFERTITLKQWRK
FT                   NVDESKAK"
FT   CDS_pept        536190..536567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0552"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0552"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60624"
FT                   /db_xref="UniProtKB/TrEMBL:D1YW02"
FT                   /protein_id="BAI60624.1"
FT                   /translation="MGIRQKVDFHSKPVIPGVFDLLIPPGTPRKLILKLAKEYPVQIVR
FT                   RDDIYVPVGVCDVERDLLAIRGDKKTIQKMEKILFQEIDAFINGQDARLHNYNKPVKLE
FT                   GISPVEKPVKPKAKVKAKAKK"
FT   CDS_pept        complement(536588..536917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0553"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0553"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60625"
FT                   /db_xref="InterPro:IPR017099"
FT                   /db_xref="InterPro:IPR019209"
FT                   /db_xref="UniProtKB/TrEMBL:D1YW03"
FT                   /protein_id="BAI60625.1"
FT                   /translation="MEASESITANDLYGKPITVGATVKYVSTRTVGKVVEMKRENDKTW
FT                   ALLDKTRLYYDTRYLEVTAADATEEEDETAARVDMEEVEKKIRSMEDALKVKDINMDTS
FT                   CEGGG"
FT   CDS_pept        537039..538247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0554"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains one YcaO_like domain (IPR003776)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0554"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60626"
FT                   /db_xref="InterPro:IPR003776"
FT                   /db_xref="InterPro:IPR017667"
FT                   /db_xref="UniProtKB/TrEMBL:D1YW04"
FT                   /protein_id="BAI60626.1"
FT                   /translation="MKLTLKKTPKGYTKDTHRVVPPEETLARVEKLLPGIGVTRVAEIS
FT                   GLDRIGIPVYSAIRPASAKGAISVYAGKGATPVEAKVSVMMEAIERYSSEFQKADKKRV
FT                   VMGTFTDVSNGKVAVDPQKLILPGQLLPNVRLDWIDGYDLMNKKEVLLPCNAVFHPYLA
FT                   PFKLFRSNTNGLASGNTMEEAIFHGLMEVVERDALSIAEATRDPGKEITITKKDGLAYE
FT                   LYAKFGKAGIDVKLWYLPTDSGIPTVLASTDDKELMDPSLLVMGVGTHMDARISVLRAL
FT                   TEVAQSRATQIQGAREDTDREKVVRTIGYERMKRMNRHWYGEGKETITLKELPDLSTDS
FT                   HKGDIEKAVKMLKGCVAAVIVTDLTREDVGVPVVRVTVPGLEMYAIDHERIGPRCKRPV
FT                   MRK"
FT   CDS_pept        538244..538897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0555"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains one TfuA-like, core domain (IPR012924)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0555"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60627"
FT                   /db_xref="InterPro:IPR012924"
FT                   /db_xref="UniProtKB/TrEMBL:D1YW05"
FT                   /protein_id="BAI60627.1"
FT                   /translation="MSKVIVYLGPSLSIEKAKAILEADYRPPIRRGDLKKALKSGVDIV
FT                   GIIDGTFFNDSPVAHKEILDVLKKGVTVVGGSSMGALRASELDVFGMVGVGRIYECYRS
FT                   GRIEADDEVAVTYNPVTGEQISEPLVNVRYQLKAAEKDDVMTKKEKDALLSMAAGMHYP
FT                   DRTYPNILKMSVEKGLLSSDKADSLLKYINEKPLNLKAEDAVAVLEKIKKISIS"
FT   CDS_pept        539143..539547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0556"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0556"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60628"
FT                   /db_xref="InterPro:IPR026350"
FT                   /db_xref="UniProtKB/TrEMBL:D1YW06"
FT                   /protein_id="BAI60628.1"
FT                   /translation="MSNVLKKDPIPDEINKLTGQIVDAAFIVHTTFGPGLLESIYEECL
FT                   IHELKLRGIKVQSQINVPLDFKGLYIERGLILDVLVEGQVIVEVKSVKELHPVYEQQLL
FT                   TYMKITGKRVGLLINFNAPLIKNGIKRMVL"
FT   CDS_pept        complement(539742..540086)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0557"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0557"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60629"
FT                   /db_xref="UniProtKB/TrEMBL:D1YW07"
FT                   /protein_id="BAI60629.1"
FT                   /translation="MSRELSEYDWDILKKLCPELNDGTCVSSGRMYRSILPPLSRHYAK
FT                   SREDFMERVEKLSDEELDYLICLAENGEESLTCIVPEHKDAFLEMVGRRTTKERAAKLR
FT                   KFIDFLETLG"
FT   CDS_pept        540180..541370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0558"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains one 40-residue YVTN beta-propeller repeat
FT                   (IPR011964)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0558"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60630"
FT                   /db_xref="InterPro:IPR011045"
FT                   /db_xref="InterPro:IPR011964"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR019405"
FT                   /db_xref="UniProtKB/TrEMBL:D1YW08"
FT                   /protein_id="BAI60630.1"
FT                   /translation="MMRRVPIIVIAVTLAFLACGMAQAAVPAPGQGFLYVANTDQRTVT
FT                   VIDMQTDAVLRTIEVGGQINGIAADPTGYYVYLACYDGVRIIDTQTDDSRNVGMGQGPK
FT                   AITVSPDGSGYYVLYGNYINLAKIGSGDVAQKITLPRNKDIMAVSPDGSMACLGSAYFE
FT                   TIGLYKVPSGESASPEIDFGQSVYCTFSPDNEYAYISLKDQKKVIALKAHDYFIKYDIS
FT                   VPSNPGGLAVSPDGSTLYATLPSENKVVAVNTSSRSVLGTIDVGDSPQQIIFSPDGNKA
FT                   YVSDANSNAISVIDTSGLPGNIGNVTKTISVGSRPVYLAIASKPALPTDTPTPTPVPTP
FT                   TPVPTPTPTAVPTEMPTPTSQPATPTPTPTPQPSPGFEVLAALACLATAGIYRIKK"
FT   CDS_pept        complement(541403..541915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mcrD-2"
FT                   /locus_tag="MCP_0559"
FT                   /product="methyl-coenzyme M reductase operon protein D"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0559"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60631"
FT                   /db_xref="GOA:D1YW09"
FT                   /db_xref="InterPro:IPR003901"
FT                   /db_xref="UniProtKB/TrEMBL:D1YW09"
FT                   /protein_id="BAI60631.1"
FT                   /translation="MSTNVGSMKLGENGTMQIEVFPQRLLNIGTAQKLLNELNTIEGII
FT                   RMVVYGPGLPRDDPDDLLEGKFGVAEKKYFNIMGEMVELSVQVGRIWIEIEDTKAIEKI
FT                   REACEKALPFPFELNEGLYLRRKKTVSDYARRGPNVDDMSLGMFDPKVKREPACCGLDH
FT                   TDKNERV"
FT   CDS_pept        complement(541955..542650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0560"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0560"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60632"
FT                   /db_xref="GOA:D1YW10"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:D1YW10"
FT                   /protein_id="BAI60632.1"
FT                   /translation="MKVLVIDSSNGSMGVLLDPYLEGIRAAGAEVEVYNGRDLVVYPCC
FT                   GNLNCTVSTPGKCMPYDDMRWLRPKIGGGDALVLASPLYFDGVVGHETPSLRSIKARLV
FT                   PDMEPSVNHTYEHAVHTTREAVRLRKVVLVSGCGFWEIDGLNPVLTHIKAFCTNSYPGF
FT                   EGNLPGQRQAILRGGLKEGTSGDDIVKLANDAGRQLVGGCEKTMISAPLPSAVSRVKHE
FT                   WKSLILYQF"
FT   CDS_pept        complement(542760..543452)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0561"
FT                   /product="TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0561"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60633"
FT                   /db_xref="GOA:D1YW11"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:D1YW11"
FT                   /protein_id="BAI60633.1"
FT                   /translation="MSIASRKEREKEQRHNDILQAAEKLFFARGYESVTMDDIAREVEL
FT                   NKATLYLYFKDKESLFFAVVLRGVRILASIVRERVRNKASGIEKFWAAGQAYIDFAEQY
FT                   PEFLRLYNYFQSGRFDLESMKDEMEALISYAHTGFALVSGDDHAKEIVALRQEMLTIQS
FT                   NAIEQGIKEGTIRPGLDPVEVAVVYTLLLQSIPNMRLDLRKALEGRGIDRALFASDIRQ
FT                   FMSDMILK"
FT   CDS_pept        complement(543538..544473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0562"
FT                   /product="ABC transporter ATP binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0562"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60634"
FT                   /db_xref="GOA:D1YW12"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1YW12"
FT                   /protein_id="BAI60634.1"
FT                   /translation="MDDVVIGVSGLVKNYPNNPAVCNVSFKVRRGEIFALLGPNGAGKT
FT                   TIIKILEFVERPTSGFAYVLDSEQLYALTKDYTGIKEKIGALPQGFKGFDLLTVYENID
FT                   YFAQMYRKYGNVDRIIDEMGLRDKRNALFKHLSGGQKQRVGIAIALINDPEVVFLDEPT
FT                   TGLDPKARRDVWDMIKGLKARGKTVLLTTHYMDEAHQLADRICVLNRGSIVTHGTPEDL
FT                   INKYGGGNTLVVRGCSTGAIERLREALPGSLVSGNDVTVRLAYGDGMAAMAKAISVLGG
FT                   DGHLCQELYVKKPTLEDVFLNLTGERLDDA"
FT   CDS_pept        complement(544499..544978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0563"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0563"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60635"
FT                   /db_xref="InterPro:IPR019271"
FT                   /db_xref="UniProtKB/TrEMBL:D1YW13"
FT                   /protein_id="BAI60635.1"
FT                   /translation="MRLKCRVGCPSYGTNLKCPPFVPTPDEFRQALKEYGFAMVLKHKP
FT                   PAMPETPGTAEERLAALRTQYREYYRTTLAIMLELEKVAFGRGYTFATAFVGGSCHLYE
FT                   KCNVEKGMCLSPAMARIAAEAVGVNVMKTAKNAGMAVKFPPEAKSPEPMALLLID"
FT   CDS_pept        complement(545079..545825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0564"
FT                   /product="ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0564"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60636"
FT                   /db_xref="GOA:D1YW14"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:D1YW14"
FT                   /protein_id="BAI60636.1"
FT                   /translation="MSRITTDIKYSLLQFFRNRQSVLVTFLFPVVFLVMAWYLFGSRAD
FT                   YVMGNSALYADFLLPGIVGIAIMVSAVDHTVGFVSRLRAAGIFRKLAMTPIRRIEWNVS
FT                   RVLTGTVVVLLSVAVSLAVAWLAFGVTPGLNLIVALLVLAGGVMFIGMGMVIAYIIKGD
FT                   EAANAAFTVTLPLIFLSGSIFPVGRLPWFLQAVAAISPLTYLNDGLRSAMVTGNMSSAV
FT                   ADLAVVSALALIFFSIGVIALRWREG"
FT   CDS_pept        complement(545837..546595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0565"
FT                   /product="ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0565"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60637"
FT                   /db_xref="GOA:D1YW15"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:D1YW15"
FT                   /protein_id="BAI60637.1"
FT                   /translation="MSRISRMATDIKYSLVQFLRSRQSVFFSLVFPAVFLVILGYLLGS
FT                   DTAEGGVNYMGYLLSGILGMCIMFSALNETMGTISRYRANGVFNMLSVTPMSTIEWNLA
FT                   RIISGTFIVLLSVAVALIAAWLAFGILPAINVFSVLLVIAGAFMFIGMGMIIAYVFDDV
FT                   RSPNMVSLMITLPLMMVSGSLFPIEQLPFLVQFFSILSPLTPLNDGLRSAMFSGDYGSA
FT                   AVSLLISIGLGFVLFTIGVAILMGKDGQDV"
FT   CDS_pept        complement(546597..548315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0566"
FT                   /product="ABC transporter ATP binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0566"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60638"
FT                   /db_xref="GOA:D1YW16"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D1YW16"
FT                   /protein_id="BAI60638.1"
FT                   /translation="MPIAVMADTGAGIKFWDAVSQKYDNAVDGTMGKNLRPTALEKLSQ
FT                   EAGLGRAVELGCGTGYFTKTLARVADSVVATDFCEGMLARAMERLSSAGNITFQKEDCM
FT                   KTSFPDDTFDTVLMALVLNYIPDPAAALAEARRILKPGGRLIIVNPDNSFIGEARKRLS
FT                   SYKLMAGYGDAQVRYPQTFRNLSADGLYKMLETAGFKIEASELIRDDPGSYECAIDAME
FT                   YVRAAKATEDFDMLMSVVKSHGRRGRPGNAIDVRYLVKNYGKFPAVCGVSFYVRTGEVF
FT                   ALLGPNGAGKTTIVEVLELLKTPTRGFISIFGNAVLTGIRTELGGNPFPGEKRDYGNIK
FT                   ERIGVLPQGFNLFGLLTVYENIDYFARMYSKHVDVDRMIDELGLREKRNALFKDLSGGL
FT                   KQRVGIAIALINDPDIVFLDEPTTGLDPRSRRDVWEAIKAIKAKGKTVFLTTHYMDEAY
FT                   HLADRVCIINKGIVIVEGTPEDLINRHGGGNVLVIRECNAEALDPLSKAIPGSTIEGDS
FT                   VLVKLRGSDGMASIAKAVEVIKSGGFACREIYVKKPTLEDVFLNLTGENLVEGGT"
FT   CDS_pept        complement(548319..550010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0567"
FT                   /product="ABC transporter ATP binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0567"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60639"
FT                   /db_xref="GOA:D1YW17"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D1YW17"
FT                   /protein_id="BAI60639.1"
FT                   /translation="MSVDNEKYWNIISAKYDSIVDRTIGDRLRPQVRERLEREKGLGRV
FT                   AEFGCGTGYFTRTLAEVADSVVATDLSDEMLARAREGMKGIINVTIQKEDCMRTSFADR
FT                   AFDAAFMALVINVTDNPMQALCEANRILKPGGVIIIANPDGSYIDVADMPGTMIRFSSN
FT                   YGFAADYFTKEEFEAMEKSARGISDNDLRQMLPAAGFQITSLEILGDDTSASNLAMDYV
FT                   RAVKTSDRAASSAGMLKNYERAEAVIVVKDLSKYYGKFIAVFGVSFTVRKGEVFALLGP
FT                   NGAGKTTIVEVLELLKSPTRGFISILGSDVLIGAPVGNLFMAQDRNFADLKEKIGVLPQ
FT                   GFNSFELLTVYENIDYFARMYSKHVDADRLIDELGLREKRNALFKDLSGGLKQRVGIAI
FT                   ALINDPDIVFLDEPTTGLDPRSRRDVWEAIKRLKAKGKTIFLTTHYMDEAYQLADRVCV
FT                   IHKGSIVAEGSPEDLINRYGGGNTLVIRECSPDALEPLAKAIPGSTIDGNNVMAKLQED
FT                   DGMASIAKAVEVIKSGGFACREIYVKKPTLEDVFLNLTGEKLIEGG"
FT   CDS_pept        550768..551217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0568"
FT                   /product="ArsR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0568"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60640"
FT                   /db_xref="GOA:D1YW18"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D1YW18"
FT                   /protein_id="BAI60640.1"
FT                   /translation="MTSLRNNIIECAGCGGFFDIEALKGEKDGSVRCPTCGEDLPLRIR
FT                   PAPKAKDNSKKAQKEDFAETAQLFKCLGDPCRVKIIELLSDHELCVFEFVDMLGFQYSA
FT                   VSYHLKMLKEMGIVQAYERGNFMVYSLTDKGETVHEFIERSRSLS"
FT   CDS_pept        complement(551223..551771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0569"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0569"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60641"
FT                   /db_xref="UniProtKB/TrEMBL:D1YW19"
FT                   /protein_id="BAI60641.1"
FT                   /translation="MGLLDFFRPRSLPPPKIDDLFKLTPAAVTMGQLRVEPTGMAGMCF
FT                   RSIGGVTFEDMKSGILKVLENSAFLARFSVLTDQFGFTWVVIDSDTLADAVSNVYMASQ
FT                   LLIEGGFSDHITAAIFRFEQGDLPVYWVYNYRRAAFYPFAPRGNERDMQLEYRLRLLVM
FT                   DELPVDSLDYWFPIWGIPF"
FT   CDS_pept        complement(551777..552673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="htpX-1"
FT                   /locus_tag="MCP_0570"
FT                   /product="probable protease HtpX homolog"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0570"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60642"
FT                   /db_xref="GOA:D1YW20"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR022919"
FT                   /db_xref="UniProtKB/TrEMBL:D1YW20"
FT                   /protein_id="BAI60642.1"
FT                   /translation="MNERVRRWPADLGLSLRMFLTMLILGAVYLGFLTILYWLGIDFWS
FT                   LMIIAAVMLGIQYFFSDKIVLASSGAKIVTPEQAPRLHAIVDRLCAETGLPKPRVAIVP
FT                   TDVPNAFATGRSQKHSVIAATQGLLNRLNEDEIVAVLAHELSHVRNRDVAVMTIASFIS
FT                   TVAYYFIMSFAFGGFRSRDRQGGSGLMIVYVISLIVYGISLLLTRLLSRYRELAADRGS
FT                   AYITGRPSWLISALLKISGQMERMPKKDLRSEEGLNQFFIVPALSGRSILELFATHPSL
FT                   EKRIRQLERMEKAMGEQ"
FT   CDS_pept        complement(552717..553763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0571"
FT                   /product="calcium/proton exchanger"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0571"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60643"
FT                   /db_xref="GOA:D1YW21"
FT                   /db_xref="InterPro:IPR004713"
FT                   /db_xref="InterPro:IPR004798"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniProtKB/TrEMBL:D1YW21"
FT                   /protein_id="BAI60643.1"
FT                   /translation="MKLDLDTILGAMLIFIPISIAAELLHLNGIIIFFTAALAIVPLAG
FT                   FMGKATEELSKQVGAGIGGLLNATFGNATELIIAIFALQAGLFEVVKASLTGGIIGNML
FT                   LITGCSMFLGGLKREKQTFNSRVQGVNSTMLMIAAVGLVMPALVSHLFDFNTVEALSLG
FT                   ISGILIIAYVASLLFSLKTHKHLYDCGGEECKPHMSRNRAILLLLVTTAVIALESEILV
FT                   GAVESVSLSLGLSELFIGVIIVAIIGNAAEHSTAILMAMKNNMDLSMGIAMGSSTQIAL
FT                   LIAPVLVFISWFWGNPMDLVFNQFEVVAIIASVVIANMISSDGESNWLEGAQLIALYAM
FT                   MAVVFFLI"
FT   CDS_pept        553928..555373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0572"
FT                   /product="hypothetical protein"
FT                   /note="Contains at least one PT repeat (IPR006970)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0572"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60644"
FT                   /db_xref="InterPro:IPR006970"
FT                   /db_xref="UniProtKB/TrEMBL:D1YW22"
FT                   /protein_id="BAI60644.1"
FT                   /translation="MVFSVIRKPLALLLVVVMVGAIMLMAVNGAIGQQGPGPVDYGGGY
FT                   AVPGAPGISLGPGTNTVAMSVSIASQQDSQIYFQVNSFAVRDQQTQTFTVYDLSSAMPG
FT                   IMDTGNNRVQIDIGKLQSSIQSTSQAAMDDLYSILRPSVNSLMVVADISQQGQQGSRAT
FT                   FQVERLTVIMPDGQTSEFDLSQPMSIVVDGAALRIFAVGFEQMYSLVNTYIVNIQNNYY
FT                   TEINYNIVTGPVIVVTPPAVYPVLTPIRFPAAWPVFYPVPVPVPIPVVSVRPHPPSVTP
FT                   TKQPTMGPTVSPTKGPTISPTARPTGMPTVSPRISPTIGPTKRPITSPRASLIATRRPV
FT                   ISPGATISPSLIPTRRPVGTFSPSLIATKKAAPSLIATKKATPTFQATKAPGGIATKRP
FT                   ISATYRPTTGPVTRPTIKATQAPVGGGAKRPIATMPVTPRKPTAGDERIRRSLQPPLST
FT                   IVPGTAASPSPSPTATIRPTKVI"
FT   CDS_pept        555450..555833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisI"
FT                   /locus_tag="MCP_0573"
FT                   /product="phosphoribosyl-AMP cyclohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0573"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60645"
FT                   /db_xref="GOA:D1YW23"
FT                   /db_xref="InterPro:IPR002496"
FT                   /db_xref="InterPro:IPR026660"
FT                   /db_xref="InterPro:IPR038019"
FT                   /db_xref="UniProtKB/TrEMBL:D1YW23"
FT                   /protein_id="BAI60645.1"
FT                   /translation="MPLMIKPDFKGGLLPVIVQDVKTREVLMFAYMNEEAFRLTMETGL
FT                   AHYYSRSRQKLWKKGEESGHVQHVKEARIDCDEDCLLLLVEQDTAACHTGYVSCFYRDV
FT                   DGRIVGKKVFEPGDVYHEGTHKT"
FT   CDS_pept        555874..557706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0574"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains one PilT protein, N-terminal domain
FT                   (IPR002716).; Contains one Nucleotide binding protein, PINc
FT                   domain (IPR006596).; Contains one Bacterial type II
FT                   secretion system protein E domain (IPR001482).; Contains
FT                   one KH, type 1 domain (IPR004088)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0574"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60646"
FT                   /db_xref="GOA:D1YW24"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/TrEMBL:D1YW24"
FT                   /protein_id="BAI60646.1"
FT                   /translation="MKLVPDTSVIIDGRITRKVESGEFEHALIIVPEAVISELETQANQ
FT                   GKEIGFNGLEELRKLQTMAREGRISIEFSGSRPTLNQIRMAPGGEIDDMIRNIAVENDA
FT                   ALVTSDKVQAGVARAKGINIIYLKPDIDELGHFDLMDYFTEDTMSVHLKADVVPMAKRG
FT                   TIGDMRLVKAGKETLSDKQLLHMAHEILERAKQDPNAFTEIEMNGATVVQLGNLRIAIA
FT                   TPPFSDGVEITAVRPVARLSIEDYKYSGTFKDRIIEKRRGILISGPPGAGKSTFAQACA
FT                   DFLFEHDFIVKTMESPRDLQLPEAITQYAPLNGSMENTADILLLVRPDYTIYDELRKTS
FT                   DFEIFSDMRLSGVGMIGVVHATRAIDAIQRFIGRVELGVIPQVVDTVVFIDHGSIEKVY
FT                   DIEFTVKVPAGMTESDLARPVINVKELESGRAEYEVYTFGEQVVVMPVGAEKPQKASRK
FT                   ADEKVVMKEVARFARGPVEVEMVGDNKAIVRVREKDIPAILGRGGKTIGQIERASGAHI
FT                   DVRTLEEGRVEAAAPEEQGMTLPVGVQEVKKHVILDVGKKFAGQTVEILTGGDYIFTAT
FT                   VGRTGIIKIPRGSSFIDRILKAQMHGEEVRARLV"
FT   CDS_pept        557982..558815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0575"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0575"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60647"
FT                   /db_xref="UniProtKB/TrEMBL:D1YW25"
FT                   /protein_id="BAI60647.1"
FT                   /translation="MVPMSLRFAKITVENVDDLMSVCGNVPGMSKHPAFVEGRKARRQW
FT                   LLDMIEKFGTVGMLAYYGGSARGFVECIPASAHPMGVFSPDVKRTAVIDCAWYAQSNGE
FT                   PGGLAVRKAILDEMFAVKFFDKLLGKKCRYVDVLTLKNAPIMQYDFYRDYGFRDAVEFT
FT                   GHATGRYLLRYPVLGDAVEPRIEQLSFNCGTDKNVLVIGTYDQCHLPHMVVEKIRKAVD
FT                   GMEGLKIKVVDYWETGTPAVCEASINGLPAFGGPVYFMDDEGIREAVASKMIKIK"
FT   CDS_pept        complement(558845..559081)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0576"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0576"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60648"
FT                   /db_xref="GOA:D1YW26"
FT                   /db_xref="InterPro:IPR007211"
FT                   /db_xref="UniProtKB/TrEMBL:D1YW26"
FT                   /protein_id="BAI60648.1"
FT                   /translation="MNGRRDPLLIISAILLIIGGLNWLLVAFGINIVEAIFGAVATSIL
FT                   TKLIYILVGLAAIYMLYPLYQWLTAPAERPIIR"
FT   tRNA            559286..559360
FT                   /locus_tag="MCP_t0011"
FT                   /product="tRNA-Arg"
FT   CDS_pept        complement(559579..559788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0577"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0577"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60649"
FT                   /db_xref="UniProtKB/TrEMBL:D1YW27"
FT                   /protein_id="BAI60649.1"
FT                   /translation="MDIQPVYLETDIDEVYVRHVCDKGDEFFVKMIKPKNTKYMLYVSG
FT                   NSLACPICNNMAKKTTEAPLPQSR"
FT   CDS_pept        560053..562071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0578"
FT                   /product="putative histidine kinase"
FT                   /note="Contains two PAS domains (IPR000014).; Contains two
FT                   PAS-associated, C-terminal domains (IPR000700).; Contains
FT                   one GAF domain (IPR003018).; Contains one ATP-binding
FT                   region, ATPase-like domain (IPR003594).; Contains two PAC
FT                   motif repeats (IPR001610)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0578"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60650"
FT                   /db_xref="GOA:D1YW28"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D1YW28"
FT                   /protein_id="BAI60650.1"
FT                   /translation="MLRGEEARRSRAEQMAHIGSWCMDIKLDIMACSDEFYRILGYQPG
FT                   ESTITVEQFKKNVHHEDIQYVDEVFNRSIREKKPYEADFRILRKDGSACDVHAITEFEY
FT                   GESGDVRFIYGTVQDITGRKRTDEALKYRSELEALITTLSTRFIKLAPEELDPALNDAL
FT                   RKIGEFAGVDRSYIHQTTKDGKMTGITHEWCREGVGPSMEFGKQLDIMETYPWVSGFLR
FT                   KLEVLHVPSVEDLPPEAEVEKRLLSASRVLSLVAVPMVCNREFIGVLGFDSVRNRKAWT
FT                   EDDIAILRIVGEIFANAIVRSETERALRDSEERFRATFEQAAVGIAHVSPGGRYLRVNR
FT                   RYCNIVGYSHGELLSRNFQSITHPDDLEEDLGNLASLISGRIDTASMEKRYIRKDGSII
FT                   WVTLTTTAVRGPEGIPKYVISVIEDITARKRAEAEMQEARMRAELYVDLMGHDIGNMNQ
FT                   AIMGYLEMAQDTVKLKDDEREFIEKPLELVKGSSALIDNVKRLQRARSGEAPVQVVDIV
FT                   PLIMSLAACYSNSSGKSAGLDFNTGAVYRVVANEFIKDLFSNIIENAVKYSRSDVRIGI
FT                   SPVERNGKPFYRVSVEDNGPGVPDEQKAGIFSELAGREKYARRRGLGLQIVKTLVKAYG
FT                   GKVWVEDRVPGDHEQGARFVVMLPALDQVAAMNAGEK"
FT   CDS_pept        562123..563094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0579"
FT                   /product="putative esterase"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0579"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60651"
FT                   /db_xref="GOA:D1YW29"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D1YW29"
FT                   /protein_id="BAI60651.1"
FT                   /translation="MATIGTITRGIEPATRSFLEKINASKGPQIYEMSVEDARDTLSSV
FT                   QAVEVSKMPVDVEETVLPVGPEGRVNVHIVRPKGSMETLPVVMYYHGGGWVLGDYNIFE
FT                   RLVGELANKANSAIVFVDYSRSPGAKYPVAIEEDYAALEYVAGHGKELNVDSSRLAIAG
FT                   DSVGGNMTAVVSMMAKQRQGPKIGFQVLFYPVTDASFDNASYRQFATGYWLTREAMKWF
FT                   WDNYLPDRPERNNPMASPLQAPVDQLKGLPPALVVTNEYDVLRDEGEAYAHKLMEAGVR
FT                   TTGVRFLGAIHDMVMLNAIANTPAPGSAIDLASDMLRRSFAK"
FT   CDS_pept        complement(563931..564614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0580"
FT                   /product="conserved hypothetical protein"
FT                   /note="Belongs to the Protein of unknown function UPF0153
FT                   family (IPR005358)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0580"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60652"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="UniProtKB/TrEMBL:D1YW30"
FT                   /protein_id="BAI60652.1"
FT                   /translation="MDELIIRNKYKVVNGKDFTCEACGACCSIYSLVDLHITDIFRMAE
FT                   KLGITPKEFFEKYVTVIEKDGAHTFAMNIEGGCKFQKDKKCAIYEARSDFCAFYPNSHS
FT                   CFDLSQTQKKEIKPKNPGCSAHKQPDNLILIPDLERMAESRIYYMVKEMYLAQHGGVYD
FT                   EEGMKAAHKKGLAQAANARMREIVHMQIMSEIMQNIPVDDETGEPVLTRDEVKMIYKKM
FT                   REKRS"
FT   CDS_pept        564717..565475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0581"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains one Ku domain (IPR006164)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0581"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60653"
FT                   /db_xref="GOA:D1YW31"
FT                   /db_xref="InterPro:IPR006164"
FT                   /db_xref="InterPro:IPR009187"
FT                   /db_xref="InterPro:IPR016194"
FT                   /db_xref="UniProtKB/TrEMBL:D1YW31"
FT                   /protein_id="BAI60653.1"
FT                   /translation="MQAIWSGNLAFGTILIPVRMYAASEELRVPFHLVHAEDGGRVKYK
FT                   KVCELDGKELHMSDIHKGYEIGDKMLQFTDEELDELRPVLSKSLKILGFCEQEEVPLLA
FT                   LEQPFYLGTESRKKGVAQPFALVKKAMEKSGKVAIVSWVTRASEQIGMMMPYEKGFLIK
FT                   AILYQQQIRPFDRVEVQESEVSEDLIDKGIMLIERMTFKFDHAAYKESYSQALREIIEA
FT                   KALGKEVKVEPVVKSAETRSLEAELERMLV"
FT   CDS_pept        complement(566140..567018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0582"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0582"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60654"
FT                   /db_xref="GOA:D1YW32"
FT                   /db_xref="UniProtKB/TrEMBL:D1YW32"
FT                   /protein_id="BAI60654.1"
FT                   /translation="MARDRFNQRVFLNVAAVAFLLMVVLAIGVFIGRTLTMNDGSDDPT
FT                   VVPSVAVSPTILPTASPSSDVTVTSTPAASATATPTVTATPTATATPTPTVTVTATPTV
FT                   TPTATPTPTPTATPTPTPTPTVTPTPTATPIDLPADTPFYESITPLKDKDQFSLAPVEN
FT                   SYIAGDGPLYLDLGNSYMGSGWAYPGDTIGVKLKMYNDGPALNTNARVTLNLSRMVITP
FT                   YGSFWLDDIIPGQQFTTQIAVGEKGSFTKNLSYAVPNVTGYKGFYKITVKFYVNDQFNC
FT                   GFVKELNILDP"
FT   CDS_pept        567198..569324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0583"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0583"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60655"
FT                   /db_xref="UniProtKB/TrEMBL:D1YW33"
FT                   /protein_id="BAI60655.1"
FT                   /translation="MKKYTNARLVFTRLACVFMAITLAMLLCAACSAAQQYSSQALPDD
FT                   WPQTISVPGMEKVTGLVQGENNLSYSINIISEDSGKINFQVNAFCVYNPASDYAMLHIL
FT                   NNPLPGVVDQDKKTLQIDFSPLDTGLKSVSIIDKSDVSKVLMQDKNSLVLNTAMAVDSA
FT                   DESQVKFSITDMSLMQPDGVLNEFSLPEAVPAYYSPETDRFSTVAFDEMASVMQQNYVL
FT                   IQQNTYVNVVNIVNEVNVINVVGFGGYGGWGCGYGGGIPYSGCGYGDYGGYGGCGDYYG
FT                   GYGGGYAPYCDPLPLVNPGPVPPLGIPHDVPVYRARHSGLDDRMPIAERRDHGGRYSDA
FT                   GGRYSDGGPGFSEGPGDRMAPYTGQNVVPGNTIAADNPVAPMGQGISTPAFTQSRPDTG
FT                   VDRTSVRSVGSPARRTSDLSKPVVDSVSNPTTRVTRPATTVTQDRPNPRSASTNLRSAN
FT                   APAKQTSARSTPALQTTNSRPTTKITAPVASTSLDQTRPNARTAPTSVKSASAPTVTRT
FT                   NTQPSKQTVTRPVTQSVRSPASSSQKSTSVQHAPEASSPKTTSVQQAPAVTRTSSQPAK
FT                   QTAARQTPSYKSGSAPQTVKSSASPAHKATSVQRSPAVSAPKTTSVKQAPATTRTSSQP
FT                   SKQTVTRPATQTVKSPASSQKAASVQRAPQASSPKTTSVRQAQAPARSSKSSAPSAPSH
FT                   AVSRPSSSGGGRKK"
FT   CDS_pept        complement(569609..570172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0584"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains one CopG-like DNA-binding domain
FT                   (IPR002145)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0584"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60656"
FT                   /db_xref="GOA:D1YW34"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="UniProtKB/TrEMBL:D1YW34"
FT                   /protein_id="BAI60656.1"
FT                   /translation="MNAPIRVTISFDEKSYRNFEALRGEIDVSQSELIRRAINYYYENR
FT                   SSLDSPPDERVSGYKDMLGNGEHIILDVDHWLLFLKTVESSSNQSEFWNTHRDIARSHA
FT                   EQLAKKVTSPEALLKRLETCNLFKISRSDSAPNEYTLLTGSGTQRRFVREFLEETFAGM
FT                   GFDANIKEDYSKLRVTLNGEKEIQ"
FT   CDS_pept        570447..571652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0585"
FT                   /product="ammonium transporter"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0585"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60657"
FT                   /db_xref="GOA:D1YW35"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:D1YW35"
FT                   /protein_id="BAI60657.1"
FT                   /translation="MPINAGDTAWIIAASALVMLMTPGVGFFYGGLVRRKNIISMIALS
FT                   FIAFALVSVQWVLYGYSLAFGPDVGGLIGGLNNICLQGIGLEPTGSSTIPPMLFMLFQM
FT                   TFATVTLAILTSVFAERVKLSSFIVFGLLWTTLVYDPIAHWVWGGGWLAQLGVLDFAGG
FT                   IVVHISAGFSALAILLVIGKRIGFGRDLMEPSNIPVALIGMAMLWFGWFGFNGGSALAA
FT                   NGLAVNAIVVTNTAAAAGALVWMLLSWKDGRPASLGIVSGAISGLAAITPAAGYVDIFG
FT                   ALLIGIIAATVCYIALTFRIRNGWDESLDAWSIHGVGGLLGVFAAGVLATTAINGYSGL
FT                   LAGNVHQLAIQVIAIVATVLYSLIVTFILAKGVDMIMGLRVKEEEEYVGLDISQHGERA
FT                   YT"
FT   CDS_pept        571677..571997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0586"
FT                   /product="putative nitrogen regulatory protein P-II"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0586"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60658"
FT                   /db_xref="GOA:D1YW36"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:D1YW36"
FT                   /protein_id="BAI60658.1"
FT                   /translation="MKMVQAIIRPEKMEAVKKALEEKGFIAMTIIEVRGRGEQKGITLE
FT                   FRGKKVDVDTIPKMKLEIVVKDEDVEIIIDTIRASARTGKVGDGKIFVLPVERMCKVRI
FT                   DD"
FT   CDS_pept        572205..573446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0587"
FT                   /product="ammonium transporter"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0587"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60659"
FT                   /db_xref="GOA:D1YW37"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:D1YW37"
FT                   /protein_id="BAI60659.1"
FT                   /translation="MVISSGDTAWLLASTALVMLMTPGVGFFYGGLVRRKNLVSMITLS
FT                   FVAFALVSLQWVLFGYSLVFGHDIGGLIGGLDFLGLSGVGQSPAVIVGTELTVPSLAYM
FT                   IFQLVFATVTLAIVTSVFAERVKLSSFIIFGLLWTTLVYDPLAHWVWGGGWLANLGSLI
FT                   GLTGGALDFAGGTVVHISAGFSALAIALVIRKRMGFGTDMMEPSNIPLALLGAALLWFG
FT                   WFGFNAGSAIAANGLAANAFVVTNTAAAAAALAWMLLSWWNGRPASLGFASGAIAGLVA
FT                   ITPAAGYVDPLAAIIIGIVAGAVCYYAMIYRIKKGLDESCDCWSVHGMGGVVGALLTGV
FT                   FATTAVNNYSGLLAGNVDQFIIQVIAVLVSVSYAFIVTFVLAKVLDSTIGMTVKEEEEY
FT                   VGLDISQHGERAYP"
FT   CDS_pept        573457..573786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0588"
FT                   /product="putative nitrogen regulatory protein P-II"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0588"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60660"
FT                   /db_xref="GOA:D1YW38"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:D1YW38"
FT                   /protein_id="BAI60660.1"
FT                   /translation="MKMVQAIIRPERLDAVKKALEDQGFIALTIIESKGRGEQKGITLE
FT                   YRGKKVEVDMLPKIKIEVVVHDEDVEKIISIVRGAGRTGKFGDGKIFVMPVEMMAKVRT
FT                   DEVWT"
FT   CDS_pept        573890..574783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0589"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0589"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60661"
FT                   /db_xref="GOA:D1YW39"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:D1YW39"
FT                   /protein_id="BAI60661.1"
FT                   /translation="MSDMKKGARKPKDSPEAGRQIKPELVTSALIAALYALFLIETIWE
FT                   GSLAALAFSVLLFAIMVLMSYFVDRGKLHKKELFKSLIYVFAGLSALSMIVELLRYLNV
FT                   PGMAGVYWAAVLGIASAIASVAIIAGLIYLEKDELKRLYVGLGDKKAAGLGVIGLVLCV
FT                   AAALVGAYFMFGGNAIGQEKFIQIAASAIVFGILAGIVEELWFRGLLLSRILPLLGESQ
FT                   GNIYQAAVFGVFEAVIFYTITGLIAYLPVIFIIGAFTGFYWGRATLKAGSMAAPVLLHV
FT                   GLYILLLLPIMTGLMS"
FT   CDS_pept        574888..576156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0590"
FT                   /product="conserved hypothetical protein"
FT                   /note="Belongs to the Conserved hypothetical protein 300
FT                   family (IPR005239).; Contains one LOR/SDH bifunctional
FT                   enzyme conserved region domain (IPR007545)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0590"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60662"
FT                   /db_xref="InterPro:IPR005239"
FT                   /db_xref="InterPro:IPR007545"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:D1YW40"
FT                   /protein_id="BAI60662.1"
FT                   /translation="MEAMREIELRGHIIDSFLLPKVFDKVMDMNGEFEIIEFEIGKHKT
FT                   DTSYARLMIRGKDQEHLDDIIGELHRLGAYVPEAEDAVVAEAPKDKVVPKGFYSTTNHP
FT                   TFVKVDGEWLRVKNQKMDSLIVLRNGSAACKTIGHVKKGDRVVIGNSGIRVVPPERPRG
FT                   HTIFDFMGSQVSSERPSQSLIREIAEEIFEVHESGGKIVVVGGPAIVHTGGQQALAELV
FT                   RKGYVDALLSGNALAVHDVEYNLYGTSLGMDLKTAELAPEGHKHHLYAISEITRAGSLK
FT                   EAVKQGVLTGGIMYECIVNNVPYVLAGSIRDDGPLPDVITDTMKAQDLMREQVKNADIV
FT                   LMMATMLHSIATGNCLSSSVRTICVDINPSTVTKLMDRGTAQAIGIVTDVGTFLPWLAE
FT                   ELDNLEKSRKKQMPALRVKSKKR"
FT   CDS_pept        576252..576821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0591"
FT                   /product="putative methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0591"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60663"
FT                   /db_xref="GOA:D1YW41"
FT                   /db_xref="InterPro:IPR008854"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:D1YW41"
FT                   /protein_id="BAI60663.1"
FT                   /translation="MYEGRPPWDIGRPQPAFVKLFRDGEIKRGRILDVGCGTGENALFL
FT                   AEAGCDVTGVDIAHRAIELAKEKAAKRNKSVDFFVCDVLTLGSCFREGEFDTVIDSGLF
FT                   HTLADEDRPVFLKQVFSVLKSNGEYFMMCFSDKEPGEWGPRRVSKGEIIGALEPHFRIN
FT                   YIKDAAFESLTRRGGSKAYLVSANKK"
FT   CDS_pept        complement(576844..577422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0592"
FT                   /product="CDP-alcohol phosphatidyltransferase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0592"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60664"
FT                   /db_xref="GOA:D1YW42"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="UniProtKB/TrEMBL:D1YW42"
FT                   /protein_id="BAI60664.1"
FT                   /translation="MSWLYAFKPFKDQALRSISHTLFAMRVTPNMVTICGLFMSLIAGV
FT                   LAASGHLYAGIFFFMIGACLDAIDGSLARACGLCSEFGRYFDSACDRISELAFIAGAVI
FT                   GGAPVLAFAVIAGSVLLMASRINNHIKGLNSNAATFGRPERIALLVAGLLSPAPYNIAI
FT                   FLVAGLLCVVSSAQVLASGMRIRAVIRPQ"
FT   CDS_pept        complement(577469..577957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0593"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0593"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60665"
FT                   /db_xref="GOA:D1YW43"
FT                   /db_xref="InterPro:IPR007318"
FT                   /db_xref="UniProtKB/TrEMBL:D1YW43"
FT                   /protein_id="BAI60665.1"
FT                   /translation="MSMSMLRSQKIKKMRIEGAGPKIMLPLFVTFAITAWISYAYRPMF
FT                   NYPLVPAEWTLALGALFLLVGVPFWLLSTVMFLLAYFGGQLETRGPFAIMPNPIYGSWI
FT                   VFVIPGISLVLNWWPVLLTSVVMYVAQRMFIREEDDALREKFGRQYEEYRKKVLIKFL"
FT   CDS_pept        complement(577967..578545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0594"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains one Flavodoxin/nitric oxide synthase domain
FT                   (IPR008254)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0594"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60666"
FT                   /db_xref="GOA:D1YW44"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:D1YW44"
FT                   /protein_id="BAI60666.1"
FT                   /translation="MNALMIIGLVVVGIILLVAAIGIAMGALFCGDIMSYTDTGSKVLS
FT                   PAGASSGKALVVYNPGLSGASKNAANEIAGDLQSKGYTVTLAGIKSTAAANTTGYDVVI
FT                   AGGPMYWGRVSNSVDAYLKALKPQKGMAVGVFGTTGAPQFNDGDIATFGEQVTIDLGGV
FT                   VLDKKAATKTIRSGDAANRDCSDFVSAVV"
FT   CDS_pept        complement(578599..579276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0595"
FT                   /product="TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0595"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60667"
FT                   /db_xref="GOA:D1YW45"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D1YW45"
FT                   /protein_id="BAI60667.1"
FT                   /translation="MEISMAVKRKSGRPVKVPGEKETKEKILDAAIDLFAARGYDHVTI
FT                   RDIAAAVGIKESSIYKHYSGKEEILGKIFEYVLLRWDQSKVGRWSDSDEAEAQIVSMGL
FT                   DGFMAMAIGVSGSWLEDPRMEKIMRIAFIELYHNDQVKNFMLTFFGAGPEFFEASFAIL
FT                   MKHRLIKPADPKVLTDEYMSFYMMALVDHFLLRYGSSSKSFVEEYGARIEEHNEFFKNA
FT                   IRP"
FT   CDS_pept        complement(579375..580454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0596"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains one Radical SAM domain (IPR007197)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0596"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60668"
FT                   /db_xref="GOA:D1YW46"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D1YW46"
FT                   /protein_id="BAI60668.1"
FT                   /translation="MEMENNNDLNRMINEMIRGIFSDALGVSLKDPAMAAFFVRAALAQ
FT                   KKAAAVRQYNEEHGVHVPPVMILSITNKCNLHCAGCYSRLVPRERKPELDEAGLRNVLK
FT                   QASELGISIVLVVGGEPLTRPEIFNVTKDFPDMIFTLFTNGTLIDDAVIQKFKEQKHVI
FT                   PILSMEGHENITDLRRGSGTYDRLMRDMTKLCERGVFFGSSLTVTRMNYDEVTGEPFVK
FT                   RMREHGCKAFIYVEYNPVKKGTEDWVVTDAQRDEILAKMAAYRKSQPGVYIGFPGDEKL
FT                   FGGCLSSGRGFIHVSASGDLEPCPFAPFSDSSILDMPLKEALNSKLFRALRANRDQLME
FT                   SNGGCALWKKPEWVKSLTE"
FT   CDS_pept        complement(580463..581104)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0597"
FT                   /product="TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0597"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60669"
FT                   /db_xref="GOA:D1YW47"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D1YW47"
FT                   /protein_id="BAI60669.1"
FT                   /translation="MAIRNDIATDSNDKTTKQRIFEASLDLFAQKGFDAVSMREIADAV
FT                   GIKKASLYSHFASKDALIEQIFNYPTMALELAGPKGENAETMIVSMGVEGFMKMACGVF
FT                   NKWIAAPDMEKVWRIICIELYHDKRIKKFYDQFSGDAIAFWASNFRIMRKHGLIKTVDP
FT                   EVLAREYLSFYIYTFMDYFIAHFDGDGTFLEANEAKLDKHMKFLVNSIKA"
FT   CDS_pept        581259..581447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0598"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0598"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60670"
FT                   /db_xref="UniProtKB/TrEMBL:D1YW48"
FT                   /protein_id="BAI60670.1"
FT                   /translation="MLSNGEIYHMAFRLWEEVIKKHKQLSVVELRDHLKELNRQDMPQE
FT                   QLEEKAREWIKEKTNQG"
FT   CDS_pept        581550..582236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0599"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0599"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60671"
FT                   /db_xref="UniProtKB/TrEMBL:D1YW49"
FT                   /protein_id="BAI60671.1"
FT                   /translation="MQRHKITIALALLLASLMLVSVVAVASQDAGLKELRWGGRKAGGG
FT                   IDIVYHTIQVTGTTGDSMTFNILNTAVKGKSGNVTTKTYTPPVTATYYFSNDTAVLKGK
FT                   PAGMMERARERGRQGPPTKGYNDATINVAGASAVIALKNMTINRVDRNTTEVQFGAFSV
FT                   YLPDGTVKSYKLDTPVKDVRSRMEMTRKITGNPQFRADLQDALKGGATFPAGTAPVPLK
FT                   TIDSKM"
FT   CDS_pept        complement(582253..583044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0600"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains one NADPH-dependent FMN reductase domain
FT                   (IPR005025)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0600"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60672"
FT                   /db_xref="GOA:D1YW50"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:D1YW50"
FT                   /protein_id="BAI60672.1"
FT                   /translation="MKILAIMGSPRGRGAGYKIVKMVEERMKAMGDAEFEYLFLKEADL
FT                   KPCIGCFNCVARGEDKCPLKDARADIEKKMLEADGIILSSPGYVQNVSSHMKNFMDRFA
FT                   YTNHRLRFFRQKVLLVANSGGAGLNETLAAMRIALGGARVVHELGVGTPPWPQTIGAVA
FT                   KKEKAISFAAEKFYRACLDTSLPSPTFNEYMRFLIQRNVAFGCKEWLPADFEFYSGKDY
FT                   FYETKISPAMGAAARTLVGLMMGMMKDMGPGEVKWPMEAKK"
FT   CDS_pept        583144..583425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0601"
FT                   /product="conserved hypothetical protein"
FT                   /note="Similar to Putative general stress protein B in
FT                   uncultured methanogenic archaeon (Q0W564)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0601"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60673"
FT                   /db_xref="InterPro:IPR038956"
FT                   /db_xref="UniProtKB/TrEMBL:D1YW51"
FT                   /protein_id="BAI60673.1"
FT                   /translation="MRTKYERGERMAEKKTEKKGDMTVEEAGHKGGEKTAETHGKEFYE
FT                   KIGHKGGEETAKTHGHEFYQEIGHKGGEKGGQKVKRLIEEGKEAEEKK"
FT   CDS_pept        complement(583433..585004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0602"
FT                   /product="putative histidine kinase"
FT                   /note="Contains two PAS domains (IPR000014).; Contains two
FT                   PAS-associated, C-terminal domains (IPR000700).; Contains
FT                   one ATP-binding region, ATPase-like domain (IPR003594).;
FT                   Contains two PAC motif repeats (IPR001610)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0602"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60674"
FT                   /db_xref="GOA:D1YW52"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D1YW52"
FT                   /protein_id="BAI60674.1"
FT                   /translation="MHSGAAPGGNKDEDKTREELLVELRSLRASAADAWRETDRIFRAV
FT                   ADSSRAGILIYQGDDTIYVNRAMADIEGYTIEERLRMKFWETIHPAFQDRVRMKGADWK
FT                   KGIDVPARSELKLIRKNGEERWAVVSSGVFTLQGKPAVLLIMQDITELKRAEEALKKSQ
FT                   YILAKAQQIAHVGNWALNMNTGQYNFSDEAYRIFGYEPGSVRPTRGWVTSRVYADDRQI
FT                   VSDFYRTIARERKRCSVDYRIVWPDGTIRYVNSVADKIVVGKSGLPERVYGINQDVTDR
FT                   KLAEEALLKAKNEAELYVDLMGHDINNMNQISMGYLELAHNILDFEGKLSPENGHLLEN
FT                   AIHSLENSSKLIDNVRKMQRERMGLYEAEVIDVSALLEEVAAQFSLVPNRDVSISCMPG
FT                   EACLVKANVLLKDVFLNLVGNSIKHSTGPLKVDIHIEKIEHDGLPCFKVAVEDDGPGIP
FT                   DSLKLTLFDRLNLATTRARGKGFGLCLIKMLVDDYGGQFWVEDRVSGDCTKGARFVVVL
FT                   PEYNNG"
FT   CDS_pept        585178..585864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0603"
FT                   /product="conserved hypothetical protein"
FT                   /note="Belongs to the Protein of unknown function DUF47
FT                   family (IPR002727)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0603"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60675"
FT                   /db_xref="InterPro:IPR002727"
FT                   /db_xref="InterPro:IPR018445"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:D1YW53"
FT                   /protein_id="BAI60675.1"
FT                   /translation="MADPIRTILNLFARSPFKPLDEHAEKVKLTVLKMDEAVRAYVEED
FT                   KAKVEALYRQISELEHEADKVKHAIREHMPSSVLMPVDRADMLSYLKQQDDVANSAEMV
FT                   AQLLEIKMVPMPRAVKDVLLKMDGEVLVTVEEHVAASNKIIEILDSSSVSKHMAEAQGL
FT                   IDRVDSQKHNVDVTRLEAMQTVYAHEKELGPVGVYHLLAVIRDLGWVAEHAESASNRLR
FT                   LMIAKR"
FT   CDS_pept        complement(585879..586091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0604"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0604"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60676"
FT                   /db_xref="UniProtKB/TrEMBL:D1YW54"
FT                   /protein_id="BAI60676.1"
FT                   /translation="MPGFFMPTPRALYIGDKNMCISCGCGQPNDNHGKSELITMDELQK
FT                   AAKAANQSVDDAAKNIAESVGLSCK"
FT   CDS_pept        complement(586108..586347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aif1a-1"
FT                   /locus_tag="MCP_0605"
FT                   /product="translation initiation factor 1A"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0605"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60677"
FT                   /db_xref="GOA:D1YW55"
FT                   /db_xref="InterPro:IPR001253"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018104"
FT                   /db_xref="UniProtKB/TrEMBL:D1YW55"
FT                   /protein_id="BAI60677.1"
FT                   /translation="MLGTVISMLGASRVVVRCIDGVTRMCRIRGKMKKRVWVREGDVVI
FT                   VVPWEIQDEKGDVVWRYTGPQVSWLERKGFLKNA"
FT   CDS_pept        586651..587313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0606"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0606"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60678"
FT                   /db_xref="GOA:D1YW56"
FT                   /db_xref="UniProtKB/TrEMBL:D1YW56"
FT                   /protein_id="BAI60678.1"
FT                   /translation="MFLVMRLDRDLLSAEAERKLFHIAWAIDPLLYYFGYPRDGMLLLI
FT                   GCQLLIWIGFEAARGMGYSAFSTSYMRPEEARGAPMGTLFQVASLFLAVLLFDKSIAII
FT                   AMVFNCVGDSAVGLAGAVLYPYIGREKAAIREQGVRGLWNMLKSHKAPVLMAVMFLACV
FT                   VPGFILFPRASPLLMGVGALGAVIADAFAWKLFGYTLNDDLTITLAAGSAMAIAASF"
FT   CDS_pept        complement(587314..587850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0607"
FT                   /product="conserved hypothetical protein"
FT                   /note="Belongs to the Protein of unknown function DUF46
FT                   family (IPR002726)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0607"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60679"
FT                   /db_xref="GOA:D1YW57"
FT                   /db_xref="InterPro:IPR002726"
FT                   /db_xref="InterPro:IPR032690"
FT                   /db_xref="UniProtKB/TrEMBL:D1YW57"
FT                   /protein_id="BAI60679.1"
FT                   /translation="MWDLIFTALWLMLPAYTANNCATLFGGGRPLDGERSFFDGKRILG
FT                   DHKTFRGFFLGVLGGIGMGVVQVIAAPYMMAYFTVPAMPPAVIIALPLGALAGDAVKSF
FT                   FKRRLGVESGAMLPVADQLDFVIGALVLGLIAAPQWSLAYYTIPVVVTIVLMTFPLQLF
FT                   HNMVAVALGKKKVLW"
FT   CDS_pept        587955..588647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0608"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0608"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60680"
FT                   /db_xref="UniProtKB/TrEMBL:D1YW58"
FT                   /protein_id="BAI60680.1"
FT                   /translation="MEKRGMRLNHLLTALLIVAVVAALSGCICCFGQDGFFSKLKKPVS
FT                   AIQFPSALKIGQKTYNKAYSNEYLDRDSAKSGLKAFARKLGYGSGDMQGLVDKAIELSG
FT                   INQYKSFKYTDGSAKGIVGGLVAKTDAPSTVTGGYEAIKQSATAGQSAINDPSQNTGDV
FT                   RNVVSGGSSSLGDGGDRYTMTVNGETCYVVVVKYSNMYISAYSFESYDACDAAIAMAIE
FT                   QVDIAASS"
FT   CDS_pept        588650..589204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0609"
FT                   /product="CDP-alcohol phosphatidyltransferase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0609"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60681"
FT                   /db_xref="GOA:D1YW59"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR004570"
FT                   /db_xref="UniProtKB/TrEMBL:D1YW59"
FT                   /protein_id="BAI60681.1"
FT                   /translation="MKGLANLVTLSRFVFIFLAAICIIAYSPAHDEYRWATLCLVVLAI
FT                   LSDIADGKVARLLNQESSLGAAMDAVADALGFTLGFIFLSFFDLGMKFPLWFVVIVVGR
FT                   EVAVYGLYLAVMLKKGRVDRKPSRLAKWNTTLLAVCVVLLLLRFEYAWPLWLLASLTTI
FT                   VTGTENIAYSWDALRAASRKS"
FT   CDS_pept        589709..590218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0610"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0610"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60682"
FT                   /db_xref="InterPro:IPR018990"
FT                   /db_xref="InterPro:IPR036331"
FT                   /db_xref="UniProtKB/TrEMBL:D1YW60"
FT                   /protein_id="BAI60682.1"
FT                   /translation="MEVLLVLPLIMLVSLMLAMAPALAMGTYTGSDNGKAIAVKSGETF
FT                   TVKLDENPTTGYSWNMTVGDGLKIINDRYVANNTGLVGSGGYHIWTIQATKPGTYKVAG
FT                   VYKRPWEPLTGGEQKYSLSVSVTAAGAGPTVPINMKFQVPSMADLTPKFSFNFSSMMSH
FT                   FPKLIG"
FT   CDS_pept        complement(590215..590952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0611"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0611"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60683"
FT                   /db_xref="UniProtKB/TrEMBL:D1YW61"
FT                   /protein_id="BAI60683.1"
FT                   /translation="MGWMAVSCTMALLLLLAGTACADTGHFGVTFDGCRDTGDTGLLSV
FT                   LETAYEQVNGLFGTCPDHVETVIISDGAMDRVGKQVDSFSGWNKEFSVIILRNSSLQRR
FT                   SSLRFLGAHELTHLAVNELLFKKDPAEFHWMEEGICTLASGEPMDDAEASRYILEHGFL
FT                   DTGEIFDAIKSEDCAVSKNGYMQSYSLVKYMEGRYGFDMIKKLLGCPEECFDAAFRQCA
FT                   DESFASVYDDWKAYVISTGHAAA"
FT   tRNA            complement(591022..591099)
FT                   /locus_tag="MCP_t0012"
FT                   /product="tRNA-Pro"
FT   CDS_pept        591312..591872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0612"
FT                   /product="AsnC/Lrp family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0612"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60684"
FT                   /db_xref="GOA:D1YW62"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D1YW62"
FT                   /protein_id="BAI60684.1"
FT                   /translation="MVDLDEKDRKILSLFESNPDVSQVEIAEQVGLSQPTVGARIGKLK
FT                   QTGVISTIAGMNLLKVGLRMAKVDVTTKDSIKVINQFKNCPYFLNGLVVSGKENLCMYF
FT                   VAEDISSVEAIIDKHIRSDPAVMDVDLGIVITSVNDLIQPVKLNVEKSDLTPCGHDCTA
FT                   CEYYTNNRCLGCAASKAYKGNFW"
FT   CDS_pept        complement(592454..594178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lig"
FT                   /locus_tag="MCP_0613"
FT                   /product="DNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0613"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60685"
FT                   /db_xref="GOA:D1YW63"
FT                   /db_xref="InterPro:IPR000977"
FT                   /db_xref="InterPro:IPR012308"
FT                   /db_xref="InterPro:IPR012309"
FT                   /db_xref="InterPro:IPR012310"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016059"
FT                   /db_xref="InterPro:IPR022865"
FT                   /db_xref="InterPro:IPR036599"
FT                   /db_xref="UniProtKB/TrEMBL:D1YW63"
FT                   /protein_id="BAI60685.1"
FT                   /translation="MLFSALVDVFEKLRKTSSRLEKTAIIADFIKGVPADDLPVIVAFL
FT                   TGRVFPLWDERKIGIASQTVIKIISTITYNPENKVVESYKNTGHLGVTAEEMFQKRKQT
FT                   MFFEADEITVRNVYDTFVEIARLTGAGSATKKQKVLIGLLHRATPKEAEYIVSLAMEYV
FT                   LSGAKEGVMEEAIARAFGVPVELVRRSNMLISDLGETARVAMLTGEAGLQAINIRPMRP
FT                   VRPMLAQNVASIQEALDAMGGRADFETKYDGARLQVHKLGDEVRLYSRRLENLTDALPE
FT                   IVDYVRQSVKADSAILDSECIATDPKTGRPVPFQNILTRLRRIYNVEEKKKLFPLFLRP
FT                   FDILYLDGESEIDKPFIERRQILETTILPLDETCKPAMALITDDVKAAQDLFKESLKSG
FT                   NEGLMAKDLNATYTPGVRGKKMVKIKEVLDTLDLAIVSSEWGHGRKAGWLTSFEVAALD
FT                   ENTDQYVVLGRVASGFSDEQLQEMTERLKPLITAEHGRIVDVKPDVIVEVKFQEIQKSP
FT                   IYSSGYALRFPRLVRVRDDLSPEEVNTFGRVMNIYDISHGIGVKHAEPQPDGAQKEP"
FT   CDS_pept        complement(594266..594709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msrB"
FT                   /locus_tag="MCP_0614"
FT                   /product="peptide methionine sulfoxide reductase MsrB"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0614"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60686"
FT                   /db_xref="GOA:D1YW64"
FT                   /db_xref="InterPro:IPR002579"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="InterPro:IPR028427"
FT                   /db_xref="UniProtKB/TrEMBL:D1YW64"
FT                   /protein_id="BAI60686.1"
FT                   /translation="MTQVSKPPKEELKKKLTPMQYKVTQEQGTEPPFQNEFWNEHREGL
FT                   YVDIVTGEPLFTSKDKFDSGCGWPSFTKPMEKGKVEEKIDTSHGMVRTEVRGKGSDSHL
FT                   GHVFNDGPGPSGLRYCINSAALRFIPKEDLEKEGYGEYRKLFE"
FT   CDS_pept        594816..596195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0615"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0615"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60687"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:D1YW65"
FT                   /protein_id="BAI60687.1"
FT                   /translation="MDASRSLNIARRRFQNGNYMLSLKKFPAARKEFEVALSIFEKGDA
FT                   YRETAEALNNIGITYVKEGEPEEAKGYFERSYELKKVHDEACDSPGSKSPVRESLFNSL
FT                   YNIVGLGDALTPEEFEKYFLEMKALGDSLGGEHAGIVAKEQQAYDRFVEAKEAERKRQE
FT                   EEALARTTPAGALAHLERLGKPCVIGLRFALQGITVTVPEFSYDDGVRVRLSGITPGDG
FT                   MSAGEIEFRVDYDSVREFLEKTEEPALLEEAFEHVKKFMEAVALVREDIDFCVGKRGYS
FT                   VLSITLKNAFGDPVEIYHADAAAPVAAAALTGEDAMLVGMMLSAKHGLYKMLLLNAKRS
FT                   MAEENHSLCIVDAVASFEAFMDLLLKKALPEAEKKDYLSMENPCLRERLRFMKRLIGGT
FT                   DASDSLEHYMGDVGRDMDDVLAYYDSIMGNDEHTIGAYESRKALVAVSRAIYNLKALYD
FT                   I"
FT   CDS_pept        complement(596822..597673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0616"
FT                   /product="putative universal stress protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0616"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60688"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D1YW66"
FT                   /protein_id="BAI60688.1"
FT                   /translation="MVMHVERRTISAEEGILHDSVVVPISRPETIESIVNIACDMLADD
FT                   GTLRLLYVIEVPYQLPLEFAETRKTKATELLAMAADHSRKRGFTPRQEVVVARDIPQAI
FT                   LDMADRYKADLILMGSSQRSVPEKVLFGSIVGRVLREAPCEVIVYSYPKTMQPIKYDRI
FT                   LVPTSGFKHAWRALDIALHFQMLFGSSVASLYVGDDRAKADQIQDSARTHAEQLGSKIE
FT                   TLYKTGSVVDTIVDIARSGGYTLIIIGSTERPSYYKFLLGSTADEVVTRAPCNVLIVRT
FT                   KK"
FT   CDS_pept        597804..598220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0617"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0617"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60689"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D1YW67"
FT                   /protein_id="BAI60689.1"
FT                   /translation="MPRLTKNEDVCITCHRCETICAWVHEVVFNPDKGRVIVDLDYPDE
FT                   HRLRICIQCGRCADACPMDAFYQDFNILTTSEQGIYRLDESKCTGCGECIEACPTKVLQ
FT                   FYPDRRVPRKCDFCLGQPMCARYCPTNALGWVLM"
FT   CDS_pept        598217..600121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0618"
FT                   /product="tungsten-containing aldehyde ferredoxin
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0618"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60690"
FT                   /db_xref="GOA:D1YW68"
FT                   /db_xref="InterPro:IPR001203"
FT                   /db_xref="InterPro:IPR013983"
FT                   /db_xref="InterPro:IPR013984"
FT                   /db_xref="InterPro:IPR013985"
FT                   /db_xref="InterPro:IPR036021"
FT                   /db_xref="InterPro:IPR036503"
FT                   /db_xref="UniProtKB/TrEMBL:D1YW68"
FT                   /protein_id="BAI60690.1"
FT                   /translation="MTTGGYTGRLLRLDMNELDFSVETPREEDLKDLIGGEGLGIKYLY
FT                   DEVPAHADALGPDNKLVFMTGPLTGTLAPTSGRHCVVTKSPLTGLETTAHAGGYWGPEL
FT                   KFAGYDGIIVEGQSEKPVYVFVDDEEVHFYKADGLWGRDTIQTDTLIKRQLDDDKLNIT
FT                   YIGPAGENLVKYATIMNDQQRSASRGGPGAVMGSKKLKAIAVRGTRDVHAANPAKYYQS
FT                   MNELLDTCYDHVVTGSLFPAYGVTGIMGLMNEKGVLPTKNHYTGNFRGADKISGQAMAK
FT                   TMLTKTRGCFCCTIHCTRVIDIEYGPYHGIRGKGPDYDSTVAFGSQCGNDNLEAIAQAN
FT                   ILCDQYGLDTVSAGATIAWAMELYEKGIIDKLDTRGVELSWGNHEAMTSMVPKIATRSE
FT                   FGAVLADGLDEAAKKIGRGSEKYIQCVKNLDLPGIEARGSKGMALGYATDNRGGDNLRP
FT                   FASMAECFGFRSKELGMPDSFDPLSEAGKAQWMIPCQNYFVAVNSLVVCMFTVIAFTVE
FT                   PSQYARHLSALTGFSFDKERLLEAGERIWNLQRAFNAREGFTRKDDRLPFRMTEPLPNG
FT                   PDAGSAVYLNRMLDEYYELRGWDKETGWPTPGKLRALRLDYVVKDLEKAGPAARQAAA"
FT   CDS_pept        600172..600411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0619"
FT                   /product="putative glutaredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0619"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60691"
FT                   /db_xref="GOA:D1YW69"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR011911"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D1YW69"
FT                   /protein_id="BAI60691.1"
FT                   /translation="MKKIKIYSQPTCPDCNRVKAYLDKKGVSYEDINVRKDKKAMDEMV
FT                   KRYGIRVTPVVVIGDRVMVGFNVPKIDKFLGAQD"
FT   CDS_pept        600436..601353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trxB-1"
FT                   /locus_tag="MCP_0620"
FT                   /product="putative thioredoxin reductase"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0620"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60692"
FT                   /db_xref="GOA:D1YW70"
FT                   /db_xref="InterPro:IPR008255"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D1YW70"
FT                   /protein_id="BAI60692.1"
FT                   /translation="MMALLDLIIIGAGPAGMTAAIYAKRKGLTLQVLADSVGGQVTKTG
FT                   NVENYPGYKSIPGPQLAALIKKQLEEMTVDITMSRAAKLEKSGDYFKVTSGDGHTYEAR
FT                   AVIIASGSKWKELNVPGEKEFKNRGVSYCPTCDGPLFSGMDVAVIGGGNAAAEAVLDLI
FT                   PLATKVYLVVRSTLKADKVVIDKISANDKVTILTGYTVDKINGTDFVESVDIVSTGGER
FT                   KTLSVGGVFVEVGLAPNVAFAKDLVQLNDRGEIVIDERCRTSVCGVYAAGDVSDVPQKQ
FT                   IIVAAGEGAKAAMSAFTYISTQKC"
FT   CDS_pept        complement(601359..601565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0621"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0621"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60693"
FT                   /db_xref="UniProtKB/TrEMBL:D1YW71"
FT                   /protein_id="BAI60693.1"
FT                   /translation="MHLMMVAKRFDNYRLALDRKRREVFDYIMFELAGRREETLVMHPN
FT                   HTEAALMNAMIEMEMRIEALEKK"
FT   CDS_pept        complement(601674..602801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0622"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0622"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60694"
FT                   /db_xref="GOA:D1YW72"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:D1YW72"
FT                   /protein_id="BAI60694.1"
FT                   /translation="MVEPNDNIGNDTMADDGNPAYGFAENNNTMRKRSTDSIPIGLKIG
FT                   STRTVLVMPNYEGSLDIVRTLTCVAKYRDLFTGKLATKFGDEAAEEYADSVYFMFRAGL
FT                   PQDDDSVKLAAQFIEYLVYKYNIPENSYVTLAHPAVENDRGRKNLKEIISGMSIGRAGR
FT                   QAWSEAFCGAIPAFDGLDAIKKTFMSVNMGSTTLEMSVFRNGEPVHTVTLGTISGNIVD
FT                   RKIRLGVQNETQGIVNIDLNTARKYKEEFANFIDYKPVYDSVHIHDKGQYGFKIEKSIM
FT                   KPVEEYVNNVVEAIMENFFPQLAQDHYQTYKRVLSEPIILTGGMACIPGLKERIQQLLS
FT                   DELEQKVTVISSDRPDLAPAIGAYRISEYTLQYRE"
FT   CDS_pept        complement(602817..605066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0623"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains one PEGA domain (IPR013229).; Contains at
FT                   least one Cna B-type domain (IPR008454)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0623"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60695"
FT                   /db_xref="GOA:D1YW73"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR013229"
FT                   /db_xref="InterPro:IPR015889"
FT                   /db_xref="UniProtKB/TrEMBL:D1YW73"
FT                   /protein_id="BAI60695.1"
FT                   /translation="MKKFINLLLISVILLSLTAVTGVNAAGTAFSISGMVVDRYGNPLS
FT                   GADVTLIDNAYKTIATKKTNENGNFDFINVIADTDTCTVRVSYTDTDGTKYEMPTYYAR
FT                   WYPTKSIQTIPSSETQIPNYPEPEYGYVYGAIQSGTGNSASFITGIVYLVSMDNDVKYY
FT                   QFAERTDGKGSYTFYVPAGTYMIYAQHWENGVCYESTHKQITVTRNADINNVLETRIIL
FT                   PLTTPSSSPDPSDMPTSHSNIVNGTVITKDGKPVEGAVVTLLQKADNQSGYIPMKNMDG
FT                   SMVTTVTDSNGKYVFNGVAPTTNDGKSIQSKKDIKVQVEYTDLSNQKQTVIAPNSDARA
FT                   LYFPNVIMGYGMENAARSVTMPNVVVSFSKGGWVSLSSVPTGAYIYVDGQQLFGPDNTP
FT                   LMTPCTAYIDAGTHTIKMSKDGYSDSTDTITMEANQQHPDFIMSMEKAVVPAWVTLVVA
FT                   IIILLIAIIAIVFLLATRIKGILAPVSRALNGFTHKLGSAKADREVAKSHKAEVAKQEA
FT                   SKRETIRARQESTPGDNVNVVNVDPVKRKREPAPVEEGRKKKILDFDLKHIAEGVPKKI
FT                   KAREPIEAPKEKSPVVFANDIYKKSKSNVERYAEPSRNYEARSYEEPSRSSYDPPQRAQ
FT                   PVSEREALVERPTAPERNERFRIPRISGQRDASTSAGDKERVLRYIRDHPEGVSFIQMS
FT                   NDLEIIPNNLTYITKELVINDDIEKVKGLYYYKSHSSSSDDSSSSVVVWRLDGDK"
FT   CDS_pept        605527..606549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0624"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains one Radical SAM domain (IPR007197)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0624"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60696"
FT                   /db_xref="GOA:D1YW74"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR016431"
FT                   /db_xref="InterPro:IPR027596"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="UniProtKB/TrEMBL:D1YW74"
FT                   /protein_id="BAI60696.1"
FT                   /translation="MLKEAILWEPLKDGKAKCNVCSYRCVILPGKLGHCRTRKNIDGKV
FT                   FSLIYGTVTSEASDPIEKKPLYHFYPGSYSYSVGSVGCNFQCEHCQNWGISQAEIQEVY
FT                   TQDIMPEELARNAVDTLCKSVSWTYNEPGIWVEYSHDCAVKCHEKDIKTIYVTNGYPTP
FT                   EHLDVMKGLLDAFRVDIKAFSEDFYKKICKSKLEPVLQSTKMAKDMGMHIEVVNLVIPG
FT                   QNDSPEEIRALSKWCFDNLGPDTPIHFTRFHPMYHMDHLESTPIVVLERAHDIAKKEGM
FT                   NYVYLGNTLGNKYENTWCPKCNELLIERYGFQIMRYSITPDKKCPKCGEKIPIVGDYGR
FT                   "
FT   CDS_pept        complement(606546..607658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0625"
FT                   /product="putative S-adenosylmethionine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0625"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60697"
FT                   /db_xref="InterPro:IPR027790"
FT                   /db_xref="InterPro:IPR042543"
FT                   /db_xref="InterPro:IPR042544"
FT                   /db_xref="UniProtKB/TrEMBL:D1YW75"
FT                   /protein_id="BAI60697.1"
FT                   /translation="MLVEQLLRPYGANKFEIVEKKGLGHPDTLCDGISDAISRSLSKYY
FT                   IDHFGHILHHNVDKVLLIGGRSRPEFGGGEILRPLAIVIGGRATDDADGTKIPVNDIAK
FT                   EATEKFLKKTVNNLNGHFTVEPRIGMGSTELRSLVGRVVANDTSIGLGYAPLSHLEENV
FT                   TKIEPLMRSVKGVGEDVKIMGIRKGNGIQLTMASAIVSKYIEDMEQYNDTKRKVEEKVL
FT                   GYVTPGWADVSAIVNNADKGEDIYLTVTGTSAEMGDDGETGRGNRPNGLITPGRPMTME
FT                   ATAGKNPVSHVGKLYNIAANRMAAEIAAFDGVEEAYVYLVSRIGAPLEEPQIKSASIYG
FT                   KANEKKIEAVIDYWLEHIPDITEDFVKGRL"
FT   CDS_pept        complement(608064..608651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0626"
FT                   /product="chromosome segregation and condensation protein
FT                   ScpB"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0626"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60698"
FT                   /db_xref="GOA:D1YW76"
FT                   /db_xref="InterPro:IPR005234"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D1YW76"
FT                   /protein_id="BAI60698.1"
FT                   /translation="MDEKSLMEAALFSAGKPVSEQQLKSLLNRSSTYINSLAQKLMEEY
FT                   RERNSPLEIVRLEGKYAMQLRPEYAERVVGFSPGELRAPALRTLSVIAYYQPIQQSDLV
FT                   DIRGQAAYDHVAMLLEKDLIEKKRVGRSYELTTTEAFCDYFGLTKGDVESIKTQIMKKA
FT                   KLKKESLTKWVDSKVPDVDAFDAVSKLMPKVK"
FT   CDS_pept        complement(608644..609339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0627"
FT                   /product="putative chromosome segregation and condensation
FT                   protein ScpA"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0627"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60699"
FT                   /db_xref="InterPro:IPR003768"
FT                   /db_xref="InterPro:IPR023093"
FT                   /db_xref="UniProtKB/TrEMBL:D1YW77"
FT                   /protein_id="BAI60699.1"
FT                   /translation="MQTEAPAQHQEESIEILLEMARSGEIDPWNIDIIDVTDRFLARIV
FT                   EREKVDLPASARTLLYASILLRMKSDVLVNAPPPEPDDDYAFGPDFDLEPEDYPMLEPR
FT                   QRNAVARPVTLQELITELQRAVATKDASHMRKALKIEKPPRKTIEEVLGIAHNEDIEAS
FT                   ILEMTSALDREFAYRDFVMFSELIKDPTPHGIVDVYLPLLFLANRKYVMLTQEILFEDI
FT                   FIRRSVPNG"
FT   CDS_pept        complement(609329..612850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0628"
FT                   /product="chromosome segregation protein SMC"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0628"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60700"
FT                   /db_xref="GOA:D1YW78"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR010935"
FT                   /db_xref="InterPro:IPR011890"
FT                   /db_xref="InterPro:IPR024704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036277"
FT                   /db_xref="UniProtKB/TrEMBL:D1YW78"
FT                   /protein_id="BAI60700.1"
FT                   /translation="MHIKEIELNNFKSFGRKAKIPFFDDFTTISGPNGSGKSNVIDSIL
FT                   FCLGLSNSRSMRAEKLTDLIYSVNGKSPGSADVTIRFDNTDREMPIDQDEVTITRRIKS
FT                   SDSGYYSYYYFNEKPVSLSEIHEHLLKAKISPDGYNVVMQGDVTRIIEVSNFERRKMID
FT                   EIAGTAEFDEKTDKALSELDIVRDRIDRVAIIISEVEARLAQLKDERDHALLYQSYRDE
FT                   KVKNEGYLVLSELKEAQQLLDSLLEDIRDKTDKRAAITADVEKKSAAVQKLKDDIKALN
FT                   ATITEKGEGEQILIRRQIEEARAGIKACISIIDFSKSEIANRDSEKQKLFLETEKAKGQ
FT                   IEEYDGKIAEEEKRKLSLTNELNFRQASLDEVQKKISAIDEKFIGVRTRLVEVKAALEA
FT                   SRNLRNEKLREKDRILDAARRKQDEEQDASTEITSSRSRIEEARVESKNLEKDVAELQR
FT                   RSQALTADINDMEGARSRTRAEQHGIEEKLRKLQEEFAKAEARVRAYEDLDGYSEAVGT
FT                   IIGARNSHELPGIYGTIAELGKVDQEYATALEVAAGNRMQNIVVDNDEDAARCIYYLKG
FT                   QRKGTATFLPLNKMRQRVQLRNIREPGVIDYAINLVQFDGRFDPAFWYVFGDTLVVDTL
FT                   ETARRLIGTGRMVTLDGDLVEKSGAMTGGYRSRTKLKFKASEEEHIKELAEQITILESS
FT                   RDSVLKKVESIDGHIYGLKKDRSDMETQASKLTARKEELAGRLTRLEAVIKEKEASIES
FT                   LREDRRKLRDELIAAEEAISKADSEITTIGAEAGKLEEELKGSEVPALTEESGRIEDEM
FT                   KRLDGRLRDTESAIASLKIEQNYVRARVEENKGRGEKVDENIASLREKISQNEAAIGEF
FT                   NGKIEDLTKREKAIESELAGMKKQRDEMSDALTAADHDLYDARRSLERLTGMLNSLEIA
FT                   REESLDKIKVFEKVVQERGVMPSEDVPPVDKVRASISQLEKKMQALEPVNMLSITEYDG
FT                   VQARLAELTGKRDTLQKERENILEKIEHYKTMKMETFLTTFNAINEQFKVIFNELSDGF
FT                   GELVLESPEDPFSGGLTIRAQPYGKSLYRLEAMSGGEKSLTALAFIFAIQRYKPAPFYA
FT                   FDEIDMFLDGANAERVARMIKKLSTNAQFIVVSLRKPMIESANRTIGIAMQENNISSIT
FT                   GVKLRAD"
FT   CDS_pept        complement(612881..613291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0629"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0629"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60701"
FT                   /db_xref="UniProtKB/TrEMBL:D1YW79"
FT                   /protein_id="BAI60701.1"
FT                   /translation="MEGDMKEIVLERLEQRLKEKDDQIRSLKKELNSGGDVKALAERVD
FT                   HLEMEVKETQVTLSEVMKKVGALEGAISTMLMNMASAAEEGYPEDDLSQPGVPPDQQPF
FT                   DRFAASADQKDIKEDGHNQSDVTRFFHLSKNS"
FT   CDS_pept        complement(613363..615609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0630"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0630"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60702"
FT                   /db_xref="InterPro:IPR022601"
FT                   /db_xref="UniProtKB/TrEMBL:D1YW80"
FT                   /protein_id="BAI60702.1"
FT                   /translation="MDASPAIIITNPAVVKATYFISTTRITIMSDGLSGINRRAFLKAM
FT                   GAAGALALGSGVLGCVGSSLNDNPSIRPTGNIMYTVTGRTQAKFAQFVPLPSTVTPALK
FT                   DYSVDVSKLTGLDELGVSDAGKSALAKNLFYLTPSMDAQVYDVYKSLSEAGLPAFVTTD
FT                   SVLHTYHILFDYILRMLEVQHFSPDVIELSKLMMNESIAQMDAATGTVKVAALKNTAFF
FT                   AVALKLLGESPSLPSAVSGMVEDELSLISGHEGFAGSPIFGYKEDYSQYLPRGHYDRNE
FT                   TLKKYFKAMMWYGRMSFRLENKDDPEAAKEQTRRAILITLALKNQAFDLWKSVYEPTVF
FT                   FVGETDDLSVYDYNTLIKEVYGISVGLADLADDAKLQALMDKALKLKEPKIVSTELNDT
FT                   DYDESGMDSIKGLRFMGQRFIPDSYMFQELVYAKVGTQGQPRLFPMGLDVMAVLGSKRA
FT                   YEILDRVYNETRYSNYVKQMESLKRQFAALGADAWTQNLYWCWLYCLMPLLNEKGDGYP
FT                   TFMKSQAWTDKELNTSLGSWTELRHDTILYAKQSYTMRATGIMPTHEPPKGYVEPNPEL
FT                   YGRLSSLAGMTIDGLKSRDLLLDVFGDRLTRLKDLLTSLKAISEKELTGTTLSDDEYST
FT                   IRYVGATLENITTFPPEVKDAITNDTDERMAIVADVHTDVNTEQVLEEGVGNPYHIYAA
FT                   VPVEGKVVVAKGAAFAYYEFKWPMSDRLTDPKWQDMLKNGQAPETPEWTKSFKA"
FT   CDS_pept        615649..616731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0631"
FT                   /product="putative translation initiation factor aIF-2B
FT                   subunit 1"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0631"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60703"
FT                   /db_xref="GOA:D1YW81"
FT                   /db_xref="InterPro:IPR000649"
FT                   /db_xref="InterPro:IPR005251"
FT                   /db_xref="InterPro:IPR011559"
FT                   /db_xref="InterPro:IPR027363"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR042529"
FT                   /db_xref="UniProtKB/TrEMBL:D1YW81"
FT                   /protein_id="BAI60703.1"
FT                   /translation="MWMRTIDWSDEKGCITIIDQTALPSKLVLLDIDHVNVLHEAILKL
FT                   RVRGAPALGAAGGFGVALLARSIRANDFKDYIKKLTEGAESLKKVRPTAVNLSWGVDRV
FT                   LAAALTGKDRAEVESTALREAKALADEDVAQCRAIGEHGAKLLESSDTVMTHCNAGRLA
FT                   CVDWGTALGVIRSAVEQGKDIKVISCETRPLNQGSRITCFELMDDRIPVTLITDSMAGH
FT                   FMRAGKIQKVIVGADRIVEDAVFNKIGTYSHSVLAKAHGIPFYVAAPLSTFDFTRREKD
FT                   VIIEERDPEELRRWNATQIAPAGVPVYNPAFDATPMQNVTAIITEQGILEPPISFARLK
FT                   KSSSQKPYIRDRTKGVQDGI"
FT   CDS_pept        616721..617830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0632"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains one Amino acid-binding ACT domain
FT                   (IPR002912)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0632"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60704"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR040537"
FT                   /db_xref="UniProtKB/TrEMBL:D1YW82"
FT                   /protein_id="BAI60704.1"
FT                   /translation="MAYRYNSQEMKGAMEAVIDKIEQGCELKEYFISGLQHVYRVDGQY
FT                   LLVLRYSKNKDGHFYFSIPQEFLYNPTIKHLVLVCEKPDNAIVLPASQIADLLEDIEPG
FT                   EKGWTLDVYDKEGWELKIARTEKVLYVDNYVNEYELIYSRSAMSTGKTALNLFCKDKPG
FT                   VLRDVAGMVAKHGGNITYTQQFIVDKGDREGQSNVYMEVENVKDIDDLVKALEKLSLVQ
FT                   EVTLHPPLDRIYGSRVIIIGGGAQVAQVAVGAINEADRHNIRGERISVDTIPLVGEDTL
FT                   ADAVEAVKRLHRAQILVLAGSIMGGSISEEIKKLHREGIPVISLNMAGSVPDYADLVVT
FT                   DPIQAGTFAVMHVAKTAVFDIDRVRGKKF"
FT   CDS_pept        617900..618556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0633"
FT                   /product="peroxiredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0633"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60705"
FT                   /db_xref="GOA:D1YW83"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR019479"
FT                   /db_xref="InterPro:IPR022915"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D1YW83"
FT                   /protein_id="BAI60705.1"
FT                   /translation="MHDEVSVISPQGILSIGMPAPDFEAVTTHGKIKLSQYKGKWVVLF
FT                   SHPSDFTPVCTTEFIAFAERYEDFKKRNVEIIGLSIDSVYSHIAWARSIQEKTGCRIPF
FT                   PIIADLDMRVAKAFNMIHPAMSETSAVRAVFFIDPNRILRAMVYYPQTTGRNMDELLRI
FT                   VDSLQIVDKEKVATPANWRPGDAVIVPAPNTQEGAEKRLNEGYECMDWYLCKKKL"
FT   CDS_pept        complement(618581..619486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0634"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0634"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60706"
FT                   /db_xref="GOA:D1YW84"
FT                   /db_xref="UniProtKB/TrEMBL:D1YW84"
FT                   /protein_id="BAI60706.1"
FT                   /translation="MPAGPAYATRSVIVLFILALAIAPALGQSLLDMTLPSSFIINGTK
FT                   ARDSANNVVDIWGPVEIFKVGNNAYVSVPTNSPAGARLAFFQDTSTGALFRNNTLMLAI
FT                   NGTSGPAASMALMTGDLTSDGTRFYGQVTDVELDTVALADGDAAAGAVLYLNVWPDRPT
FT                   YHISISNNGTIKKAVSDEATKSGQTGKVKLMLDVNGESISYIIVRMKAPYAGDNVSAYR
FT                   YGDGGVTRLACKAIRSNESVIYETISSGDGTFAFVGPFQEAPAPGPGTTDVLIFMGAVA
FT                   ALQLGLVRAAIAVIRKTSQG"
FT   CDS_pept        complement(619564..620271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0635"
FT                   /product="putative isochorismatase hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0635"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60707"
FT                   /db_xref="GOA:D1YW85"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:D1YW85"
FT                   /protein_id="BAI60707.1"
FT                   /translation="MTSLPIRNQEEDHLLTPKNSVLVIIDYQPPQIFTTKSMDRQQMIN
FT                   NVVALTKIAKNFGLPIILTTVNVTNGTNPDTIPQLRSVIPDVRSYDRTTINSWEDEAVL
FT                   NAVKATGRKKLIMAALWTEACLLFPALDAIKDGFDVYPVIDALGGTSIESHRAALDRIS
FT                   QAGGHLTTWNGVGCELQRDWARAETVPGWVQPIIEQGEAWGWYLTLENEVNAFHDYTPG
FT                   AKKPAPGAREARA"
FT   CDS_pept        complement(620429..622084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0636"
FT                   /product="thermosome"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0636"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60708"
FT                   /db_xref="GOA:D1YW86"
FT                   /db_xref="InterPro:IPR002194"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR012714"
FT                   /db_xref="InterPro:IPR017998"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/TrEMBL:D1YW86"
FT                   /protein_id="BAI60708.1"
FT                   /translation="MAQQTQGGQPIIILKEGSSRTRGRDAQGMNLMAARAVAEAVRTTL
FT                   GPKGMDKMLVDSLGDVVITNDGVTILKEMDIEHPAAKMIVEIAKTQDDEVGDGTTTAVV
FT                   LAGELLKRSENLLDQDVHPTVIAAGYREAASKAREILDSLAYPVTLKDEGLLKKFAITA
FT                   MSGKGAEAAGEKLADLCVRSIKAVVDEDGKVDVDDIKVEKKVGGTIGDSELIQGLVIDK
FT                   ERIHPNMPKTVKNAKIALLDTPLEIEKTEIDAKIEITSPDQLQSFLDQEEKMLKTMVDK
FT                   IKATGANVVFCQKGVDDLVQHYLAKNGIMAARRVKESDLKKLAKATGAKVSNSIDELAK
FT                   DDLGVAGLVEERKIGDENMIFVEQCKDPKAVSLILKGGTEHVVDELERAVHDALRVVGV
FT                   VVEDKKYVAGGGSTEVELALRLKEFASTVGGREQLAIEAFAESMEIIPRTLAENAGLDP
FT                   IDTLVDLRSKHEGKNKDGKNFGINVFTGEAVDMKKEGVVEPLRVKTQAISGASEAAVMI
FT                   LRIDDVIAASKLSGGRGGPGGMPPGMGDMGDMGM"
FT   CDS_pept        complement(622234..622596)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0637"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0637"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60709"
FT                   /db_xref="InterPro:IPR018990"
FT                   /db_xref="InterPro:IPR036331"
FT                   /db_xref="UniProtKB/TrEMBL:D1YW87"
FT                   /protein_id="BAI60709.1"
FT                   /translation="MTCRNGATYYKNFYATVLWMRATFTDNGKHIGLSLRDVLEVRLPE
FT                   SQVSGYMWSLVEGSCPCLRFIEDIYVEKGPAKYNGLGERYWLFTAAGTGECELIFNLIR
FT                   PWSKPSPEFILHVTVE"
FT   CDS_pept        622595..624493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0638"
FT                   /product="putative phosphoadenosine phosphosulfate
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0638"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60710"
FT                   /db_xref="GOA:D1YW88"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR002500"
FT                   /db_xref="InterPro:IPR004521"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="UniProtKB/TrEMBL:D1YW88"
FT                   /protein_id="BAI60710.1"
FT                   /translation="MSRQVYLGKLTLYWCDTCNVPVLGKKCARCGAPTRYVDCTPPGDI
FT                   RPAFPFDVELINKTIEESFGHPDLIPADKLVVLNKAPYEDRLDEIFVDGRMFGALRFDP
FT                   YRLRWMFMPRAFAAKQMNLARGHATKGFVIADKGAEKPLLGSSNMLGPGVVDCDENIQV
FT                   DDEVVVFLEGRPIAVGRAKMTGADMKERKKGVAVKVRWNGYDDHPVLNGGQTWQDAVDA
FT                   NREYLMSIEGEAIGFAKKVAGQYRLPVTVSYSGGKDSLATLLLVRKALPDFDVLYINTG
FT                   LEFPETTQNVHDVVAQYGLRLKTAKAGSFWDAAPSLGPPSVEARWCCKVCKLGPITDLI
FT                   ENNYSDGCLTFIGQRRYESEVRAKSQRIWQNPWVGNQVSASPIQHWTALHIWLYLFREK
FT                   APYNPLYGRGFDRIGCWLCPSASLADYEFVKSQYPEMWARWEAFLIDYGKKVGYPAEYV
FT                   KYGLWRWRRLPRQWEELRKALGIELTAPAEASGDLSFTMVAGYRPCKDGSATAEGNFNM
FT                   PLDMGRIEGYLRPIGEVRDAEGMLFVTRDGASLQVYATGTVVARAKDKEAAAALMSLAE
FT                   KSIRRGMLCVGCGVCVGACPINAITKESQRVTVSEACTACGECVDRCPLVKFKREA"
FT   CDS_pept        624490..625092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisH"
FT                   /locus_tag="MCP_0639"
FT                   /product="imidazole glycerol phosphate synthase subunit
FT                   HisH"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0639"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60711"
FT                   /db_xref="GOA:D1YW89"
FT                   /db_xref="InterPro:IPR010139"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D1YW89"
FT                   /protein_id="BAI60711.1"
FT                   /translation="MIAIIDYGVGNLRSVEKGFAYVGVTAKVTGDPSVIDAADAIVLPG
FT                   VGAFESGMRHFEPLRKAVLGRVDAGVPLLGVCLGMQMLYEESEENGLHKGLGLVKGRIT
FT                   RFSNGLKVPHMGWNSLDIKKQHPLLDGIKNNSFVYFVHSYKAPAGENTVASAEYGGEFT
FT                   AVVSGDRPNVVGTQFHPEKSGDTGLRMLKNFSDCIKR"
FT   CDS_pept        625098..625544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0640"
FT                   /product="conserved hypothetical protein"
FT                   /note="Belongs to the GtrA-like protein family
FT                   (IPR007267)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0640"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60712"
FT                   /db_xref="GOA:D1YW90"
FT                   /db_xref="InterPro:IPR007267"
FT                   /db_xref="UniProtKB/TrEMBL:D1YW90"
FT                   /protein_id="BAI60712.1"
FT                   /translation="MDFLKTIDGLLSRVYADYMKLGKYFAVGAVGTIAEWSLYSGLIVF
FT                   TLLDYRVATAAAYFLGMIINYTLNRYFTFNSTYKKIHVQFASFAAIALIGLGIQELVMI
FT                   GVIGYLFNNTTSDSIQIISKVIATFVGFVWTFIANKKITFKVFQ"
FT   CDS_pept        complement(625550..626200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0641"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0641"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60713"
FT                   /db_xref="GOA:D1YW91"
FT                   /db_xref="InterPro:IPR003390"
FT                   /db_xref="InterPro:IPR036888"
FT                   /db_xref="UniProtKB/TrEMBL:D1YW91"
FT                   /protein_id="BAI60713.1"
FT                   /translation="MSSQTPIELRGQEEMVMNAVLSIAKSISRSGEGSLIIIAERRDVD
FT                   GLYETHYPQITSNSVLTEQGMNVVVEKLATIDGSVIITPTGELVAFGARVLKSTTLPGY
FT                   GTRHAAAAGITSSLPQATAILISEESSLIKIFQKGNIVIEMDSAEVNPNAMEKVIAFLT
FT                   RNDMALIVATGLSLAVQVPYYYIFLVGGSYLIVKAIFEVASSVLMGSTEKDKA"
FT   CDS_pept        626448..627719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0642"
FT                   /product="putative glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0642"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60714"
FT                   /db_xref="GOA:D1YW92"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D1YW92"
FT                   /protein_id="BAI60714.1"
FT                   /translation="MGAAAGSVVYYALFLASWLNRTVIYEWMPSLLLLILIVLAGVTGY
FT                   FTWRFIRQCRYQEMPEIQSDQILPLTIIVPALNEARDIEQCVESLMAAEYPTEKLEVII
FT                   AHEVPPKCTDTTPEIAKKLAERYRNVKAVPNRDGHRGSKAGAINNCLSQAKGEIIGIYD
FT                   ADHIVAKDALLRASAQFATSPGLACLGGKVIVRNVNYNWFTALVGNESAVINNFSRYVS
FT                   QLFTGQHMVYGSNLFIRKDVLEKIGGFDESSLTEDCDLGMKLMQSNYGMSMDYSIKSYE
FT                   QPAITFMDWWNQRVRWTWGGISVLKKYAKGGSSWSKVRTFLMYSLGTTGILFSIVLLGF
FT                   VAFMLFMGVLTPVILLIIVVPLSVLFAAESIVDFCEGHGSVIDMVISIFIRPFIIYVYS
FT                   LVGVYALVMDALSRERVWYTSQRI"
FT   CDS_pept        627948..628433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0643"
FT                   /product="putative peroxiredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0643"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60715"
FT                   /db_xref="GOA:D1YW93"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D1YW93"
FT                   /protein_id="BAI60715.1"
FT                   /translation="MYRSMLGNVRQGSKAPMFSALDVRGDMFDTRAYLGRSNLVLFFYR
FT                   GYWCATCREELLGLKGEYQRISTQDSEVVAISKDSIDEAKNMAVNLQLPYKVISDPDHH
FT                   IIDMYDVYDSENETAFITLFLIDKAGVVRYKRSIAGLEDVMPATEIVNKLKNLGSAF"
FT   CDS_pept        complement(628430..628927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dut"
FT                   /locus_tag="MCP_0644"
FT                   /product="probable deoxyuridine 5'-triphosphate
FT                   nucleotidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0644"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60716"
FT                   /db_xref="GOA:D1YW94"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/TrEMBL:D1YW94"
FT                   /protein_id="BAI60716.1"
FT                   /translation="MILGKTELIKLLDSLVEGAVDAQAQVQPNGFELTAGKIEAFEGAG
FT                   GIGFSNDDRALPSTKPLEWGRDGWLLLAPGCYKVVFNEVVSIPKDVCAIGLPRSSLLRM
FT                   GVSVHTAVWDAGYRGRSEALLVVYNQGGFRIKKSARIIQLLFMRLESGQEGYSGRYMNE
FT                   NV"
FT   CDS_pept        complement(628890..629333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0645"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains one Protein of unknown function UPF0066
FT                   domain (IPR001378)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0645"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60717"
FT                   /db_xref="InterPro:IPR023370"
FT                   /db_xref="InterPro:IPR036413"
FT                   /db_xref="InterPro:IPR036414"
FT                   /db_xref="InterPro:IPR040372"
FT                   /db_xref="UniProtKB/TrEMBL:D1YW95"
FT                   /protein_id="BAI60717.1"
FT                   /translation="MSINFTPIGYVHNRSSLDTHTEVLQTQTSEIILDKKYEDGLMDLD
FT                   KNDLITIIFYFHEVDGYRLRLHPRGDQARPITGVFNTRSQFRPNPIGVTVARLKSVEGN
FT                   RLVVEGLDAIDGTPVLDIKPHVLTFDEGIKTDDPRKDRTYKTP"
FT   CDS_pept        complement(629387..630067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0646"
FT                   /product="conserved hypothetical protein"
FT                   /note="Belongs to the Protein of unknown function DUF124
FT                   family (IPR002838)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0646"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60718"
FT                   /db_xref="InterPro:IPR002838"
FT                   /db_xref="InterPro:IPR016031"
FT                   /db_xref="InterPro:IPR036983"
FT                   /db_xref="UniProtKB/TrEMBL:D1YW96"
FT                   /protein_id="BAI60718.1"
FT                   /translation="MKYEILYRPVYSLLKVEMDAGESMSSEAGAMVSMTPNIEIQTTAK
FT                   GGLLSSLKRTVLGGESFFQNTFICQQGKGVITFGPAYTGDVEHIPMSGEWLVQGGSYLC
FT                   STPGLSIDTKFQGAKGLFSGESLFFLRIFGQGDLFISSFGAIHPVDLQPGEEIKVDTGN
FT                   LVAFQQGITYSVERVGGIKSTVLSGEGLVLRMRGPGKIYIQTRSPASFAGWLYPLLPKP
FT                   QSHQ"
FT   CDS_pept        complement(630085..630804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0647"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0647"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60719"
FT                   /db_xref="GOA:D1YW97"
FT                   /db_xref="UniProtKB/TrEMBL:D1YW97"
FT                   /protein_id="BAI60719.1"
FT                   /translation="MIPEILNFIEEHRTAVLAAIALFALLDIGAILVYLVLSSGAAVPT
FT                   NTPTAVPSVVITPTPMPTSTPTPTPEPTPVPTPAPAPTVTPDLDIQSSISPLDQYAPNY
FT                   MVHVEKSMTADSLSVDLVYSDLGGQYAYINDTYVTHLTVVDISNASVDRIKIRAICRND
FT                   SGTGYMLYESERVDVVLLDPGDKIFRTVGFKVKPDAPPGKYLLRVDVYTDPYGNDTWAG
FT                   KGCSFEAGLNILAIPAR"
FT   CDS_pept        630914..631741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0648"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains two 4Fe-4S ferredoxin, iron-sulfur binding
FT                   domains (IPR001450)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0648"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60720"
FT                   /db_xref="GOA:D1YW98"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D1YW98"
FT                   /protein_id="BAI60720.1"
FT                   /translation="MTLRDTLVGLGYAIAYRAALLFFSLSKLPVAGRLFEAPVAARRFT
FT                   VVTVPMNAKLRETSAILPFDMIRQLVDSAAYVAIADNCVCREAHNCKDYPASPGCVYLG
FT                   DGARSIKYRTRQATKQEALEWLERARSLGLVTNVVWSSVEFEAIGANPSRTVEICSCCP
FT                   CCCLMFKTRDASKAYLDNILGFGTARVTSADSCTRCTNCEAACPFKAIKVDMHEGPAVD
FT                   MTRCKGCGRCVDACRAGVLKVFPDEDPAAITDTCDHSTPNARDLVERFLGMVK"
FT   CDS_pept        631818..632945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cdc6-2"
FT                   /locus_tag="MCP_0649"
FT                   /product="cell division control protein 6 homolog"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0649"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60721"
FT                   /db_xref="GOA:D1YW99"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR014277"
FT                   /db_xref="InterPro:IPR015163"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D1YW99"
FT                   /protein_id="BAI60721.1"
FT                   /translation="MTKDLLLWDQTIFKEQEYFELDFLPENLLHRDAQMRSLKFSVSPA
FT                   LRGSTPLNAYCRGAPGTGKTSAVLKVFSELENATQKVVPVYINCQVDSTRYAIFAQIFK
FT                   KLFGYPPPSSGISFKKLFSQIAKHLVEKKRVLIVALDDFNYLMASKEADEVLYSLLRMH
FT                   EVQPGAKVGVITILSDLTLDMVRDLTPQVQSVFLPEEIAFPQYSPEEIKDILKYRVRYG
FT                   FMQGVISDELIDIVTGYTADTGDLRVGINMLKRAGLNAERRASRAISKEDIEKAYEGSR
FT                   YIHLNYTIRNLKKEEKVLLKCIVASGKEEMMSGELYECFKEKTDLGYTSFYEMVNRLEG
FT                   LKILSLNTTGKGTRGQSRLVSLMYDPGEVEKRIDV"
FT   CDS_pept        complement(632961..634133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0650"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0650"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60722"
FT                   /db_xref="GOA:D1YWA0"
FT                   /db_xref="InterPro:IPR007315"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/TrEMBL:D1YWA0"
FT                   /protein_id="BAI60722.1"
FT                   /translation="MAASSGHRQELVTTRIAEKPERPARFKQVPAWLAYTLTLFVTTRA
FT                   VLTVIGFIAYQHIAHVKLSMPSEFLRIWKVWDSVNYIDIAQYGYFIPVDRTKMANYAFF
FT                   PLYPLLMRILDTVLNDPALSGFIISSVCLLIACFYLYRIVGLDSDERTAMRSIKYLFLF
FT                   PTAFVLSGILTESLFLALSLACLYYAKKGNWIFTGALGFFTALTRPYGVIIILPVLYEY
FT                   LRSKEFKLQNIRADALYMLLIPAGISAYALYCYYLMGDPLAFVHVQSAWGGHLVNPIME
FT                   LGYRLITPASTEVLFGACFTLIALIVMLLSYKKVGFSLWLYGLLLILIPLSTPSSAWSM
FT                   ARYVVLAFPLFIVFAKLGENRDFDDTATIAMALLQGLLMALWATWGYYVV"
FT   CDS_pept        complement(634182..634523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0651"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains one Zinc finger, SWIM-type domain
FT                   (IPR007527)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0651"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60723"
FT                   /db_xref="GOA:D1YWA1"
FT                   /db_xref="InterPro:IPR007527"
FT                   /db_xref="UniProtKB/TrEMBL:D1YWA1"
FT                   /protein_id="BAI60723.1"
FT                   /translation="MSIFDDIEKDGLTPENEKRLALEFGARGKKAIETVRSGKIKKYKD
FT                   FFVVQGSTGDYIVEEDFCTCNDYLYRLSVKGGVCYHSIAVRIANATGEYERVEEWYTDI
FT                   ISKDRKSVH"
FT   CDS_pept        complement(634520..635275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0652"
FT                   /product="conserved hypothetical protein"
FT                   /note="Belongs to the NGG1p interacting factor 3, NIF3
FT                   family (IPR002678)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0652"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60724"
FT                   /db_xref="InterPro:IPR002678"
FT                   /db_xref="InterPro:IPR036069"
FT                   /db_xref="UniProtKB/TrEMBL:D1YWA2"
FT                   /protein_id="BAI60724.1"
FT                   /translation="MKLSDLVSRLEEIAPPALAEEFDAGRIGLIVKGAEDVDMVATALD
FT                   PTPYVIRRAVEEGAQALVTHHTLIWDPVNVINEDLAVRLKLLLDSGMSLYSMHTNYDNA
FT                   PGGVNDALAELLGLSDTVVFYGGRAGNVPEMSLGRFASLASERLGCDVEYVGDDERSVR
FT                   RAVVVSGSGFRLALDEARKADVDVLLSSELKHDVILGRGDVALVSAPHYFTEAPAMKAL
FT                   AERLSRTVPAVFIDDPPGIKTIQKDGKRS"
FT   CDS_pept        635406..636344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="moaA"
FT                   /locus_tag="MCP_0653"
FT                   /product="probable molybdenum cofactor biosynthesis protein
FT                   A"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0653"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60725"
FT                   /db_xref="GOA:D1YWA3"
FT                   /db_xref="InterPro:IPR000385"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010505"
FT                   /db_xref="InterPro:IPR013485"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D1YWA3"
FT                   /protein_id="BAI60725.1"
FT                   /translation="MQESLVDNYGRRVTSLRMSLTNRCNLQCIYCHNEGESGSGGEITV
FT                   DEIARLVRIATKYGVDRVKFSGGEPLLRTDLEDILRALPPLKDISLTTNGTLLAPRAKG
FT                   LKEAGLDRVNISLDTMDSGRFDLITQRKGQFSRVMDGINAAIDAGLTPVKLNMVYLKGI
FT                   NEDEIERMIEFIRGRPLVLQVIELMNFKGAFKYHADISALEHSLKARADDYKCREMHRR
FT                   TKYYLNGAEVEIVRPIDNSEFCMNCNRLRVTSDFKLKPCLLRNDNLVSLRGLDDEGLEK
FT                   ALRYTVGIREPFFKAAPVAMPKKSEKVPSEN"
FT   CDS_pept        complement(636353..638428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0654"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0654"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60726"
FT                   /db_xref="GOA:D1YWA4"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR032790"
FT                   /db_xref="InterPro:IPR032856"
FT                   /db_xref="UniProtKB/TrEMBL:D1YWA4"
FT                   /protein_id="BAI60726.1"
FT                   /translation="MEATIVINEGTTFMVTDSSGNVPRGTPLGLFRSDTRYLNLYWLQL
FT                   DGKPLIPLSFTRKGYIANISLTNPELKSNGEAIPEGTLHILRTMFISTNFYEKMFIKNT
FT                   NGFPVKLKLSLSYDTDFRDIFEVKGVNLHRKGLRAIIEGDEGKNIILRYEGLDNVIRRT
FT                   EFYFKPSPEIFWDTAIFDIEIAPYETREIDVEVVMTMGGVPVIRQEFVEAKKEIEESYD
FT                   RWQRGLTQISTDSEVMNNVIETCILDLRSLIINTKKDLLVPAAGIPWYDTIFGRDSLIT
FT                   CFQTLMLNPSLSASTLRFLTLYQGTKVDPWTDEQPGKILHEIREGELANLHHIPHTPYY
FT                   GTIDATLLYLVLLSEYYHWTADPGILSDLKAGAEAAVSWIDDYGDIDRDGFVEYIRMSE
FT                   RLGLVNQGWKDSHNSIVFADGRLAAPPIALSEVQGYAYDAKKRFAGLYPDGDLARKMLS
FT                   ESAPLRDRFEDIFWMRENDFYAEALDKDKRQVNSITSNPGHGFWSGIIPESRADTIVKR
FT                   FMQPEMFSGWGIRTLSSKEAAYDPESYHNGSIWPHDNSLIAWGLKKYGYAKEANHVITS
FT                   LIEASKHFDYRLPELFSGYPREEDKAPVIYHSTCSPQAWASGSIVLFIQTMLGLYPDAP
FT                   NNVLYVNPTLPDWLGLVTIKNMVVGNEKISIEFKRVGEKTTFETIGKTGNIRVEHL"
FT   CDS_pept        complement(638440..639702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0655"
FT                   /product="putative glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0655"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60727"
FT                   /db_xref="GOA:D1YWA5"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D1YWA5"
FT                   /protein_id="BAI60727.1"
FT                   /translation="MKIGVMHWAFPPVVGGVESHLVYLYEELARMGHEVSLLTAPHPDR
FT                   DPSAYPWCRIVDNDLMSIRYCLNDAGEDRYLRVHEMMERFIEQEEPDIIHAHNFHYFVP
FT                   DHAECLDGLSKKYGLPIVLTIHNYWEDDLCRHLLSDIGWDRIVAVSYYMKSPCIFDAKL
FT                   DPGRVEVHYHGIDLDRYCAMDCDAIKERLGLAGRKVVFHPARACESKGSLHSIMAAALL
FT                   KDKYPDICLVLSGNGDSVDFDAERDPFKARVGELLRKYDMEKNVLFVSASGDEMPLYMN
FT                   AADVVVYPTIFHKGEAFGIAPVEAMACSKPVVVTNSGGLVESTYPGINGLIVDKNPETL
FT                   AEELAKSIDRIMGDRELAEYLGKNGREVALERFDSRKMALRMEHLYDRLISDSVMQRAG
FT                   NKAARPRQGINGAGCTTSRMI"
FT   CDS_pept        complement(639805..641070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0656"
FT                   /product="putative glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0656"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60728"
FT                   /db_xref="GOA:D1YWA6"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D1YWA6"
FT                   /protein_id="BAI60728.1"
FT                   /translation="MRIGVVHWAFPPVVGGVESHLIYLYTELARMGHDISFLTAPHPLR
FT                   DDGDIGWCKVASNELMSIAGLLKVPAGPERWDRVYTMMESYIRDFSPDVIHAHNLHYFF
FT                   PDHAEALGILAKKYGIPIVLTIHNYWEDDLCRHLLADIGWNMIVSVSYHLKRSCLFDAG
FT                   LPPDKVEVHYHGIDLGKYRASGDREALKERLGLSGRKVIFHPARMCEMKGTLHSIEAVS
FT                   RLKGKYPDIRLVLSGNGDTVDFENERPAFRAKVQQMLNDLKVSDHIQFVSIPADEMPVY
FT                   MNAADIVIYPTILPQGEAFGIAPVEAMACCRPVIVTNSGGLSESTSHGINGLVVDDDPE
FT                   TLTDTLALNIERLLERPGLSEYLGMNGREVAIERFDAGRMGLRMEDLYNRLILARIAES
FT                   PPGIQTPVEAGAPATHKKTLEH"
FT   CDS_pept        complement(641176..641463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0657"
FT                   /product="conserved hypothetical protein"
FT                   /note="Belongs to the ThiamineS family (IPR003749)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0657"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60729"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:D1YWA7"
FT                   /protein_id="BAI60729.1"
FT                   /translation="MAVCVDIVGYARSLFDRPRYSFEARRGFTLKGLMEELSKLARPDF
FT                   RKRIYDAATGKMNEHIAVFINSREARSLRGLDTELKDGDVVTILPPMAGG"
FT   CDS_pept        complement(641466..643358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0658"
FT                   /product="tungsten-containing aldehyde ferredoxin
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0658"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60730"
FT                   /db_xref="GOA:D1YWA8"
FT                   /db_xref="InterPro:IPR001203"
FT                   /db_xref="InterPro:IPR013983"
FT                   /db_xref="InterPro:IPR013984"
FT                   /db_xref="InterPro:IPR013985"
FT                   /db_xref="InterPro:IPR036021"
FT                   /db_xref="InterPro:IPR036503"
FT                   /db_xref="UniProtKB/TrEMBL:D1YWA8"
FT                   /protein_id="BAI60730.1"
FT                   /translation="MKGLSGRLIRVNLTDGSVNIEDYDEGDARKYLGGKGLAAYYAFKE
FT                   IKRGTDPLGPDNKLYLFTGTLTGTPAPLGNRTVAATKSPSTGTFTDSYMGGFWGPELRF
FT                   AGYDGVILEGASAEPVRIHIQDDDIRLLSARNLWGMDTWQTEAEIKKLHGPTKKPIKVL
FT                   SIGPAGERKDLLAAIIADARAAARGGVGAVMGSKNLKAVSVLGSKRPQLHDPKTMMGLV
FT                   KEQNARLNKNPVTSDALRLRGTPNILLGVNAAGALPYNDFSGEMNPEADRIDGDALKTV
FT                   LWNDGKNWHPCWNCTVKCTHFHVLEQPGFEGKIDDGPEYETVGLLGSNCGINDPKAISL
FT                   ADYILDGYGLDTMSVGDTIAFLMDCYEKGLIGKDMTNDVDLRFGSVDAWMAAINAAGRG
FT                   EGTLGRLVANGCLRATEEIGKGSMDFAPQVKGMEIPSYDPRSGEGTALSYARCERGADH
FT                   LKPWVFNKEWLSSAERTDPFTTEDKPSLIKRENEGSAVLDCLCVCRFAGNELSLEGDFI
FT                   LLANAATGFNYQWHEFWETGERSINIARAFGAREGLGRAQDSLPKKFSTEPLKEGMAKG
FT                   GMAHVEKMLSKYYELCGWDENGVPGPQKLRELGLDFVADELRAAGIGPEEARAA"
FT   CDS_pept        complement(643355..644248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapA-2"
FT                   /locus_tag="MCP_0659"
FT                   /product="dihydrodipicolinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0659"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60731"
FT                   /db_xref="GOA:D1YWA9"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020625"
FT                   /db_xref="UniProtKB/TrEMBL:D1YWA9"
FT                   /protein_id="BAI60731.1"
FT                   /translation="MYHPAGVYPAMPTPFMRNGDLDETGLRDLVSYFNNTGVNGLLVLG
FT                   TIGEFAMMSGQERRRAAEIIVGAADKLEIIANAGCPSTRETIRMALFLKDIGVDAVIAV
FT                   EPYFYHPTAKGMARHYLDIAEKADMPVMAYNIPQFSGNRLTPDIMDAFAGDGRIVGLKD
FT                   SEGDPVKLMEFIRRAPEGFSVMVGADPLVSYGICMGAKGMLIGSASVAPRACVEMYRAA
FT                   IDGDMDKTFAMQGRLNDIIRAMSVGTFPAAVKYMLSGQGLPGGHVRPPLEGLSDAEKLI
FT                   VDDYMKGAKAMSEVVV"
FT   CDS_pept        complement(645171..645536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0660"
FT                   /product="NUDIX hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0660"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60732"
FT                   /db_xref="GOA:D1YWB0"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:D1YWB0"
FT                   /protein_id="BAI60732.1"
FT                   /translation="MSISYVYVIAFHGDEFLMVRHARRSWEMPGGKVNAGESPGEAAVR
FT                   EFREETGYDVGGLNVIEIEDGGLVYMGDVGKKLSTTPDAREIAEVKLFKELPDNLSFPL
FT                   VEYTRMLDAARKYHSAH"
FT   CDS_pept        complement(645614..645922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0661"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0661"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60733"
FT                   /db_xref="InterPro:IPR020501"
FT                   /db_xref="UniProtKB/TrEMBL:D1YWB1"
FT                   /protein_id="BAI60733.1"
FT                   /translation="MDFVVNEITKRLHDYLATDVQGIRRIVLQAFVKMKSLTADTLHRI
FT                   LMERGFSITLKQVTAMLGVIHSKLGILHAHKNSYDAKYEYSLKEKYEGIVQTALLSI"
FT   tRNA            complement(646176..646247)
FT                   /locus_tag="MCP_t0013"
FT                   /product="tRNA-Gly"
FT   CDS_pept        complement(646294..647124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0662"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0662"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60734"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D1YWB2"
FT                   /protein_id="BAI60734.1"
FT                   /translation="MLKRDPLGGYMGIYEHDGEKIAYHVEGEGRPVLMTMGLSARGGSY
FT                   DWRFIFDCLAGTFKVYALDVLGLEDERPRLSYGTGHYQKLVEGFMESVVGERMSIISGP
FT                   IDAQYALKAAFEHTSLVEKILIVSPDGVRRIATHDTIGRSVTYRILRIPKIESVMYGNI
FT                   SSKRSMLIFLRKVYGRLEEKKARPLIESRMRQKYPPLSTLSERRFMEYSWSRSLMQAPM
FT                   RLSKMIRKSRRIVGEMDDFRILRNSRLIVFQRSGELPMRKDALRFCDDAIKFLG"
FT   CDS_pept        complement(647169..647828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0663"
FT                   /product="putative phosphatase, PHP family"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0663"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60735"
FT                   /db_xref="GOA:D1YWB3"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="UniProtKB/TrEMBL:D1YWB3"
FT                   /protein_id="BAI60735.1"
FT                   /translation="MLKYDLHMHTIYSRDGAIKPADAIRIAKKRGLDGIAITDHDTIRG
FT                   GLEALKLKTEGLDIIVGAEIKTDRGDVIGLFLNEEIRERDHMEVIDAIRSQGGVAVVPH
FT                   PFDSMRGSAFWLTDKDSGKMDAIEVINARCVLKRSNRMAGIYADDYKVGKVGGSDAHFG
FT                   AEIANAGTLVPESEDIAKAISGGRTTAFGRCSMPLFHVFTTALLVERRVVKPKKSR"
FT   CDS_pept        complement(648625..650292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0664"
FT                   /product="thermosome"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0664"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60736"
FT                   /db_xref="GOA:D1YWB4"
FT                   /db_xref="InterPro:IPR002194"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR012714"
FT                   /db_xref="InterPro:IPR017998"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/TrEMBL:D1YWB4"
FT                   /protein_id="BAI60736.1"
FT                   /translation="MAENSGQPIYILREGTSRSNGREAQNNNIMAALAVADAVRSTLGP
FT                   KGMDKMLVDSTGNTTVTNDGVTILKEIDIEHPAAKMVVEVAKTQDQQVGDGTTTAVIFA
FT                   GALLKKAQELMDQGIHPTIVTSGYRLAAAKANELLSEIAIPAKGKDILKKVAYTAMTGK
FT                   SAGAVGEVLAGLAVDAVLAVEENGKVDVDNIKVEKKTGANVENSRVVRGLVLNKHRETS
FT                   SMPRKAENAKVLLLNVALDIKKTEVDASIKIRSPMQMQSFLEQEESIIRRKVDSIKKSG
FT                   ATVVFCQKAIADLAAHYMGKAGIMAFKSMSESDMAKLSKATGGRVVTKLDDIDPKDLGF
FT                   AGVVEERLITGEDDLLFIEGCKNPKALTILLRGSGYTSIDEYERALHDALRVVGVVIED
FT                   KKVVPGGGAPEIELGLRLRDYASTVGGREQLAIEAFAAALDIIPRTLAENAGLDPIDML
FT                   VELRSKHENKGGKNFGLDVFQGKPVDMLEANVLEPLRVKTQAIGSATEAATMILRIDDV
FT                   IASGGPSDQEVAQARAAAARQLQGMRGGMGGMPPGMGM"
FT   CDS_pept        650478..650780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0665"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0665"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60737"
FT                   /db_xref="GOA:D1YWB5"
FT                   /db_xref="InterPro:IPR005642"
FT                   /db_xref="UniProtKB/TrEMBL:D1YWB5"
FT                   /protein_id="BAI60737.1"
FT                   /translation="MDGMVTYIGLLVISLAAGVAAGLVRGKFSDSQKKYVSAAITCLVF
FT                   LLILLMGLKTGSNEAVISNLGLYGLQALLITVGAVLGSIAFAILFERLFFRDGVR"
FT   CDS_pept        650780..651385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0666"
FT                   /product="conserved hypothetical protein"
FT                   /note="Belongs to the Protein of unknown function DUF340,
FT                   prokaryotic membrane family (IPR005642)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0666"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60738"
FT                   /db_xref="GOA:D1YWB6"
FT                   /db_xref="InterPro:IPR005642"
FT                   /db_xref="UniProtKB/TrEMBL:D1YWB6"
FT                   /protein_id="BAI60738.1"
FT                   /translation="MSIILIILSALVIGIVAGVLGIVPPSVDSNVDTLITIMLCLLLFV
FT                   IGLDMSQNKSVIKEIRRIGWKILLLPAFIAAGSILGALVAGVVSGMDPRYAMAIGAGFG
FT                   WYSLSSVILTGIVGAQIGTMALLSNIFREMLSIVIMPLVVRYCGKTAAVAPGGATTMDT
FT                   TLPVVVKYAGSEMGIISFVSGITLSLLVVVLVPFFAGL"
FT   CDS_pept        651438..651659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0667"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0667"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60739"
FT                   /db_xref="UniProtKB/TrEMBL:D1YWB7"
FT                   /protein_id="BAI60739.1"
FT                   /translation="MGDVVLNAKFVLLFLLLAFCVTVSPAAASYAQAYAASGYGYPGLC
FT                   GYSFGLPGWGWSFPSFDWGWATSAIFPH"
FT   CDS_pept        652516..653925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recJ"
FT                   /locus_tag="MCP_0668"
FT                   /product="single-stranded DNA-specific exonuclease RecJ"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0668"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60740"
FT                   /db_xref="GOA:D1YWB8"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="UniProtKB/TrEMBL:D1YWB8"
FT                   /protein_id="BAI60740.1"
FT                   /translation="MSSCNGDTMQRFRKAAELCAERIKKCDEAVVVSHIDADGLTAAGI
FT                   MCKALDRLGRPHEEKFVKKLDDAALKGIADFSAGKLVIFTDLGSGALASIKALGIDAVV
FT                   TDHHRPAPVEYEYHMNPHLYGLNGSTEISGAGVSFLLSLCLGDNVDLGSLAIVGAVGDL
FT                   QDMRTNALVGVNRQILDLATSKGYIAYEKDIKLFGRQTRPVYKLLQYSSDPFIPGLSGC
FT                   EDACIAFIEGAGIPIKKDNWRRWIDLGQGEKKSLTSRLFQYCMACGMPSHKIQRLVGEV
FT                   YTLLKEEPGTELRDASEYSTLLNATARYDYADVGLAVCMGDRGEAFHYARDLLESHRHN
FT                   LVNGLNLVADKGVCRMNNLQYFHAHGEIRETIVGIIAGMSTSLDCVSRDMPIIGMAKSE
FT                   GGTKVSARGNHDLILRGLNLALALGEAASAVGGVGGGHDIAAGATIPEGKEHEFLETLD
FT                   AVIGAQLKKSI"
FT   CDS_pept        653986..654594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0669"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0669"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60741"
FT                   /db_xref="InterPro:IPR014518"
FT                   /db_xref="UniProtKB/TrEMBL:D1YWB9"
FT                   /protein_id="BAI60741.1"
FT                   /translation="MRMLTFYSQERWNNWINQVKESKFKIDPTAEGLGREGIVFLDMEE
FT                   DVILALCKVTGKLQLGTLAKEDAANSIQGMKEIVLAKIEPMDEDKDAMIESVQSSLVGA
FT                   FAAAEAFVGGDFDPKQKVEELVLQASKAEEGGDMDKAFEMMGKAGALVLAGKKFDSDKV
FT                   YEKIPPESFVAEGVDGLDTILAVLAGGIDYTDEADDEGD"
FT   CDS_pept        complement(654604..655215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0670"
FT                   /product="putative amino acid kinase"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0670"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60742"
FT                   /db_xref="GOA:D1YWC0"
FT                   /db_xref="InterPro:IPR011375"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:D1YWC0"
FT                   /protein_id="BAI60742.1"
FT                   /translation="MVMLFVLKLGGSLFGHAPDILRRVADSGSDVLVVPGGGPFADLIR
FT                   EIDLERGLSANAAHWMAVLAMDQYAYYLHDKTGIELTPLLVRKKGVRIILPYEVLRRQD
FT                   ELPHSWDVTSDTIAAWMAYKTASDFIKATDVDGVMLEGQLQETVDASTLKGRETCVDRA
FT                   MPGFLVEHGMDALIINGTVEGRLEDALKGKTVKGTKIRGK"
FT   CDS_pept        complement(655209..656000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0671"
FT                   /product="conserved hypothetical protein"
FT                   /note="Belongs to the Protein of unknown function DUF81
FT                   family (IPR002781)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0671"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60743"
FT                   /db_xref="GOA:D1YWC1"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D1YWC1"
FT                   /protein_id="BAI60743.1"
FT                   /translation="MELGLSLALFFITGIISGLFGGMLGIGGATILVPALTLIFGLPVY
FT                   LAIGVSLLNNVAVSTSATMRYKKRGLLNRRVILVMNLGSILGIIIGTFIATRSPEAAIK
FT                   VFFGAFLLFMVANGLLRRNAVDSVGMVELTPKTEVGLSGLGFVMGLLGALLGLGGGTVA
FT                   VPTLNNVFKMPLKQAIANSLATVILASALGAVIYFYLSAGALFSAEEALLTAFTIVPGS
FT                   IIGASLGARISERIDTKYIKYIFYAMLLYIAYNMIKSGLGW"
FT   CDS_pept        complement(657079..657792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0672"
FT                   /product="putative cytochrome c biogenesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0672"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60744"
FT                   /db_xref="GOA:D1YWC2"
FT                   /db_xref="InterPro:IPR039447"
FT                   /db_xref="UniProtKB/TrEMBL:D1YWC2"
FT                   /protein_id="BAI60744.1"
FT                   /translation="MDLSILASFKEIPLLYAFAIGLVTAIGPCPLSANIAAIAYVSSKF
FT                   TDARGTVSAGILYTAGRALTYTILGLLALMFSSAILDSAPLLQDYDKVILGPLLLVVGL
FT                   VMLEIVKPNISVGDGLKAKYGLKLSSMGALGAFGLGAIFALAFCPYTAVMFFGLLIPLT
FT                   LSSNVLGISYPLLFGIGTGLPVLVFALFLGISSSFAKSYVSKVVKVEPYVRKALGIGFI
FT                   LYGGYLLVAYAATIF"
FT   CDS_pept        complement(657795..658247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0673"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0673"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60745"
FT                   /db_xref="UniProtKB/TrEMBL:D1YWC3"
FT                   /protein_id="BAI60745.1"
FT                   /translation="MITLKKLSLLALVPVLALLLLASVLPAISSDTVSGTSAASGAPDK
FT                   IALLYFHRSERCISCNNAEQYARDTLNAYFPDEVKSGVLSIRSIDYQKDTEMAKKYNAN
FT                   MQGLKLVEYRGGQETVKDLPEIWAYVRDKNAYMNYLRDVLNKELGR"
FT   CDS_pept        complement(658364..658714)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0674"
FT                   /product="ArsR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0674"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60746"
FT                   /db_xref="GOA:D1YWC4"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D1YWC4"
FT                   /protein_id="BAI60746.1"
FT                   /translation="MNELQELEISPYPLSEKTKKGLKSIKTNDYRPTSDLFKALADPTR
FT                   VRIIEALGVKELCVCVLVDMTGLQYSALSYHLKNLKDNDIISYRKDGNFLIYSLTPKGK
FT                   AVHDFINKSQKL"
FT   CDS_pept        complement(658769..658945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0675"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0675"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60747"
FT                   /db_xref="UniProtKB/TrEMBL:D1YWC5"
FT                   /protein_id="BAI60747.1"
FT                   /translation="MITMAKEGCSCGINMSDLAMGTPYKDLGFRKVVCAKCGKEFFTDI
FT                   KGKTMCFECEKCP"
FT   CDS_pept        complement(658942..659181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0676"
FT                   /product="conserved hypothetical protein"
FT                   /note="Belongs to the Redox-active disulfide protein 2
FT                   family (IPR005243)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0676"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60748"
FT                   /db_xref="GOA:D1YWC6"
FT                   /db_xref="InterPro:IPR005243"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D1YWC6"
FT                   /protein_id="BAI60748.1"
FT                   /translation="MKVQIYGTGCAKCNMLEKAAKQAIKEMGVNAEVVKVNDINQIVEA
FT                   GILATPGFAVEGEVKSMGRVPSNDEIKKWIKAKM"
FT   CDS_pept        complement(659218..660297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0677"
FT                   /product="conserved hypothetical protein"
FT                   /note="Belongs to the Protein of unknown function DUF318,
FT                   transmembrane family (IPR005524)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0677"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60749"
FT                   /db_xref="GOA:D1YWC7"
FT                   /db_xref="InterPro:IPR005524"
FT                   /db_xref="UniProtKB/TrEMBL:D1YWC7"
FT                   /protein_id="BAI60749.1"
FT                   /translation="MIESLTDLGITLVNVGIDAVFEYISLHVLFCLIPAFFLAGAIAAL
FT                   FSKESVLKFLGPDANKVMSYGVAAVSGVLLAVCSCTVLPLFTGIYKRGAGIGPATAFLF
FT                   SAPAINVLAIVYSAQKLGLDIGAARAFCAVALSIVIGAIMAFLYQKSMNEERKNQKAAP
FT                   FIVTSQDGGETGYKYRTPITFLLLVVILVFGGWALDWLVKGPVLALLVLLAAYTSYRWY
FT                   NKDELTQWMNETWFLTKKIFPLLIGGVFFGSIIIYLIPVSYVQAFLGGNSLLSVSVASV
FT                   FAAFMYFSTLTEVPIVGLLMAQGMGKGPALAMLLSGPALSLPSMLVILNILGKKKGLTY
FT                   IGLVILMAVICGLVFGAIV"
FT   CDS_pept        660454..661023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtrA-2"
FT                   /locus_tag="MCP_0678"
FT                   /product="putative tetrahydromethanopterin
FT                   S-methyltransferase subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0678"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60750"
FT                   /db_xref="GOA:D1YWC8"
FT                   /db_xref="InterPro:IPR030688"
FT                   /db_xref="UniProtKB/TrEMBL:D1YWC8"
FT                   /protein_id="BAI60750.1"
FT                   /translation="MIPIGDKIEKTYKYGDASSPVAVATLASDYEKFDLKGYAILGSVF
FT                   TENFGVQMAIANMLKDQNIGYLILCGQESAHLSGHAFVTLHENGVVQIGTSRRIIGCKS
FT                   PLPFIDEIPMGAIDEYQENIKLIDMIGIEDTKLIQAKIDECTEESKKRSYRRKPFDAGM
FT                   PEIGAYSWKKYSAIVEIEMKNRLNRK"
FT   CDS_pept        661043..661399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0679"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0679"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60751"
FT                   /db_xref="InterPro:IPR014958"
FT                   /db_xref="UniProtKB/TrEMBL:D1YWC9"
FT                   /protein_id="BAI60751.1"
FT                   /translation="MGTNSSDGTIALLTCSSPSNAGRIAIRAAVTLLQFNPGRMEWAQL
FT                   KQPIEDIEEVARSADKILIIDGCPTCCVEKKLGEMGMKADGHVIVTDLLGITKSMADIK
FT                   GEEVRKVIEAIDRL"
FT   CDS_pept        661431..662363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trxB-2"
FT                   /locus_tag="MCP_0680"
FT                   /product="putative thioredoxin reductase"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0680"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60752"
FT                   /db_xref="GOA:D1YWD0"
FT                   /db_xref="InterPro:IPR008255"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D1YWD0"
FT                   /protein_id="BAI60752.1"
FT                   /translation="MSDKIYDIAIIGAGPAGLTSALYCGRANLSTIVFGNVYESQIAKA
FT                   GDIRNYPGIDSIQGVDLIEKFEIQAEHYNITHVPSNVTRAILGELFTLYSELDEFKCRS
FT                   IIVATGSKHRELNIPGEKELAYKGVSYCSICDGNLYKGKVVALVGSGDQAAKAALYLAG
FT                   LCKEVLVLTDKSDMDSPQYMEQVKSNTAIRVMGNARVVAIEGHEAVERIGFRINEGPEE
FT                   VAGVEAVFIEGGIPNTLLALELGLELDDKGNISVSRPDQSTNVSGVFAAGDVTSGIHQV
FT                   SKAVGDGASAAMSAILYVKKQKKGDSKLT"
FT   CDS_pept        662389..662874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0681"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0681"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60753"
FT                   /db_xref="UniProtKB/TrEMBL:D1YWD1"
FT                   /protein_id="BAI60753.1"
FT                   /translation="MKDEYRSCNPGISLEGPLSEEERKTLERKLVKTLNWIGVKIPQEV
FT                   ELKGKKVPLKEVMWDLMSKKECFTEEEKKILYDLEYALERKLKEDIKDVGTDEDKAEVL
FT                   GHYCEAMGLMRAIVSLKAMVETDRCHDDRQKLSRRITDRRKVEAENWLGFLKRIDIY"
FT   CDS_pept        662953..663930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0682"
FT                   /product="conserved hypothetical protein"
FT                   /note="Belongs to the Protein of unknown function DUF318,
FT                   transmembrane family (IPR005524)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0682"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60754"
FT                   /db_xref="GOA:D1YWD2"
FT                   /db_xref="InterPro:IPR005524"
FT                   /db_xref="UniProtKB/TrEMBL:D1YWD2"
FT                   /protein_id="BAI60754.1"
FT                   /translation="MLKEPVDYFTYTVLGLSPGSQMGSALNFFIYDTIKIFLLLSFMIF
FT                   AISYIRSYIPPHKVKEWLSHMNEYVGNVLAALFGIVTPFCSCSAVPLFIGFVESGIPLG
FT                   VTFSFLIASPMINEIAVIMLLGLFGWEVMALYIGTGLAIAIVAGIVIGRLKLEGEVEGY
FT                   VYDVLNKKKGMAACACGPVEIEEPTQKERLVYAKDYVVEILKKVWLYVVIAIGIGAFIH
FT                   GYVPTDFLAQYAGKDNPLGVLIAVLIGVPLYSNAAGVLPLVAVLMEKGVPLGTSLAFMM
FT                   AVTALSLPEMIILRKVLKPKLLAIFIGILATSIITVGYLFNAVL"
FT   CDS_pept        664002..665066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0683"
FT                   /product="putative arsenite resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0683"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60755"
FT                   /db_xref="GOA:D1YWD3"
FT                   /db_xref="InterPro:IPR002657"
FT                   /db_xref="InterPro:IPR004706"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:D1YWD3"
FT                   /protein_id="BAI60755.1"
FT                   /translation="MAETAKARLSFLDKYLTLWIFLAMALGVGLGYFYPALANFINSLS
FT                   IGTTSIPIALGLIVMMYPPLARVRYEEIGKVFRNVKVMALSLLQNWIIGPILMFILAIL
FT                   LLRNYPEYAAGLILIGIARCIAMVIVWNRLACGDSEYAAALVALNSIFQVIFYSIYAYI
FT                   FITVLPSWLGMQSMVVNITIWQVAESVLIYLGLPFAAAVLTRFVLRPRLGSDWYDNKFI
FT                   PAISPVTLLALLFTIVVMFSLKGQYIVSQPFDVVIIAIPLIIYFVIMFVVSFFISRYME
FT                   VNYEQSCTLSFTAASNNFELAIAVAVGVFGIDSGQAFAAVIGPLIEVPVMIALVNIALR
FT                   WREKYFTPKTWKGS"
FT   CDS_pept        complement(665089..665850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0684"
FT                   /product="ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0684"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60756"
FT                   /db_xref="GOA:D1YWD4"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:D1YWD4"
FT                   /protein_id="BAI60756.1"
FT                   /translation="MLSLQMLVEQLKRSFSIARKDIKIYYLKGPVITFGLIFPFFLIVA
FT                   YTLGRNVPIKDLYPGIMGMTVFFTATSVGPAIMPWEVRSQTFERLVSMPVALWAMLFGD
FT                   IQASFYFGLVISLLTAMIAPLIGVSILHVMVFGLALLLATLCFAALSVLLSAYPPTDTP
FT                   GNTMMLASMIKFPLVFISGVFLPIGQMPEWGRLVAYFSPLTYYTDLVRYTTDGISYFPI
FT                   LVDFTAIAVFTLIFIVAAIKIHEKVLTQRLT"
FT   CDS_pept        complement(665853..666773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0685"
FT                   /product="ABC transporter ATP binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0685"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60757"
FT                   /db_xref="GOA:D1YWD5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005894"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1YWD5"
FT                   /protein_id="BAI60757.1"
FT                   /translation="MNAIEANRLTKYYGSLAAVDQVSFTVDEGEIFGFLGPNGAGKTTT
FT                   MRMLTGVIRPDEGTGSIMGYDVVKENIRAKQARGVVPDTSNAYVDISAWQNLLLTGDLY
FT                   GVPRRLTEERAEKLLRRFGLYEKRDQVVKGYSKGMKQRLILCMALVSEPPILFLDEPTS
FT                   GLDVESSRLIKDIVREVNKGGVTVFLTTHNMEEANQLCDRIAIIRSGRIVAVDSPEKLK
FT                   ARSKELQSIEVSFDRPIDLAGVPLSGIAKTVKAGDKYRLYTGDPDTVIKQLVDYAESER
FT                   LRIVALSLLSPSLEDVFVELTKKEA"
FT   CDS_pept        complement(666787..667092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0686"
FT                   /product="hypothetical protein"
FT                   /note="Contains one Cupin 2, conserved barrel domain
FT                   (IPR013096)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0686"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60758"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D1YWD6"
FT                   /protein_id="BAI60758.1"
FT                   /translation="MSLIDLLALSEYSIEGRIKKDLLKTKGFNAVLVCLDAGQEIPPHP
FT                   EPYEVLFIVIEGEGTITGGDGRYSVKPGNAVYVKNGEIRGIRCDKRMAIVGIQEAH"
FT   CDS_pept        complement(667177..667509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0687"
FT                   /product="ArsR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0687"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60759"
FT                   /db_xref="GOA:D1YWD7"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D1YWD7"
FT                   /protein_id="BAI60759.1"
FT                   /translation="MANGEKCCENLKPVLDKLMKKMPSNEDTKRQAEYFKAISDPARVR
FT                   IIYALANGELCVCELMLIMGMQQTVVSHHLKILKYANIVSDRKSGKWVNYSLADRRVLD
FT                   ILKAIE"
FT   CDS_pept        complement(667557..667721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0688"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0688"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60760"
FT                   /db_xref="UniProtKB/TrEMBL:D1YWD8"
FT                   /protein_id="BAI60760.1"
FT                   /translation="MLEKIICIEGLTCERSAPFAGMRLVQEDVEVTMGKRRVAIPHVSE
FT                   LESMARRGF"
FT   CDS_pept        complement(667738..668553)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0689"
FT                   /product="putative methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0689"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60761"
FT                   /db_xref="GOA:D1YWD9"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR026669"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D1YWD9"
FT                   /protein_id="BAI60761.1"
FT                   /translation="MSSKIDELSVRKAVKERYSGLATSGSSGKDYASRIGYSGEAVEKL
FT                   PDQVLEVSAGCGNPTAIADLKPGQTVLDLGSGGGIDVFLSAQAVGSKGKAIGVDATPEM
FT                   IWRARKAAKEMNATNVEFRLGEIECMPVESNTVDVVISNCVINLSPDKEKAFMEAFRVL
FT                   RPGGKLAVSDMVLTEDVKADEQEMFKSWASCIGGAIPLDEYVGKMKAAGFKDIEINSRH
FT                   TYTSEELALMLGDTGCCGSGCGCGTGITTLTGSKALSKVATVKITARKE"
FT   CDS_pept        complement(669289..669567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0690"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0690"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60762"
FT                   /db_xref="UniProtKB/TrEMBL:D1YWE0"
FT                   /protein_id="BAI60762.1"
FT                   /translation="MIVRILNENQYVVPSLYYDDINKLDNEIVHLIAKGDEKGFKNTYA
FT                   KLIEIVRKNGVPMDVKAIKESDLIIPPADLTFEEARRIFVGEGLIPG"
FT   CDS_pept        complement(669564..670265)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0691"
FT                   /product="PspA/IM30 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0691"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60763"
FT                   /db_xref="InterPro:IPR007157"
FT                   /db_xref="UniProtKB/TrEMBL:D1YWE1"
FT                   /protein_id="BAI60763.1"
FT                   /translation="MPGLLSRLTATIKAKLSSLLDMFEDPRETLDYSYKRQLELQTDVK
FT                   KGVANVITARKRLELQKSKLEANITRLNEQAREAVAAGRDDLAAIALQRKMDMMTQADS
FT                   ITAQIQDLQRQEDKLTDTARKLDVKIEQFRTEKETIKAQYSAAEAKVKIQEATTGIGEE
FT                   MADVGYAVQRARDKTEEMQARSEAIDTMVEQGTLEDVLGNKDLVEKELEKIKSDAAVKR
FT                   ELETLKQEVKR"
FT   CDS_pept        complement(670334..671110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0692"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0692"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60764"
FT                   /db_xref="GOA:D1YWE2"
FT                   /db_xref="InterPro:IPR025098"
FT                   /db_xref="UniProtKB/TrEMBL:D1YWE2"
FT                   /protein_id="BAI60764.1"
FT                   /translation="MEGYEGLSDLLSNSIKYGLSNKRSILIWGAVYLVTMLLFFAGYIG
FT                   GIFLLIMDEKSMIAWVLILISFIPVLILSVFLAGYVRRCLSGLFAGNDTVPDISDLAGM
FT                   AVDGLKLSAIYIEAVVLMFIVFIPSIVFILLSYRYEEAIIGYCLLYPIELILMILVLGL
FT                   NVVQWAIFADTGSLMSGLNPVKAARLIAGDLRYVAVAGIAALILYLILSVVSTVLTLLV
FT                   ITLLALPFAIMPFYFALIYILARFYQHAKGKLPAAG"
FT   CDS_pept        complement(671184..672158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0693"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains one Aminoglycoside phosphotransferase
FT                   domain (IPR002575)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0693"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60765"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D1YWE3"
FT                   /protein_id="BAI60765.1"
FT                   /translation="MHGRSRLYRYLKSGRLSAKAGFDRYPDLRVKQLGGSHNVYLVSDH
FT                   RSHKKCIVKSFAGSGPKSVQHMEKEYKRLRQAGRLVDDRRWVHVARPLCKSNGEGFFAE
FT                   ELVSGKALGDYMRDAMANGRDSELYEKLTMLAGFLALLHKKTERPSHVKPSNIRDELKK
FT                   HARQASKGGAFAPHELKRIESLVDNVTSNDLISQTRRGLVHGDANPSNFLYDKKRLNVI
FT                   DMERSGYRDPVYDLGMLAGELCHYAMKYGGNEYKADPFIGHLYWTYAGNFKDQLGTFIR
FT                   LTGRNPIYMANSLLRIARHPFFSPEYKRRLARKAYECLKSLKK"
FT   CDS_pept        complement(672158..672889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0694"
FT                   /product="putative haloacid dehalogenase"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0694"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60766"
FT                   /db_xref="GOA:D1YWE4"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:D1YWE4"
FT                   /protein_id="BAI60766.1"
FT                   /translation="MKIKAVVSDIYTTLIDIKTDEVDKDPYRRLASYLKYQGVYLSADE
FT                   LKWFFFEKKALQKKQSKETYPEVDYRRIWGDILGENQYSGADVVAIVPEIVKLHRALTV
FT                   EKIKLYRGVFETLAGLKGGNNYRLGIVSDSQVDHAYPELRMLGIFGFFDAVVVSSEFGF
FT                   RKPDVRLFAECLKRLEVSPHESVYIGNDTFRDIKGARDAGMATVLIMTKHGSKDGKVAA
FT                   PDFTIEHIDEINEVLKKLEKK"
FT   CDS_pept        complement(672894..673571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoU-1"
FT                   /locus_tag="MCP_0695"
FT                   /product="phosphate transport system protein PhoU"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0695"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60767"
FT                   /db_xref="GOA:D1YWE5"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR028366"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:D1YWE5"
FT                   /protein_id="BAI60767.1"
FT                   /translation="MATVVSSRVDGIKADVLLMMGYVGLSIDEAVRSLDDRDVDTAKCV
FT                   IGRDRQINEYLRRIEAECLDMLAKKLEGEELRTVAASYKLVSDVERIGDYCTAIANVTL
FT                   AVANKPVTTTALDIIKMGRTALQMLNICMEAYKGRSEVNVEEVFDLDKSIDNLYNDSFV
FT                   GSITSILREPNTITNVIYLTMASRALERIGDHLTDIAERIIFIRSGKIVERSEPMHVPE
FT                   FPE"
FT   CDS_pept        complement(673664..674080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0696"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains one CBS domain (IPR000644)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0696"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60768"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:D1YWE6"
FT                   /protein_id="BAI60768.1"
FT                   /translation="MQVKDVMTTGIACVDSRSSAADAAKKMKDQNVGTVLVVDENQVKG
FT                   LVTDRAIVTKVVAEQQNPKDVPVGNVMTKQVVGCRESDDILEAVKTMGDMKVRRLPVVN
FT                   DRDQLVGVVSLADIAQEMRPAMDSMFDEITKATK"
FT   CDS_pept        complement(674447..674785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0697"
FT                   /product="putative 6-pyruvoyl tetrahydrobiopterin synthase"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0697"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60769"
FT                   /db_xref="GOA:D1YWE7"
FT                   /db_xref="InterPro:IPR007115"
FT                   /db_xref="InterPro:IPR038418"
FT                   /db_xref="UniProtKB/TrEMBL:D1YWE7"
FT                   /protein_id="BAI60769.1"
FT                   /translation="MRLGVIEYIDAAHYLPGHKTCGQWHGHTYKVELIIEGEKKETGMI
FT                   MDFYDMKSILRQVLSEYDHRPLNDIIEYPSVENICESVYSKLQGKITLPFMIRIWEGRG
FT                   KWCELGDI"
FT   CDS_pept        complement(674782..675513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0698"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains one Radical SAM domain (IPR007197)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0698"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60770"
FT                   /db_xref="GOA:D1YWE8"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024924"
FT                   /db_xref="UniProtKB/TrEMBL:D1YWE8"
FT                   /protein_id="BAI60770.1"
FT                   /translation="MKSPIREIFVSAQGEGPYVGYRQLFVRFPKCNLECQYCDTPKDWS
FT                   SESKCRVESKPGEFVEYDNPFSSEHLLSVIKLYERIHSVSLTGGEPLLYAKFIKELKTS
FT                   KFPLYLESNMTLPEGAKEVKDVVKYVSGDFKLKDQCDFKGHYEKYFNDTARSFSILRQT
FT                   SFRDCFCKIIVSEDIDREDMMHAVDQIKDCITELILQPVTPTGGVEAASSKLLLELQDK
FT                   ALEKVENVRIIPQTHRMWGAL"
FT   CDS_pept        complement(675510..676064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0699"
FT                   /product="conserved hypothetical protein"
FT                   /note="Belongs to the Protein of unknown function DUF366
FT                   family (IPR007162)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0699"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60771"
FT                   /db_xref="InterPro:IPR007162"
FT                   /db_xref="UniProtKB/TrEMBL:D1YWE9"
FT                   /protein_id="BAI60771.1"
FT                   /translation="MKCIFAGERIGYDGSQIGSLWAYTKFEVQDDNIICFRGSCAIPLK
FT                   HMIDVEDKIHNEKIESPDMLHFIVEHFDMPSLKVAYARQRLLACIAGEVFKDMGYSVSR
FT                   KGDDLFYNNGKLSISIASTSPVSCKIHFGINVRCDEYMSLEKMGIKDVDAVQKQIGQRY
FT                   AAEYEDMERDIRKSRPLEAYQ"
FT   CDS_pept        complement(676061..676747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="queC"
FT                   /locus_tag="MCP_0700"
FT                   /product="archaeosine biosynthesis protein QueC"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0700"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60772"
FT                   /db_xref="GOA:D1YWF0"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018317"
FT                   /db_xref="UniProtKB/TrEMBL:D1YWF0"
FT                   /protein_id="BAI60772.1"
FT                   /translation="MMGSIVLLSSGLDSAVAFKMALDAFGVDLALTFDYGQRAADMEIE
FT                   SAKMICERFGVRHEVIEAPWLEDVTLTALVNRGESVPTPSETELDEIKGKARETAHAVW
FT                   VPNRNGAFINIAACFADALKVDHIVCGFNAEEGATFPDNTPAFVEAINKSLYYSTENHA
FT                   KVIAPVIDMDKVEIIKKGMSIDAPLDLSWSCYVSGEKPCGKCESCVRRARAFKRAGVAD
FT                   PSLVVK"
FT   CDS_pept        complement(676744..676941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0701"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0701"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60773"
FT                   /db_xref="GOA:D1YWF1"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="UniProtKB/TrEMBL:D1YWF1"
FT                   /protein_id="BAI60773.1"
FT                   /translation="MPKISVDIPQELLDDLMTHVGKDKKFVSQSDAVRTAIRKMLDSLD
FT                   EVDRLHGRVDRRHSRTGRDK"
FT   CDS_pept        677040..677609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0702"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0702"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60774"
FT                   /db_xref="GOA:D1YWF2"
FT                   /db_xref="UniProtKB/TrEMBL:D1YWF2"
FT                   /protein_id="BAI60774.1"
FT                   /translation="MECHWKRKNFQSRKKDIKQNRKLTDMLKNGALGILALALILWAAN
FT                   FSYGFLHEAGHALVIKTLGGQVFEIYVNPLGTDAYTLHSFVSGTPGVLSMEIAGLTVTT
FT                   LLAFFTLLSDYAPLPIFMAMRTAIYALNYAPGTDIFEVQRLIGNYSLLITAALVLLNLA
FT                   CAAIAIQATIKNVSIREPVLQRLLHL"
FT   CDS_pept        complement(677586..678062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0703"
FT                   /product="GCN5-related N-acetyltransferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0703"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60775"
FT                   /db_xref="GOA:D1YWF3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D1YWF3"
FT                   /protein_id="BAI60775.1"
FT                   /translation="MSGNDGHSACIFIRAAKEDDVEKMYRLEQMCFDIEAFSTHQLQYL
FT                   INTKTAFSYVAEAEGDFAGFIIGLTNRNRFGKYGRVYTLDVDDRFRRMGIATTLMDALM
FT                   ESLRRAGCTSCFLEVKMDNSKAIPLYEKMGFRRSRIVPNYYSSGVHALKMKKPL"
FT   CDS_pept        678199..679470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisD"
FT                   /locus_tag="MCP_0704"
FT                   /product="histidinol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0704"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60776"
FT                   /db_xref="GOA:D1YWF4"
FT                   /db_xref="InterPro:IPR001692"
FT                   /db_xref="InterPro:IPR012131"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR022695"
FT                   /db_xref="UniProtKB/TrEMBL:D1YWF4"
FT                   /protein_id="BAI60776.1"
FT                   /translation="MIKQLYGVDDAALDEVFKRRTSISSVMDTAKKVADEVREGGDAAV
FT                   RKYTKQFDGVDLRDLEVTDDEMYNAVELIDYETIGHLEKAIDNIEAFHALQRPSGDMWL
FT                   TEISPGIRLGQKFTPLERIGAYVPGGTGSYPSTALMLIVPAQVAGVSEIIACTPPRKDG
FT                   TIHPLTLTALDMAGADRIFKVGGVQAIAAMAYGTQSIPKVEKIVGPGNIYVTAAKMYVR
FT                   DAAEIDMPAGPSEIVVIADDTAIPSFIASDMIAQAEHDVNAMSILLTPSEMLAESVELE
FT                   IERQKENAPRRQIIDKAGMGIYVLDDLDAAVEVCNRIAPEHVEIMVRDPMSTLNKVRNA
FT                   GTVYVGDYAPVAAGDYASGANHVLPTGGYAKVFSGMNTMQFIKTTSVQVIEKGGLEGIK
FT                   DTITALAEIEGFDAHARSVYKRFE"
FT   CDS_pept        679470..680774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aspS"
FT                   /locus_tag="MCP_0705"
FT                   /product="aspartyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0705"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60777"
FT                   /db_xref="GOA:D1YWF5"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004523"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:D1YWF5"
FT                   /protein_id="BAI60777.1"
FT                   /translation="MQRTHYSRDITPAMNGSTVTVNGWVHEIRDFGGLAFLILRDREGL
FT                   VQVTMPKKKVSKEIVDTVKGLSRESVVSVTGDVKAMEKAPNGYELIPTALEVLSRADAP
FT                   LPLDPTGKVPAELDTRLDSRFMDLRSPEVTAVFYVRANMIKAIRDYLSSQGCLEIASPK
FT                   IVATATEGGTELFPISYFEREAFLNQSPQLYKQMMMAGGMDRVYEIGPIFRAEEHATRK
FT                   HLNEATSIDVELSFATDEDAMRLLENTIAYAYAYVKEHCQAQLKVLNVDLQVPKTPFRR
FT                   LCYRDAIEIAKKDPECADIEYGDDLSTQAEHAVGQAIGEHYFIVNWPTNIRAFYTQPCE
FT                   NDPSICKAFDLMHPRMELSSGAQREYRYAELVKKMEEKGLSPESFKFYLDSFRYGMPPH
FT                   AGWGLGAERLLQTMLNLNNIREAVLFPRDRVRLTP"
FT   CDS_pept        complement(680982..682286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0706"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0706"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60778"
FT                   /db_xref="GOA:D1YWF6"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="UniProtKB/TrEMBL:D1YWF6"
FT                   /protein_id="BAI60778.1"
FT                   /translation="MDVLRGSGLFKPRVFKSNGLEAYHLISDEGGSFLYEGRIDYSDAE
FT                   LFNDEQGKAYYLVTTDIGGPSKYYVEVEPVGKPIPAVHKEKEKSISDLVKTTPEEQAPG
FT                   APVPEPSPEPAIKPEVSKEPEAAPTPAIAPMPVDTGTKGVPKETCFETPEQPPEEKPST
FT                   TEEAQAAVKAMASLGENRPHKKSKVPLILALLVIALIVAGAAIAVYRPGLISGLPFIGQ
FT                   ATPTPTPEPTVTPTPEPTVTPTPTPSPTTLPGGGDIYRNLLTIAPAINASDPAVTGYVA
FT                   NNSNQTGTSYGQLAKVCDLFDAVNKRWSLVNGNDTAPQSLNKSVETMEGSMMDYSVLMA
FT                   SLAEAEGMDARIVAVYNEGMSSYVYYPEIKVAPNDSDYNDALVYLKARYDIENPYGHAD
FT                   GIVHWLSLSLNNTPGGYVDTKFAYTVNSKSEITGV"
FT   CDS_pept        complement(682383..682577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0707"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0707"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60779"
FT                   /db_xref="GOA:D1YWF7"
FT                   /db_xref="UniProtKB/TrEMBL:D1YWF7"
FT                   /protein_id="BAI60779.1"
FT                   /translation="MVLGRIIAAIIAVLAFIVAWRLLDVFLGFSFGILLWVIKALLFLV
FT                   LLYVVYRLFAGRRGQPYLR"
FT   CDS_pept        complement(682652..683389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0708"
FT                   /product="glutamate synthase large subunit domain 3"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0708"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60780"
FT                   /db_xref="GOA:D1YWF8"
FT                   /db_xref="InterPro:IPR002489"
FT                   /db_xref="InterPro:IPR012061"
FT                   /db_xref="InterPro:IPR035710"
FT                   /db_xref="InterPro:IPR036485"
FT                   /db_xref="UniProtKB/TrEMBL:D1YWF8"
FT                   /protein_id="BAI60780.1"
FT                   /translation="MVHIDAKEMPYRALNEKIRALAAEGEYSVELDNVCGQKYIGGGLK
FT                   GKMKIDVRGIPGNDLGIFMDGAEVVVHGNGQDGIGNTMNSGKVVVHGNAGDVIGYAMRG
FT                   GKVFIKGDVGYRVGIHMKAYGDMVPTIVIGGTASDFLGEYMAGGVMVLLGLTQNSHPQP
FT                   TGDYVGTGMHGGVIYVRGDIDDYYLGREVIKSEPDAKDIAIISRLVGEYCVTFGCDFDE
FT                   IMRKPFIKLAPRSHRPYGNLYTS"
FT   CDS_pept        complement(683391..684917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0709"
FT                   /product="glutamate synthase large subunit domain 2"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0709"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60781"
FT                   /db_xref="GOA:D1YWF9"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR024188"
FT                   /db_xref="UniProtKB/TrEMBL:D1YWF9"
FT                   /protein_id="BAI60781.1"
FT                   /translation="MTTVALPSTVPPEFSVEVNDRKCVRCKKCTTECGFGAVTYSKEFD
FT                   CIIADDSKCVACLRCVTMCPKRAIRIEHNPLTFKPNASFTDEIRKNIYKQAESGGILLT
FT                   AMGTDKPYPILWDHLLIDACQVTNPSIDPLREPMELRTYLGKKPDKLEFDFSGGSLKLK
FT                   TDLAPNFRLDIPVIFGAMSYGAISYNVHKSLMLAAKECGTLMNTGEGGLHRDFYQYKDN
FT                   VIVQCASGRFGVTEEYLNAGALVEIKIGQGAKPGIGGHLPGEKVSEDVSKTRMIPVGTD
FT                   ALSPAPHHDIYSIEDLSQLIYALKEATEYKKPVSVKVAAVHNIAAICSGIVRAGADIVT
FT                   IDGFRGGTGSAPRIMRDNVGIPIELALAAVDDRLRAEGIRNQASIVVGGGIRQSADVVK
FT                   AIALGADAVMIGTAALVALGCRVCQKCNTGNCSWGIATQKPHLTARLDPEIGAQRLTNL
FT                   LSAWSHEIQEVLGALGINSVESLRGNRERLRGIGLDEKTLEILGVKPAGR"
FT   CDS_pept        complement(684914..686008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0710"
FT                   /product="glutamate synthase large subunit domain 1"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0710"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60782"
FT                   /db_xref="InterPro:IPR012375"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:D1YWG0"
FT                   /protein_id="BAI60782.1"
FT                   /translation="MRCDTKVRCERNPSGCAISGILNKKGKRIDGTKIIKSIALMHDRS
FT                   NGLGGGFAAYGIYPKYRDYYAFHVMFDDEDCQARLEEHLAQRFVIEKDEKIPTVKVDSI
FT                   HNAPLIRRYFVRVDDSKLENKPEDDYVVEQVMDINSNFAGAFISSSGKNMGGFKGVGYP
FT                   EDIAKYFKLDQYKAYLWTAHGRFPTNTPGWWGGAHPIALLDWSVVHNGEISSYGINKRY
FT                   LEMFGYKLELLTDTEVIAYLFDLLVRKHKLPITVATKALAPPFWKDIDRMEPSQRRAHE
FT                   AIRMVYGSALMNGPFSIIVGCNRGMIGLNDRIKLRPMMAATKDDTLYMSSEEAGIRIIE
FT                   PEPDQIWAPKAGTPVIGLVEEDVE"
FT   CDS_pept        complement(686233..688671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrA"
FT                   /locus_tag="MCP_0711"
FT                   /product="DNA gyrase subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0711"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60783"
FT                   /db_xref="GOA:D1YWG1"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:D1YWG1"
FT                   /protein_id="BAI60783.1"
FT                   /translation="MATQETVLPVKIEEEMRKSYIDYAMSVIVGRALPDVRDGLKPVHR
FT                   RVLYGMYELGNTYDKPYKKSARVVGDVMGKYHPHGDMAIYDTIVRMVQDFSLRYPLIDG
FT                   QGNFGSVDGDSAAAMRYTEVRMAKIADEMLDDLDKETVNFVPNFDESLKEPSVLPAKLP
FT                   NLLINGSSGIAVGMATNIPPHNISEVIDGTVALINDPAIEPLELLKLITGPDFPTGAYI
FT                   YGREGIKDAYLTGRGSIKIRAKAEITEEGGRNVILVTEIPYMVNKAKLIENIADLVRDK
FT                   KLEGISDLRDESDRDGMRIVIELKKGANANVLLNQLYRHTQMETTFGVNNLALVDNQPR
FT                   TLSLKETLEYYLKHRQEVVTRRSQFELKKAQAREHILAGLLVALDNIDDFVNILRRSAS
FT                   ADDAKAVFMSKYGLSEEQSKAILDMRLRGLTGLERRKIEDERAELIKLIAHLKEVLASP
FT                   QMVLDIIKNELLELRAKYGDGRRTIIKESDGEIVDEDLIPVENVVVTISNTGYIKRQPV
FT                   DTYRTQRRGGMGIMGMETKEEDFVVDVFTASTHDHLLFFTNKGRVYVLKVYEIPEASRQ
FT                   SRGKAIVNLLTLMPNESVNAMIPIKEFDEKHYLIMCTREGTIKKTALSSFQNIRRTGII
FT                   AIGLDEGDELISVKLTNGGQEVLIATRNGKANRFSESEVRPMGRQAGGVIGIRLTEKDK
FT                   VIGMEVVSESASILTVCENGFGKRTAISEYTPHHRGGQGMINIKTTLRNGGVVAIASVT
FT                   DDDQLLVVTRDGIMMRINVKDISEISRNTQGVKIITLKSENDAVVGVAKLVSEKKEEEI
FT                   "
FT   CDS_pept        complement(688675..690582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="MCP_0712"
FT                   /product="DNA gyrase subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0712"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60784"
FT                   /db_xref="GOA:D1YWG2"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D1YWG2"
FT                   /protein_id="BAI60784.1"
FT                   /translation="MSNEIPAQAYDASSIQVLEGLEAVRKRPSMYIGSTDYRGLHHLVY
FT                   EVVDNSIDEALAGYCHNIEVTINKDGSVTVSDDGRGIPVEMHEKYKRPALEIVMTMLHA
FT                   GGKFDNLTYKVSGGLHGVGVSVVNALSEWLRVEVRRNEKLWVQEYVRGKPKDEVHEIGT
FT                   AIGTGTTTIFKPDPTIFETTEFKYEILVNRLRELAFLNKGVKITLMDARSGVSDTFHYE
FT                   GGIVQFVQYLNEGKTPVNEKVIYFEKQKDTTDVEIAMQYNDGYSEIVLAFANNIHTTEG
FT                   GTHLSGFRSALTRSFNDYAKKNSLLKGDMQFSGEDIREGLTAIISVKLTNPQFEGQTKT
FT                   KLGNSDVQGIVNSLVGEGLDDFLEENPSEARKIIDKAVQAFQAREAARKARELTRRKSV
FT                   LENTTLPGKLADCSERDPSKCELYLVEGDSAGGSAKQGRNRLFQAILPLRGKILNVEKA
FT                   RLDRVLTSEEIRALITAMGTSVGEDFVIDKARYHKIILMTDADVDGAHIRTLLLTFFFR
FT                   YMKPLIEAGYVYIAQPPLFRAKKGKEERYAYNEEALAGILEEMGRNGVAVNRYKGLGEM
FT                   NPEQLWSTTMDPQTRTVLQVTMEDAVEADRTFTLLMGDKVEPRRDFIVQNAKFVRNLDV
FT                   "
FT   CDS_pept        690794..691441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0713"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains one RNA-binding S4 domain (IPR002942).;
FT                   Contains one Methyltransferase type 12 domain (IPR013217)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0713"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60785"
FT                   /db_xref="GOA:D1YWG3"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR004538"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:D1YWG3"
FT                   /protein_id="BAI60785.1"
FT                   /translation="MRLDEYLVSEGLVPSRSRAKRLIEKGQVKVDGKAVLKPSQKVEYG
FT                   RKVAIEGEDMPEGYFKLKGIQEASGILRPGDVVLDIGSSAGGFLMFASGIASRVVGIEF
FT                   SREFLEPLSNVEKEYPGVKVMFGDAFRMDLAALGGPYDVILNDMTVEPLTSIEVLKRFL
FT                   PLLKEHGRIVQVVKLGPRGTPEPMIKKLAEAGLKIQKVIRPQKMEAYIVAEK"
FT   CDS_pept        complement(691454..691762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0714"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0714"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60786"
FT                   /db_xref="UniProtKB/TrEMBL:D1YWG4"
FT                   /protein_id="BAI60786.1"
FT                   /translation="MEAVYFYEDKEKKPVDKLLEEEFFKRLGPSVREAAIMGTNRKTGY
FT                   YLYVRADNPEKMKEAVRLIEESKIPIAKITGDEEKHILDYIHKEEDEAASGMGAIFG"
FT   CDS_pept        complement(691818..692651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0715"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains one Protein of unknown function DUF362
FT                   domain (IPR007160)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0715"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60787"
FT                   /db_xref="InterPro:IPR007160"
FT                   /db_xref="UniProtKB/TrEMBL:D1YWG5"
FT                   /protein_id="BAI60787.1"
FT                   /translation="MAKSTLISIVHTSDPVEGPKKALDMIGAGGILNRYERVLIKPNYV
FT                   NSSKPETGVTTDPRVVKGIVEYLLDHGWSNKEFAVGEGGMASYDTMETFRSTGLVDALE
FT                   DYEVTLYDLNAQPHVEVDIPGGKSLKSVRVAKPFIDYDCILSVPKLKVHVWSLSTLSMK
FT                   NMMGGILPKGIMHDDLHQKIVDLNRVFGPELTVIDGIIGCQGHELACDPIRSDVIIAGE
FT                   DFVATDAVGSFLMGLCPDDIPYLKLAKKAGMGENEMEKIEYMGETISQLRKYYRM"
FT   CDS_pept        692833..693255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0716"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0716"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60788"
FT                   /db_xref="GOA:D1YWG6"
FT                   /db_xref="InterPro:IPR018990"
FT                   /db_xref="InterPro:IPR036331"
FT                   /db_xref="UniProtKB/TrEMBL:D1YWG6"
FT                   /protein_id="BAI60788.1"
FT                   /translation="MTGKLTDSLPLALSGLVIAGILVAFIASVMLPSRGIEASYGAADN
FT                   GKEISIGEGTTFKIILDENPTTGYSWNTTVTSGLRVENSEFIQGGNAGLAGAGGTHEWT
FT                   IKATGKGEQQFTAIYKRPWEPTTGSESAFTLKILVN"
FT   CDS_pept        complement(693267..693569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0717"
FT                   /product="ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0717"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60789"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D1YWG7"
FT                   /protein_id="BAI60789.1"
FT                   /translation="MFNSYKVNTLKFDPEECTGCGMCTKVCPHAVFAYQDKKVVLANKE
FT                   ACMECGACFLNCPTTAIEVESGVGCAAAMIKAALTGGPETCDCGCDETDKPPGCC"
FT   CDS_pept        complement(693570..694565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0718"
FT                   /product="conserved hypothetical protein"
FT                   /note="Belongs to the CO dehydrogenase/acetyl-CoA synthase
FT                   delta subunit family (IPR004486)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0718"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60790"
FT                   /db_xref="GOA:D1YWG8"
FT                   /db_xref="InterPro:IPR016041"
FT                   /db_xref="UniProtKB/TrEMBL:D1YWG8"
FT                   /protein_id="BAI60790.1"
FT                   /translation="MAESISVSKIVRTTSTLTLKDRLDHFMTRWGYRRAYHRVEPGLYS
FT                   LGNPTAESPVLVTANYTLSFDALRSNLKDVDCYILVLDTKGINVWCAAGKGTFGTDELM
FT                   NRIKATGLEGAVSHRKVILPQLGAAGVSAFSLKEWCGWNVEYGPVRAEDLPEYLKTHRA
FT                   TPAMRKVLFGLWDRIQLIPVELVSVFLAMAAASIILYFIMGLTAALAALACVLAGVVLF
FT                   PVLLPYIPVKDFSAKGLILGLLVALQFAYIAFTAPGSATLNAVAAAGYLLAMPPVTAYL
FT                   ALNFTGCSTFTSRTGVRREIFTYIMPMAVMFGLGALIFIGLNVARFMGVA"
FT   CDS_pept        complement(694576..694809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0719"
FT                   /product="putative AbrB family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0719"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60791"
FT                   /db_xref="GOA:D1YWG9"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:D1YWG9"
FT                   /protein_id="BAI60791.1"
FT                   /translation="MGGYRVEAMVSVDERGQMVMPKELRDKIGIKAGDKLVVLSWQSEG
FT                   DVCCISLIKTDYFLSIMKDRLGPMMGELTTGK"
FT   CDS_pept        complement(694926..695312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0720"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains one PilT protein, N-terminal domain
FT                   (IPR002716)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0720"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60792"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:D1YWH0"
FT                   /protein_id="BAI60792.1"
FT                   /translation="MDICMDPNVFSSGPNFLEWMRKKDVKGYLSSLAFMELSYYEMKRV
FT                   GGSMVKFLGVLNGLDIEIVSFDKGQAMIAAKNALHGHDFSDNAVDYGIGAYAYKRKIPL
FT                   VTNNKKHFQWVGEVYTPAEFMKKQ"
FT   CDS_pept        complement(695312..695557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0721"
FT                   /product="putative AbrB family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0721"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60793"
FT                   /db_xref="GOA:D1YWH1"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:D1YWH1"
FT                   /protein_id="BAI60793.1"
FT                   /translation="MDASSSKVSSQNQITLPAEVRDRLGIGPGDKVVFVEEDDKVVIRN
FT                   LKDLIYEVVEGFKDFDKTDKEFRDAWAKRLKREGID"
FT   CDS_pept        695669..697045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0722"
FT                   /product="conserved hypothetical protein"
FT                   /note="Belongs to the Conserved hypothetical protein 1213
FT                   family (IPR005912)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0722"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60794"
FT                   /db_xref="GOA:D1YWH2"
FT                   /db_xref="InterPro:IPR004114"
FT                   /db_xref="InterPro:IPR005912"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR039894"
FT                   /db_xref="UniProtKB/TrEMBL:D1YWH2"
FT                   /protein_id="BAI60794.1"
FT                   /translation="MTIIETAKCILKEGPVCDPCLGRQFGKLSTGLTNAQRGFAIKTEM
FT                   SMQAAADGDRETQQLLAPAFAQARKVLGIEGQDEECWLCRGLFQNPENIQKWADRCIES
FT                   VSGYEHDTLLVGTKVPPIYSEKEEVIWAECGVAHAEPLKAELNREVGKAVSQKTGKEVD
FT                   FKRPDVVFTIDLAADRVVPKINSLFIYGRYNKYVRDIPQTRWPCRECGGKGKKGEAECE
FT                   HCKGTGKMYPTSVEEQINHEVIDEFKAGDAILHGAGREDIDGRMLGDGRPFVMEVINPR
FT                   VRWVDLDALRERINAYASEKVAVSGLHYVDKDSVEQVKSIKPDKTYRLKVIYNDDISIE
FT                   TLKSSLATLSNSTILQRTPVRVSHRRADLERKRKVHSITLGELNEADKYFTITVRCEGG
FT                   LYVKELVSGDNGRTSPSLSALLNRQARVTELDVMNVEGGISWQDHMVKEKRPGTSSQRR
FT                   "
FT   CDS_pept        696988..697296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpl21e"
FT                   /locus_tag="MCP_0723"
FT                   /product="50S ribosomal protein L21e"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0723"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60795"
FT                   /db_xref="GOA:D1YWH3"
FT                   /db_xref="InterPro:IPR001147"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR022856"
FT                   /db_xref="InterPro:IPR036948"
FT                   /db_xref="UniProtKB/TrEMBL:D1YWH3"
FT                   /protein_id="BAI60795.1"
FT                   /translation="MARSHGERKKTRYKFTKALRERGFSPVSRAVQEFTVGQKVHIDID
FT                   PSVHKGMPYRRFQGKTCTVTGTRGRAYLLEMYDGGLRKEIIARPQHLRPQKDQPAEQ"
FT   CDS_pept        697310..697660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0724"
FT                   /product="putative DNA-directed RNA polymerase subunit F"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0724"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60796"
FT                   /db_xref="GOA:D1YWH4"
FT                   /db_xref="InterPro:IPR005574"
FT                   /db_xref="InterPro:IPR010924"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="UniProtKB/TrEMBL:D1YWH4"
FT                   /protein_id="BAI60796.1"
FT                   /translation="MIIKKVISEELITLPEVRDTLNAIRDEREKAGQELRYEQKRAVEH
FT                   ANKFSKIGAKESRDMVNELLTLEKMKLDIAVKIANLCPRSKDELRAIYAKERFTLNEAE
FT                   LKAILDIVGKYI"
FT   CDS_pept        697716..698288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0725"
FT                   /product="conserved hypothetical protein"
FT                   /note="Belongs to the Protein of unknown function DUF655
FT                   family (IPR007003)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0725"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60797"
FT                   /db_xref="InterPro:IPR007003"
FT                   /db_xref="UniProtKB/TrEMBL:D1YWH5"
FT                   /protein_id="BAI60797.1"
FT                   /translation="MPITHTTDIKEQFAYIIDFLPTGHAEDTRPIHLRKPLAQALGAEF
FT                   FILLELSVKEGARVEIESKVFVGKGERDIVKHVEKRLRYDELTPSAKVELPYMIEKIVK
FT                   ENEAKYVEFFNTAQPITTRLHMLELLPGIGKKMMWAIIDERKKGKFKSFADIETRIKGL
FT                   HHPDKLIAKRIEQEIQDEQMKYRMYAR"
FT   CDS_pept        698289..699119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ksgA"
FT                   /locus_tag="MCP_0726"
FT                   /product="probable dimethyladenosine transferase"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0726"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60798"
FT                   /db_xref="GOA:D1YWH6"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D1YWH6"
FT                   /protein_id="BAI60798.1"
FT                   /translation="MPAFTALTAFIAPDKRKDQHFLIDLNILKKIVAIADIHKDEDVLE
FT                   IGTGPGNLTELLAQKARHVYTIEMDPALVALLEEKFKGSNVTIIKGNALKVEFPRFDKV
FT                   VANLPYSISSDVTFKLLKNNFKLGILMYQREFAQRMIARVGEPDYSRLSVDVQHFADVE
FT                   ILMKVPPQAFSPPPEVESAVVRVTPRPAAYSVKDRALFMALVTAAFTQRRKRLRNALVN
FT                   GAHIMGIHGMKALVSRLPPDLMDKRAEEVSPEEYAALADRLYELTAHERSGLSK"
FT   CDS_pept        699094..699672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0727"
FT                   /product="methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0727"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60799"
FT                   /db_xref="GOA:D1YWH7"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004557"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D1YWH7"
FT                   /protein_id="BAI60799.1"
FT                   /translation="MSVRVYRNKEFELLDDVYDPGEDSYLLVEAALKEVKPDDRVLEVG
FT                   TGSGVVSLFVKDIAAKVVATDISPIACRNARINGVPVVRADLYSGICSQFDLIIFNPPY
FT                   LPTVPEEQLGSWLNRAFDGGLTGRREIERFIKDIDRILAPGGRILAVISSITGIDETEA
FT                   LFKDKGFHMATAAIEKVPFEKLVVLRFSR"
FT   CDS_pept        699717..701159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0728"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains one Carbohydrate kinase domain
FT                   (IPR000631).; Contains one YjeF-related protein, N-terminal
FT                   domain (IPR004443)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0728"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60800"
FT                   /db_xref="GOA:D1YWH8"
FT                   /db_xref="InterPro:IPR000631"
FT                   /db_xref="InterPro:IPR004443"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="InterPro:IPR030677"
FT                   /db_xref="InterPro:IPR036652"
FT                   /db_xref="UniProtKB/TrEMBL:D1YWH8"
FT                   /protein_id="BAI60800.1"
FT                   /translation="MKPITVEDMRALEANSDYFGVSYGELMENAGRKAAESIIALFKRC
FT                   NVLVVCGTGNNGGDGFVTARFLREAGYGVLIVLLGRVGQVKEGPALANIEIVRGMGIPV
FT                   VESILPEEVPKEAFDGCDLIVDAVLGTGFQGTPREPARTAIRYMNQSPAPRVSLDVPSG
FT                   LDAHTGECAECVDADLVITFYAPKKGLDRYKVEVVDIGIPKKAFTHIGPGSMVGLRSRG
FT                   DFVEKGGGGRLLIIGGGPYTGAPAMAAMAAYRAGAEIVTVAAPKRAADIIASFSPDLIV
FT                   RPLSDEDFLVEKDVPMLKELISRHHAVVIGMGLGREPETLAAAGRIIPLCERAVIDADV
FT                   LQTEIPLSGIVTPNVHEFNRLSGETLGPKDTAAAEKVRKFSAQNKVVTLWKGSPAVVSD
FT                   GNEVKINSTGNPGMAVGGTGDVLAGITGAFYCRNDAFKAACAAAFISGAAGDMAFEDKG
FT                   YGLVATDVIHWLPYAVKRYRHA"
FT   CDS_pept        701201..701677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="moaC"
FT                   /locus_tag="MCP_0729"
FT                   /product="probable molybdenum cofactor biosynthesis protein
FT                   C"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0729"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60801"
FT                   /db_xref="GOA:D1YWH9"
FT                   /db_xref="InterPro:IPR002820"
FT                   /db_xref="InterPro:IPR023045"
FT                   /db_xref="InterPro:IPR023047"
FT                   /db_xref="InterPro:IPR036522"
FT                   /db_xref="UniProtKB/TrEMBL:D1YWH9"
FT                   /protein_id="BAI60801.1"
FT                   /translation="MRSTDFTHVEGDKVKMVDVGSKEEVVRIARASGTIHLTKETMALI
FT                   KAGNVKKGNVLAAARIAAIQAAKHTWETIPLCHQIPITGIDVEFEVGDTDIKAIAEVRS
FT                   VGKTGVEMEALCAVSTALLTIWDMVKAVEKDETGNYPETKITNIVVDKKIKAKQ"
FT   CDS_pept        701674..702381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0730"
FT                   /product="putative RNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0730"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60802"
FT                   /db_xref="GOA:D1YWI0"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004384"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:D1YWI0"
FT                   /protein_id="BAI60802.1"
FT                   /translation="MISIRVVLIEPLYEGNVGSVCRSMKNFGFADIVLVKPCRLDNFAK
FT                   AMASHAQDLLATARIVDTFDEALEGADLLVATTGKPGAHINSHVRYPFYNPKELRTMLE
FT                   DKSGTAALIFGREDAGLPNEIVERCDIVAYIPTSKDYPIMNLAQAVSIFLYELSGFKGG
FT                   NVALADREDVDRLYENYSNLLDDINYPEHKKDKTMMMLRRIYGRAMLNRREYYTMMGVL
FT                   HEIGLALERAKKR"
FT   CDS_pept        702405..703058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0731"
FT                   /product="putative phosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0731"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60803"
FT                   /db_xref="GOA:D1YWI1"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:D1YWI1"
FT                   /protein_id="BAI60803.1"
FT                   /translation="MRFLAVTDFHGNYDKAIDILHKAGAGGNPPGVDGTLIAGDLTEFG
FT                   PVEKAKQIIDMLPRPILAVPGNCDPKEIVRLLEREDVCLHRERITFDGITFVGIGGSNP
FT                   TPFGTPFELSEDEIRKTLEELVKGVKGPMVLISHAPPKGYQDRIPNGVHVGSEAVAQLG
FT                   PKFKVIVCGHIHEDPGISKMGDTIVVNPGVASEGNAAIVEIDEKGNAKAELIKG"
FT   CDS_pept        703061..703480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0732"
FT                   /product="conserved hypothetical protein"
FT                   /note="Belongs to the Protein of unknown function UPF0047
FT                   family (IPR001602)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0732"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60804"
FT                   /db_xref="InterPro:IPR001602"
FT                   /db_xref="InterPro:IPR035917"
FT                   /db_xref="UniProtKB/TrEMBL:D1YWI2"
FT                   /protein_id="BAI60804.1"
FT                   /translation="MTVVTKTFSFQSKGRDDMIDITSNVQDSLTASGLTSGIVIVFVPG
FT                   STASITTIEYEPGLLKDFPRAMEKLAPREAHYDHDARWGDGNGHSHVRASTIGPSLVVP
FT                   FQNGRLMLGTWQQIIFIDFDNRPRSRNVIVQAMGE"
FT   CDS_pept        complement(704156..704542)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sor"
FT                   /locus_tag="MCP_0733"
FT                   /product="putative superoxide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0733"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60805"
FT                   /db_xref="GOA:D1YWI3"
FT                   /db_xref="InterPro:IPR002742"
FT                   /db_xref="InterPro:IPR036073"
FT                   /db_xref="UniProtKB/TrEMBL:D1YWI3"
FT                   /protein_id="BAI60805.1"
FT                   /translation="MMKVAETTPNLFEKVNYPKDPNNMTDLEKKHWPRIECPDTVEANK
FT                   PFDVTINIGVGIDHPSELAHFIEWISLGRTDGNIEMCREVLLPKFSYPRVTFKVALDKS
FT                   TTLVARESCNLHGLWENKKQVNVK"
FT   CDS_pept        704709..705617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0734"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0734"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60806"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="UniProtKB/TrEMBL:D1YWI4"
FT                   /protein_id="BAI60806.1"
FT                   /translation="MFRKALITISFLACICLAVSANAQEAQNVTTLYWSPVTLVYPSTT
FT                   FTIEDAKDINYTIYDELGAQSVHVSVITAQLYLNGAPYHMANIPITFSSDNDSIAYLEP
FT                   YNRTRPSDANGQAKILLIAHNRTGFVNITAESEIIYGHRLSDTCRVRVVGWGTVSGIVT
FT                   DQNRNGIHDATVTLWHWNGTANTKMLASKDNPQLSNDGRTAAPGMYTFVYVPVGSYNVT
FT                   AEKEGHSYYRLIDMYEGSGTITANVAIPDYVFISPATLTPTPSASPTTGAPSATPVPTP
FT                   ALPALLAAGAIVAAATIKRRL"
FT   CDS_pept        complement(705650..705919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0735"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0735"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60807"
FT                   /db_xref="GOA:D1YWI5"
FT                   /db_xref="UniProtKB/TrEMBL:D1YWI5"
FT                   /protein_id="BAI60807.1"
FT                   /translation="MHGLIFYAVEFIAILTGVVLIHKFIYNRKREYDMGSLYLSVLAAT
FT                   YIFIVAVCMHEFGIETGFISGLIGGGVAVALLDSATGFLHNSGY"
FT   CDS_pept        complement(706540..708549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metG"
FT                   /locus_tag="MCP_0736"
FT                   /product="methionyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0736"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60808"
FT                   /db_xref="GOA:D1YWI6"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004495"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR023458"
FT                   /db_xref="InterPro:IPR029038"
FT                   /db_xref="InterPro:IPR033911"
FT                   /db_xref="InterPro:IPR041872"
FT                   /db_xref="UniProtKB/TrEMBL:D1YWI6"
FT                   /protein_id="BAI60808.1"
FT                   /translation="MTEFPSDRPVLVTCGLPYANGAAHIGHLRTYIPADMFVRTLRMMG
FT                   QNTTFVCGSDTHGTPIVVNAEEQGTTPGELVKKYHLVFEQTFKNFEIDFNHYGSTDDLE
FT                   NHERTRSIVRDLEKNGYVYPKEIKVAYCGHCQRGLPDRYVEGTCPYCGALARGDECDIG
FT                   CQKHLEPGDILDPRCRICGGKAETRVKEHFFFKLSEFGPFLTDYLNKLHATSNVNYAKE
FT                   WAKDLKDWCITRNLEWGVKYPGHEDLVVYVWVDAPIGYIAFTEEYMSSIGEDWKNIWKG
FT                   DSRIIHFIGGDIIYHHCIFWPAMLKGAGYTLPWGVVASGMIKVNDKKFSKSRGYIVWVE
FT                   DDYLAHGFHPDLLRYYILSYTSHTKDINFSWKEFQTKVNKELVGSFGNFVNRVLTFIES
FT                   KGLDVKGEIDPSVSEAIKTAMSVAKAEIENYEFKKICDSIITLADFGNTYFQGHEPWKL
FT                   IKEDKAACENVLYNCTQIVKALAILSWPSIPAKAEEIWGMLGYDKASLSKVPLEDALLP
FT                   YVSMDRPKPTILFSKLEDKKIAEMEKILNERVAAAEAKAAGFKEVPKVSIEEFQKIEIK
FT                   IGRVISSERIKGSKKLLKSMIDVGEARPRQIVSGIAEQYSPEEMVGKTVVVITNLKPVK
FT                   IMGVESNGMVMAADSNGATLLTPEKPSEPGTKVR"
FT   CDS_pept        complement(708658..710097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0737"
FT                   /product="putative sodium:amino acid symporter"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0737"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60809"
FT                   /db_xref="GOA:D1YWI7"
FT                   /db_xref="InterPro:IPR001463"
FT                   /db_xref="UniProtKB/TrEMBL:D1YWI7"
FT                   /protein_id="BAI60809.1"
FT                   /translation="MGLLEIFQSVISTVNGFVWGIPMLVLLVGTGLLLTIRLKGIQFRE
FT                   LPLAFSRVMHSIKTRKSGDQEGDIPAFHALCTALSATVGTGNIAGVATAIVMGGPGALF
FT                   WMWMTALVGMVTKYSEAVLSVKYRQKNPDGSMSGGPMYYIEKGLKMKWLAVLFALCGTV
FT                   AAFGIGSMTQANSVTLAITSQLDVGGSIVLPVFGEISVLSLVIGAILVAITALVTFGGI
FT                   KRIGEVASILVPFMAISYIIGGLLVLAINYARIPDALVMVFNYAFTPYAAVGGVAGYAV
FT                   AQAVRYGMARGVFSNEAGLGSAPIAYAAAKTNSPVNQGLIAITEVFLDTLVICSITGLV
FT                   VLTSGLWDDGVYNSTSLTIAAFTNSLGLPGLIMVVISAVLFGYSTILGWAYYGEQCFHY
FT                   LFGNRMKNLYKVLFLCAVLFGSVTKVSLVWDISDTFNGMMAIPNLVALVALSGVVVAET
FT                   KQYFDERKANRGQEGPAAVVQ"
FT   CDS_pept        complement(710180..711400)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0738"
FT                   /product="MFS transporter"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0738"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60810"
FT                   /db_xref="GOA:D1YWI8"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D1YWI8"
FT                   /protein_id="BAI60810.1"
FT                   /translation="MAESVFRRYDRQVWILVAGSLLNTFGTSIAYPFVSLYLYKYQGVS
FT                   MTDIGLALLAAAAAGGLVSVGAGELCDRFGRKIMLNIGLFFQMVSFALLGYAIMAGWGY
FT                   SEFMMLMVLKEISGGLYRNVPQVMVADTVEPGDRNGAFSLLRIGGNLGFALGPIFGGIL
FT                   ASYSYAAMFIITALTSGAYMLISLYLLHDTRPDERDIAAHPHHDPMWSNTPFIIFCAAS
FT                   AIGSLVYSNLFTTFGTFSGGFIDVSESMIGLIFSLNGFMVVVFQLPVAYYLERFRMTTS
FT                   LILGSLIYASGFALVGFCNSVWMLFMSMFIITVGELVVTPASQTLLSEMAPPEARGRYM
FT                   NVAGFIGSGGNACGPAVGGFLMDGFSKNIIMMWLILGALEVVCAGGYLALRLRLSSKMD
FT                   DLKAAGA"
FT   CDS_pept        711468..712556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0739"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains one Radical SAM domain (IPR007197)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0739"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60811"
FT                   /db_xref="GOA:D1YWI9"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017200"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="UniProtKB/TrEMBL:D1YWI9"
FT                   /protein_id="BAI60811.1"
FT                   /translation="MISGFDRLVLLGRLKVWQDRLEKERKEHRLRYLFWETTRACNLRC
FT                   RHCGSDCTVPKPGELSTGEIKAAFKSIASDYDARSIMVAVTGGEPLLRKDLFDVMGYAH
FT                   GLGFPWGMVTNGMLVDDEVIEKCGRAGMSTVTVSVDGLREAHEHIRRGGSFERTIEALK
FT                   LFKDSGRFSVVQATTCASQYNTGDLQGLYELFSRLGIDEWRLLTVTPIGRARDDPNFRL
FT                   QPGQLRSLLDFIVAKRREKGLRVTFEEEGFLGPAYEGKVRDSLFYCPAGINIASILACG
FT                   DIGACPNLPPEFIQGNVRKDRFKDVWENRYGNMRDLGWKRCGTCAGCAWWDLCRGNSLH
FT                   LWDLKNGRPIMCHLQALEEGGR"
FT   CDS_pept        712597..712836
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0740"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0740"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60812"
FT                   /db_xref="GOA:D1YWJ0"
FT                   /db_xref="UniProtKB/TrEMBL:D1YWJ0"
FT                   /protein_id="BAI60812.1"
FT                   /translation="MLFKGLQGLLTLPVVKYGPPPETPSVVPLYGVPVSVTPAPMPGGI
FT                   LSLSTETLLALIAAILLAMLGGYVLLRMLLAGKK"
FT   CDS_pept        712905..713249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0741"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0741"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60813"
FT                   /db_xref="GOA:D1YWJ1"
FT                   /db_xref="UniProtKB/TrEMBL:D1YWJ1"
FT                   /protein_id="BAI60813.1"
FT                   /translation="MSWVESISSYIGASLPPGRVQPMYGVPIVKYGPPPSPVPYEPGST
FT                   GLPVSGMPDFDWARIWQPPAFSMPDFGHLGLSFPKLIAGIALVAYVALMAMAVLGLALR
FT                   GGTWYLKNRK"
FT   CDS_pept        complement(713253..713882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0742"
FT                   /product="putative translin"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0742"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60814"
FT                   /db_xref="GOA:D1YWJ2"
FT                   /db_xref="InterPro:IPR002848"
FT                   /db_xref="InterPro:IPR036081"
FT                   /db_xref="UniProtKB/TrEMBL:D1YWJ2"
FT                   /protein_id="BAI60814.1"
FT                   /translation="MGSLKDISDSIRARFDAMDKAREGALAATRKITRNSGDAIKAIHR
FT                   GERAQAESLLADIRALNDGLHGSLEDFPEVYYSGYVEDAQVELAELSILYAVLQGLAMP
FT                   TPESLRIENTAYLKGLGDASGELRRHILDLIRKGRPEEGERYLDVMDEFYTEMMSFDYP
FT                   DAIMHGLRKKTDVARSLIERTRGDLTNALEIKGLHESMERFDKKLQ"
FT   CDS_pept        complement(713963..715585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0743"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0743"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60815"
FT                   /db_xref="UniProtKB/TrEMBL:D1YWJ3"
FT                   /protein_id="BAI60815.1"
FT                   /translation="MRLVQAVIALILSALFLGVLAGVAAANVPGVAINAPPPPPAPNVA
FT                   TAGSDAMIKVVLTHRDTGSPALHYVDRVMLYDGNKLIKEWKYDQNSYKTDEVWTESLTV
FT                   PAKSDMHLRAVAHCTVHGYDLAGMHVRVLPAGTTPAQMMQTDAAYAGMQAFGYSKADKA
FT                   SDFVASADTRLLQDNIKARSGDLKSFQAKMSDWMKSTEGKQFIAKFEKTGAPMSAGEMA
FT                   RQAPMATKAAKPTIKRKVGTGDLSDKSSNIPRATYSPTPFVSVKPSLKAKAKTSPATKY
FT                   LAVKASVKPTMKPTTKYMTAKATVKPTKTATKYLAVKASPKPTMKPATKYLAAKAKAKP
FT                   SASMMPAKTKKTLSQYGTMALKVSPTAKPAKKPATKYLVAKATARPTKKPGMKYMLAAP
FT                   QGVKTPAESYGIYGLGGNVPSPPKATATVRPVPSGSPTPVPGFYTPRYPGEAGAGKNVT
FT                   VPPTPTPTARPAAGVAASSVSIPYTGTTGRGTIGQCGCVALASDNRYAGRGPGLVGTTI
FT                   VNPPSSAPGPNSRPTAFVIVRRR"
FT   CDS_pept        complement(715718..716623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0744"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains one Radical SAM domain (IPR007197)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0744"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60816"
FT                   /db_xref="GOA:D1YWJ4"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR013917"
FT                   /db_xref="InterPro:IPR023993"
FT                   /db_xref="InterPro:IPR034556"
FT                   /db_xref="UniProtKB/TrEMBL:D1YWJ4"
FT                   /protein_id="BAI60816.1"
FT                   /translation="MSLVELLKKQGYHIIGEHSAIKPCLWLGRSLKSQGACYKSHFYGI
FT                   QSHLCMQMTPCIACNQRCLHCWRPVEEPYAVRSWDRPETIIEGCLKEQKRFISGYGGIP
FT                   ETDKKKWKDAFEPRHAAISLVGEPTLYPHLKELVALLGERGMSTFIVTNGTRPDVLEKV
FT                   TPSQLYMSLDAPDRETYLKACNPVADLWDKVNDSLEVLGQRDSRRALRLTLVKGVNMKD
FT                   PEGYAALIKKAAPDYVEVKAYMHLGYSRNRLPREAMPKHDEVLEFARKVADASGYRLAS
FT                   DVELSRVALVSKDGAVKALM"
FT   CDS_pept        complement(716648..718879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0745"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0745"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60817"
FT                   /db_xref="GOA:D1YWJ5"
FT                   /db_xref="InterPro:IPR018746"
FT                   /db_xref="UniProtKB/TrEMBL:D1YWJ5"
FT                   /protein_id="BAI60817.1"
FT                   /translation="MRKEYWLALALAGILAMLPLGPLQLILLLTVPGFALLVLFKERFD
FT                   VVELAAYSFTLSILAFPLAVLIAWFLGMWHAGAVLLGLAAVSVAAIKYRRGANIELVHS
FT                   KLQWPVLGIALLIFAIVLFISLKTFTLTDAGFVCGTTHASDLNFHLSIAQRYIESPHIP
FT                   VEDPYLPGHYIVYNWFMHLLMGELGVLTGIDLFTIFHVLVPLASALIFLGAYLLALFLF
FT                   NSERDALVSSVVFIAASGLSWVYIAYQLFVLNNPSPDIFKEMVYEWPGIIQMIPGIKFT
FT                   MMLKYDPTVLFFFLPQTQTFGLLATIFGFLLFLKAIKEKSPACAAVTGLVLASLVLFHM
FT                   ITAFPVFITLGLMFLYLLLRRRFDDALVAAIPLSVAFVASIYQLAIMQQGNASQIIIAH
FT                   HPDVIPTILFSIGLFIPFAIYGMYLKRDDEPSWLLGLFAIINIVLLNVVELPATVNTYR
FT                   FLVYAALPVSLFAGLVFSRWLVSRNTLKMAAAAVVILLMVPSTLIMVGFYNDSTYVHAS
FT                   TAEYEALQWIKENTPNNAVIYEEPGFFPRVPVVTGRDVAYSGEIYTLQYHNVDLQADAY
FT                   GILSITDPAALYDKLSEYNVKYVFVGHRESTHPFITALKDARYFLPVYDRDGVNIYEVT
FT                   GIAPQEETKDMDISPMNWIAFFAALLYLLILPGFNIVRTLGWESKLNPVELVVYVFGIS
FT                   VAVLVVVATLVALTFSIGLNFYTIIVPVTLIIILTNREVVSFIRRTLKV"
FT   CDS_pept        complement(718896..720068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0746"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0746"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60818"
FT                   /db_xref="GOA:D1YWJ6"
FT                   /db_xref="UniProtKB/TrEMBL:D1YWJ6"
FT                   /protein_id="BAI60818.1"
FT                   /translation="MSDNSVLKVVRQYWYMAALVLIVLIALWYRMGIIDSYIIPTYGNT
FT                   MYHVGIERETILTGYYPTEELSYGGGFPHFYVPAYRLLIVSMCVATGIDPMVMSGLMTI
FT                   VLGIMVMLVIYAVAYRLSHNLYIALFAAFFFIMSPDITIYTIRPLPEILGLFMVPFTLL
FT                   FVISEKWSLAAISAGITALTHQMTLLTLVSIIGVYMVFQLVRAVWAYFRKKEDRDAYMK
FT                   PFRTALWCLAPILTACLTYAVWMMYSMGSLDIMGIAQVANHEGNVVDIALFLRVGIFVL
FT                   LFTIIGLIFIIDELFGSKSAPAAGAKKSEYGYSVSKDSALLVVAWAVITLLLTFNDKIF
FT                   YLFPDHKFLIFPNFMDRYLTFFAQICIIIAAFGMYYLLRALDLDVLKEKP"
FT   CDS_pept        complement(720065..720625)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0747"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0747"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60819"
FT                   /db_xref="GOA:D1YWJ7"
FT                   /db_xref="UniProtKB/TrEMBL:D1YWJ7"
FT                   /protein_id="BAI60819.1"
FT                   /translation="MAGISDFVKYGLVILMFLLFIYTSYFMSGTYQVPMTENSYYMFPE
FT                   VKTNADAWYGRVVLQGELEAADWVNENLNMSDKFVADIFGAELIMGMTCRVSTVGGDWA
FT                   NAANPVKYMSDTNQIYTTSSAWEAYDLARENNCTYVWLPNRNTFSGYDWVYGDHKKFED
FT                   PAYFKLVYENDDVKIYRILEAAA"
FT