(data stored in ACNUC7421 zone)

EMBL: AP012052

ID   AP012052; SV 1; circular; genomic DNA; STD; PRO; 3982034 BP.
XX
AC   AP012052;
XX
PR   Project:PRJDA62249;
XX
DT   09-FEB-2011 (Rel. 107, Created)
DT   07-OCT-2016 (Rel. 130, Last updated, Version 5)
XX
DE   Microbacterium testaceum StLB037 DNA, complete genome.
XX
KW   .
XX
OS   Microbacterium testaceum StLB037
OC   Bacteria; Actinobacteria; Micrococcales; Microbacteriaceae; Microbacterium.
XX
RN   [1]
RP   1-3982034
RA   Morohoshi T., Wang W.Z., Someya N., Ikeda T.;
RT   ;
RL   Submitted (08-FEB-2011) to the INSDC.
RL   Contact:Tomohiro Morohoshi Utsunomiya University, Department of Material
RL   and Environmental Chemistry; Yoto 7-1-2, Utsunomiya, Tochigi 321-8585,
RL   Japan
XX
RN   [2]
RX   DOI; 10.1128/JB.00180-11.
RX   PUBMED; 21357489.
RA   Morohoshi T., Wang W.-Z., Someya N., Ikeda T.;
RT   "Genome sequence of Microbacterium testaceum StLB037, an N-acylhomoserine
RT   lactone-degrading bacterium isolated from potato leaves";
RL   J. Bacteriol. 193(8):2072-2073(2011).
XX
DR   MD5; a92259d04bd1cb785fe6e1ed96d0ab88.
DR   BioSample; SAMD00060982.
DR   EnsemblGenomes-Gn; EBG00001095232.
DR   EnsemblGenomes-Gn; EBG00001095233.
DR   EnsemblGenomes-Gn; EBG00001095234.
DR   EnsemblGenomes-Gn; EBG00001095235.
DR   EnsemblGenomes-Gn; EBG00001095236.
DR   EnsemblGenomes-Gn; EBG00001095237.
DR   EnsemblGenomes-Gn; EBG00001095238.
DR   EnsemblGenomes-Gn; EBG00001095239.
DR   EnsemblGenomes-Gn; EBG00001095240.
DR   EnsemblGenomes-Gn; EBG00001095241.
DR   EnsemblGenomes-Gn; EBG00001095242.
DR   EnsemblGenomes-Gn; EBG00001095243.
DR   EnsemblGenomes-Gn; EBG00001095244.
DR   EnsemblGenomes-Gn; EBG00001095245.
DR   EnsemblGenomes-Gn; EBG00001095246.
DR   EnsemblGenomes-Gn; EBG00001095247.
DR   EnsemblGenomes-Gn; EBG00001095248.
DR   EnsemblGenomes-Gn; EBG00001095249.
DR   EnsemblGenomes-Gn; EBG00001095250.
DR   EnsemblGenomes-Gn; EBG00001095251.
DR   EnsemblGenomes-Gn; EBG00001095252.
DR   EnsemblGenomes-Gn; EBG00001095253.
DR   EnsemblGenomes-Gn; EBG00001095254.
DR   EnsemblGenomes-Gn; EBG00001095255.
DR   EnsemblGenomes-Gn; EBG00001095256.
DR   EnsemblGenomes-Gn; EBG00001095257.
DR   EnsemblGenomes-Gn; EBG00001095258.
DR   EnsemblGenomes-Gn; EBG00001095259.
DR   EnsemblGenomes-Gn; EBG00001095260.
DR   EnsemblGenomes-Gn; EBG00001095261.
DR   EnsemblGenomes-Gn; EBG00001095262.
DR   EnsemblGenomes-Gn; EBG00001095263.
DR   EnsemblGenomes-Gn; EBG00001095264.
DR   EnsemblGenomes-Gn; EBG00001095265.
DR   EnsemblGenomes-Gn; EBG00001095266.
DR   EnsemblGenomes-Gn; EBG00001095267.
DR   EnsemblGenomes-Gn; EBG00001095268.
DR   EnsemblGenomes-Gn; EBG00001095269.
DR   EnsemblGenomes-Gn; EBG00001095270.
DR   EnsemblGenomes-Gn; EBG00001095271.
DR   EnsemblGenomes-Gn; EBG00001095272.
DR   EnsemblGenomes-Gn; EBG00001095273.
DR   EnsemblGenomes-Gn; EBG00001095274.
DR   EnsemblGenomes-Gn; EBG00001095275.
DR   EnsemblGenomes-Gn; EBG00001095276.
DR   EnsemblGenomes-Gn; EBG00001095277.
DR   EnsemblGenomes-Gn; EBG00001095278.
DR   EnsemblGenomes-Gn; EBG00001095279.
DR   EnsemblGenomes-Gn; EBG00001095280.
DR   EnsemblGenomes-Gn; EBG00001095281.
DR   EnsemblGenomes-Gn; EBG00001095282.
DR   EnsemblGenomes-Gn; EBG00001095283.
DR   EnsemblGenomes-Gn; EBG00001095284.
DR   EnsemblGenomes-Gn; EBG00001095285.
DR   EnsemblGenomes-Gn; EBG00001095286.
DR   EnsemblGenomes-Gn; EBG00001095287.
DR   EnsemblGenomes-Gn; EBG00001095288.
DR   EnsemblGenomes-Gn; EBG00001095289.
DR   EnsemblGenomes-Gn; MTES_r001.
DR   EnsemblGenomes-Gn; MTES_r002.
DR   EnsemblGenomes-Gn; MTES_r003.
DR   EnsemblGenomes-Gn; MTES_r004.
DR   EnsemblGenomes-Gn; MTES_r005.
DR   EnsemblGenomes-Gn; MTES_r006.
DR   EnsemblGenomes-Gn; MTES_t001.
DR   EnsemblGenomes-Gn; MTES_t002.
DR   EnsemblGenomes-Gn; MTES_t003.
DR   EnsemblGenomes-Gn; MTES_t004.
DR   EnsemblGenomes-Gn; MTES_t005.
DR   EnsemblGenomes-Gn; MTES_t006.
DR   EnsemblGenomes-Gn; MTES_t007.
DR   EnsemblGenomes-Gn; MTES_t008.
DR   EnsemblGenomes-Gn; MTES_t009.
DR   EnsemblGenomes-Gn; MTES_t010.
DR   EnsemblGenomes-Gn; MTES_t011.
DR   EnsemblGenomes-Gn; MTES_t012.
DR   EnsemblGenomes-Gn; MTES_t013.
DR   EnsemblGenomes-Gn; MTES_t014.
DR   EnsemblGenomes-Gn; MTES_t015.
DR   EnsemblGenomes-Gn; MTES_t016.
DR   EnsemblGenomes-Gn; MTES_t017.
DR   EnsemblGenomes-Gn; MTES_t018.
DR   EnsemblGenomes-Gn; MTES_t019.
DR   EnsemblGenomes-Gn; MTES_t020.
DR   EnsemblGenomes-Gn; MTES_t021.
DR   EnsemblGenomes-Gn; MTES_t022.
DR   EnsemblGenomes-Gn; MTES_t023.
DR   EnsemblGenomes-Gn; MTES_t024.
DR   EnsemblGenomes-Gn; MTES_t025.
DR   EnsemblGenomes-Gn; MTES_t026.
DR   EnsemblGenomes-Gn; MTES_t027.
DR   EnsemblGenomes-Gn; MTES_t028.
DR   EnsemblGenomes-Gn; MTES_t029.
DR   EnsemblGenomes-Gn; MTES_t030.
DR   EnsemblGenomes-Gn; MTES_t031.
DR   EnsemblGenomes-Gn; MTES_t032.
DR   EnsemblGenomes-Gn; MTES_t033.
DR   EnsemblGenomes-Gn; MTES_t034.
DR   EnsemblGenomes-Gn; MTES_t035.
DR   EnsemblGenomes-Gn; MTES_t036.
DR   EnsemblGenomes-Gn; MTES_t037.
DR   EnsemblGenomes-Gn; MTES_t038.
DR   EnsemblGenomes-Gn; MTES_t039.
DR   EnsemblGenomes-Gn; MTES_t040.
DR   EnsemblGenomes-Gn; MTES_t041.
DR   EnsemblGenomes-Gn; MTES_t042.
DR   EnsemblGenomes-Gn; MTES_t043.
DR   EnsemblGenomes-Gn; MTES_t044.
DR   EnsemblGenomes-Gn; MTES_t045.
DR   EnsemblGenomes-Tr; EBT00001549483.
DR   EnsemblGenomes-Tr; EBT00001549486.
DR   EnsemblGenomes-Tr; EBT00001549488.
DR   EnsemblGenomes-Tr; EBT00001549490.
DR   EnsemblGenomes-Tr; EBT00001549492.
DR   EnsemblGenomes-Tr; EBT00001549494.
DR   EnsemblGenomes-Tr; EBT00001549496.
DR   EnsemblGenomes-Tr; EBT00001549498.
DR   EnsemblGenomes-Tr; EBT00001549501.
DR   EnsemblGenomes-Tr; EBT00001549503.
DR   EnsemblGenomes-Tr; EBT00001549505.
DR   EnsemblGenomes-Tr; EBT00001549508.
DR   EnsemblGenomes-Tr; EBT00001549509.
DR   EnsemblGenomes-Tr; EBT00001549511.
DR   EnsemblGenomes-Tr; EBT00001549514.
DR   EnsemblGenomes-Tr; EBT00001549516.
DR   EnsemblGenomes-Tr; EBT00001549518.
DR   EnsemblGenomes-Tr; EBT00001549520.
DR   EnsemblGenomes-Tr; EBT00001549523.
DR   EnsemblGenomes-Tr; EBT00001549525.
DR   EnsemblGenomes-Tr; EBT00001549528.
DR   EnsemblGenomes-Tr; EBT00001549530.
DR   EnsemblGenomes-Tr; EBT00001549532.
DR   EnsemblGenomes-Tr; EBT00001549534.
DR   EnsemblGenomes-Tr; EBT00001549537.
DR   EnsemblGenomes-Tr; EBT00001549539.
DR   EnsemblGenomes-Tr; EBT00001549542.
DR   EnsemblGenomes-Tr; EBT00001549544.
DR   EnsemblGenomes-Tr; EBT00001549546.
DR   EnsemblGenomes-Tr; EBT00001549548.
DR   EnsemblGenomes-Tr; EBT00001549551.
DR   EnsemblGenomes-Tr; EBT00001549553.
DR   EnsemblGenomes-Tr; EBT00001549556.
DR   EnsemblGenomes-Tr; EBT00001549558.
DR   EnsemblGenomes-Tr; EBT00001549560.
DR   EnsemblGenomes-Tr; EBT00001549563.
DR   EnsemblGenomes-Tr; EBT00001549566.
DR   EnsemblGenomes-Tr; EBT00001549568.
DR   EnsemblGenomes-Tr; EBT00001549570.
DR   EnsemblGenomes-Tr; EBT00001549572.
DR   EnsemblGenomes-Tr; EBT00001549574.
DR   EnsemblGenomes-Tr; EBT00001549576.
DR   EnsemblGenomes-Tr; EBT00001549578.
DR   EnsemblGenomes-Tr; EBT00001549581.
DR   EnsemblGenomes-Tr; EBT00001549583.
DR   EnsemblGenomes-Tr; EBT00001549585.
DR   EnsemblGenomes-Tr; EBT00001549587.
DR   EnsemblGenomes-Tr; EBT00001549589.
DR   EnsemblGenomes-Tr; EBT00001549591.
DR   EnsemblGenomes-Tr; EBT00001549593.
DR   EnsemblGenomes-Tr; EBT00001549595.
DR   EnsemblGenomes-Tr; EBT00001549596.
DR   EnsemblGenomes-Tr; EBT00001549599.
DR   EnsemblGenomes-Tr; EBT00001549601.
DR   EnsemblGenomes-Tr; EBT00001549603.
DR   EnsemblGenomes-Tr; EBT00001549605.
DR   EnsemblGenomes-Tr; EBT00001549607.
DR   EnsemblGenomes-Tr; EBT00001549609.
DR   EnsemblGenomes-Tr; MTES_r001-1.
DR   EnsemblGenomes-Tr; MTES_r002-1.
DR   EnsemblGenomes-Tr; MTES_r003-1.
DR   EnsemblGenomes-Tr; MTES_r004-1.
DR   EnsemblGenomes-Tr; MTES_r005-1.
DR   EnsemblGenomes-Tr; MTES_r006-1.
DR   EnsemblGenomes-Tr; MTES_t001-1.
DR   EnsemblGenomes-Tr; MTES_t002-1.
DR   EnsemblGenomes-Tr; MTES_t003-1.
DR   EnsemblGenomes-Tr; MTES_t004-1.
DR   EnsemblGenomes-Tr; MTES_t005-1.
DR   EnsemblGenomes-Tr; MTES_t006-1.
DR   EnsemblGenomes-Tr; MTES_t007-1.
DR   EnsemblGenomes-Tr; MTES_t008-1.
DR   EnsemblGenomes-Tr; MTES_t009-1.
DR   EnsemblGenomes-Tr; MTES_t010-1.
DR   EnsemblGenomes-Tr; MTES_t011-1.
DR   EnsemblGenomes-Tr; MTES_t012-1.
DR   EnsemblGenomes-Tr; MTES_t013-1.
DR   EnsemblGenomes-Tr; MTES_t014-1.
DR   EnsemblGenomes-Tr; MTES_t015-1.
DR   EnsemblGenomes-Tr; MTES_t016-1.
DR   EnsemblGenomes-Tr; MTES_t017-1.
DR   EnsemblGenomes-Tr; MTES_t018-1.
DR   EnsemblGenomes-Tr; MTES_t019-1.
DR   EnsemblGenomes-Tr; MTES_t020-1.
DR   EnsemblGenomes-Tr; MTES_t021-1.
DR   EnsemblGenomes-Tr; MTES_t022-1.
DR   EnsemblGenomes-Tr; MTES_t023-1.
DR   EnsemblGenomes-Tr; MTES_t024-1.
DR   EnsemblGenomes-Tr; MTES_t025-1.
DR   EnsemblGenomes-Tr; MTES_t026-1.
DR   EnsemblGenomes-Tr; MTES_t027-1.
DR   EnsemblGenomes-Tr; MTES_t028-1.
DR   EnsemblGenomes-Tr; MTES_t029-1.
DR   EnsemblGenomes-Tr; MTES_t030-1.
DR   EnsemblGenomes-Tr; MTES_t031-1.
DR   EnsemblGenomes-Tr; MTES_t032-1.
DR   EnsemblGenomes-Tr; MTES_t033-1.
DR   EnsemblGenomes-Tr; MTES_t034-1.
DR   EnsemblGenomes-Tr; MTES_t035-1.
DR   EnsemblGenomes-Tr; MTES_t036-1.
DR   EnsemblGenomes-Tr; MTES_t037-1.
DR   EnsemblGenomes-Tr; MTES_t038-1.
DR   EnsemblGenomes-Tr; MTES_t039-1.
DR   EnsemblGenomes-Tr; MTES_t040-1.
DR   EnsemblGenomes-Tr; MTES_t041-1.
DR   EnsemblGenomes-Tr; MTES_t042-1.
DR   EnsemblGenomes-Tr; MTES_t043-1.
DR   EnsemblGenomes-Tr; MTES_t044-1.
DR   EnsemblGenomes-Tr; MTES_t045-1.
DR   EuropePMC; PMC3133038; 21357489.
DR   EuropePMC; PMC3156400.
DR   EuropePMC; PMC4832456; 27087892.
DR   EuropePMC; PMC5353710; 28295028.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01746; mraW.
DR   RFAM; RF01747; msiK.
DR   RFAM; RF01750; pfl.
DR   RFAM; RF01763; ykkC-III.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; AP012052.
DR   SILVA-SSU; AP012052.
XX
CC   ##Genome-Assembly-Data-START##
CC   Finishing Goal           :: Finished
CC   Current Finishing Status :: Finished
CC   Assembly Method          :: Celera Assembler v. 5.3
CC   Genome Coverage          :: 42x
CC   Sequencing Technology    :: Roche 454
CC   ##Genome-Assembly-Data-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3982034
FT                   /organism="Microbacterium testaceum StLB037"
FT                   /strain="StLB037"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:979556"
FT   CDS_pept        complement(6..1145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0001"
FT                   /product="permease of the major facilitator superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0001"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ72965"
FT                   /db_xref="GOA:E8NGY2"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E8NGY2"
FT                   /protein_id="BAJ72965.1"
FT                   /translation="MATFAQLYATQAVLPAIAADIDSGPAGAALTVSASTLGLAVAVIP
FT                   WSLVADRIGRVPVMALGLVAATLLGACTPFADDIVMLLGLRLLEGAALGAVPAVALAYL
FT                   SEEIAPRHVAAAAGSYIAGTTVGGLSGRVIAGWVGEVAGWRWGVASVVLLCVVAAVLFV
FT                   ALVPSARGFVPGRARKERGLSVRRRILANLRSRVQLALYAQGFLLIGAFVAVYNYLGFH
FT                   LAGAPFFLPPAVVTLLFLAYLAGTVSSPRAGMLAVRHGRLPVLVGSIAVMAGGIVLMSV
FT                   PALPVVVVGLLAFTAGFFGAHAVASGWTPVAAASDARAQASSLYYLAYYAGSSLFGWLL
FT                   GWVFGGAGWSVFLAAVLVMCALALAVAIVTLRAPKASGP"
FT   regulatory      complement(1157..1162)
FT                   /locus_tag="MTES_0001"
FT                   /regulatory_class="ribosome_binding_site"
FT   rRNA            complement(1321..1436)
FT                   /locus_tag="MTES_r001"
FT                   /product="5S rRNA"
FT   rRNA            complement(1541..4648)
FT                   /locus_tag="MTES_r002"
FT                   /product="23S rRNA"
FT   rRNA            complement(5062..6584)
FT                   /locus_tag="MTES_r003"
FT                   /product="16S rRNA"
FT   CDS_pept        complement(7152..7355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0002"
FT                   /product="uncharacterized membrane protein, putative
FT                   virulence factor"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0002"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ72966"
FT                   /db_xref="GOA:E8N7D3"
FT                   /db_xref="UniProtKB/TrEMBL:E8N7D3"
FT                   /protein_id="BAJ72966.1"
FT                   /translation="MHEGVGEARHMANRIPLLMTVAGVAVLFLSIAFVFALVIGALFFG
FT                   GIEFTGGHTDAAAALASIPSEV"
FT   regulatory      complement(7364..7369)
FT                   /locus_tag="MTES_0002"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(7427..8881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsA"
FT                   /locus_tag="MTES_0003"
FT                   /product="30S ribosomal protein S1"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0003"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ72967"
FT                   /db_xref="GOA:E8N7D4"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:E8N7D4"
FT                   /protein_id="BAJ72967.1"
FT                   /translation="MTTATTAPAIKQVAINDIGSAEDFLAAVEKTLKFFNDGDLIEGTV
FT                   VKIDRDEVLLDVGYKTEGVIPSRELSIKHDVDPNEVVNVGDHVEALVLQKEDKEGRLIL
FT                   SKKRAQYERAWGDVEKIKENDGVVTGSVIEVVKGGLIVDIGLRGFLPASLIELRRVRDL
FT                   TPYLGQEIEAKILELDKNRNNVVLSRRALLEQTQSESRTTFLNNLHKGQVRKGTVSSIV
FT                   NFGAFVDLGGVDGLVHVSELSWKHIEHASEVVEVGQEVTVEILEVDLDRERVSLSLKAT
FT                   QEDPWQVFARTHAIGQIAPGKVTKLVPFGAFVRVADGIEGLVHISELSGKHVELAEQVV
FT                   SVGEEVFVKIIDIDLERRRISLSLKQANESVDPNGTEFDPALYGMATEYDERGEYKYPE
FT                   GFDPESGAWLEGFDTQREAWEQEYAAAQGRWEAHKAAVTKALEAEAANPADTGSFGGSF
FT                   SSESPAQGTLADDESLAALREKLSGR"
FT   regulatory      complement(8892..8897)
FT                   /gene="rpsA"
FT                   /locus_tag="MTES_0003"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      9266..9271
FT                   /locus_tag="MTES_0004"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        9282..10268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0004"
FT                   /product="16S rRNA uridine-516 pseudouridylate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0004"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ72968"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:E8N7D5"
FT                   /protein_id="BAJ72968.1"
FT                   /translation="MSSDSTPPYNRRSRRLAARRSTRRPAITAGAVALGLAATVALTGT
FT                   APVAQAAPASSLLSASSFQLASYTAPVTPATTSAPTVADARAAEQAAAASLQSAAAVQN
FT                   DISASGLDIGQPATVDTSALQQATDRLDAAQVLPPAFLPGVTGEVTAAASAVDQRVSAL
FT                   RGSLDAAVAKKQEEEAAEKARQEAEAAAAAKAKEEAEARSSAPSDDSSGGWTPPPSSGG
FT                   GSGDNSPGGAQSTARGMLAGYGWGDDQFSCLVSLWNRESGWNYQAYNAGSGAYGIPQAL
FT                   PGSKMSSAGADWQTNAGTQIAWGLGYISGRYGSPCGAWDHSQSTGWY"
FT   CDS_pept        complement(10271..13162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0005"
FT                   /product="DNA or RNA helicase of superfamily II"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0005"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ72969"
FT                   /db_xref="GOA:E8N7D6"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E8N7D6"
FT                   /protein_id="BAJ72969.1"
FT                   /translation="MPPEPARPLAGWSFDGTLRAYQAAALRRVDVDAGEPLHLVAPPGS
FT                   GKTLLGLLLAARRGRRTVVFAPTIAIREQWVGAARALAHDDTAVSEDPAAPADLTALTY
FT                   QSISVLDSASPFAALARERWRDELKDDDRTPEAATVWLDALSESNPSAYRRGIQSRARA
FT                   IRRSLARQDATVLAAALHPNARELIDRLVARGVETIVLDECHHLLDHWALVVAALLARI
FT                   RADGRDPLVIGLTATLPTPDDADEYDNYISLLGEVDLEVPVPAVVREGDLAPYRELVHV
FT                   VEPTAEERLFLSAHAQALEVALRTSFAVGSGRASLLGILKPVGTADADADDIDHLLAAA
FT                   FAADFAGAEAAGAMLSLVAPDDPVVAHLPAFARRPPTTDETLRLLGRFALDHVLPDPSR
FT                   AEEWTRLRTLLADFGYALTDRGVRRTRDPIDSVLTSSLAKDQGACDILAAEAAALGERL
FT                   CALVVTDFARHGNVHGGLLGAAGAVRTFSVLTTDAATADLRAMLVTSSTVRLARRDAAE
FT                   LLAALVAELGVEVTAAPVDDDPHVVEVRGIAGAGIVGAAARLLSAGRLQVVVGTRGLFG
FT                   EGWDCPRVNTLVDLTAAAGDAAMQQLRGRTLRLDPAWPEKTAHNWTVTALVPTDLAVEA
FT                   QPDATRLRRKHARLWGVDVDDPRRVVRGIGAALGHAQRRALTGVLSKAPGAASAGVGAL
FT                   DAIPSRATTRELWRIGEPYEDVEEESFVVEHRPHVPLFPTSVSATRETATAFVGTLGAS
FT                   GAAIAGAFALVPDVAPPFAGAALLGGALTAVPLGIAWRQGRRRVRDARATLHRIVEVLW
FT                   AALADAGRVRAAAGAPSVIPADALTAVHRLEVVLRGAEPDDRAAFGQALIELCAPVRAP
FT                   RFVLEVDRGGRSAVVGAVLRLAGSRRPRRFLAVPADVGRRREVAHRFAQEWQRRIGPVT
FT                   LHEVGLSEGDAVISEARRSGAFSGAARSLVWWR"
FT   regulatory      complement(13170..13175)
FT                   /locus_tag="MTES_0005"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(13195..14889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0006"
FT                   /product="predicted unusual protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0006"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ72970"
FT                   /db_xref="GOA:E8N7D7"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:E8N7D7"
FT                   /protein_id="BAJ72970.1"
FT                   /translation="MTDDALMRARYRRITRFAARYLVQAWWYELFLPRFGLGWISARGR
FT                   TRRLLRLAQRFHVLAVDLGGLMIKVGQFMSSRLDVLPPIITKELEGLQDEVPAVPFARM
FT                   RERIEDELGMPLTRAFAFVDERPLAAASLGQAHRAALTDALAEESGLREVVVKIQRPGI
FT                   DRIVDVDLRALRKVGRWLSKVSLVSDRVDMPALVEEFAVTSLEEIDYLHEAANSERFAA
FT                   DFGDDARVAVPAVAWERTTRRVLTLEDVSAIKITDVDALRAAGIDPSEVAARFAAVMFD
FT                   QLFEDGFFHADPHPGNVFVTPLPTPDADTPAWRFTFIDFGMMGEVPPGLRRGLRRVLIA
FT                   AASRDGKGLVDGIRDIGVLLPTADTVQLERAMTQLFSRFGGMGFAELQEVDPREFRAFA
FT                   VEFGDVVRTLPFQLPENFLLIVRAMSLTSGMCSALDPSFNIWDAVEPYAQRLIREESGN
FT                   TAQALVREVGAVAAVTARLPRRVDNLISRFEEGAVSVQTPRIERRLRDLERMIRRVVSA
FT                   VLFTGLLLGGILLQPEEGFWGTILLIASVAPLSHALLAGIIARRNGA"
FT   regulatory      complement(14894..14899)
FT                   /locus_tag="MTES_0006"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(14942..15520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0007"
FT                   /product="predicted transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0007"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ72971"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E8N7D8"
FT                   /protein_id="BAJ72971.1"
FT                   /translation="MSGSFLGDAFGGRGGNNTPGWPMSNILEAVEQLRTQFEQKASSAP
FT                   RMNKGDVRSAVLSLLLEQPMHGYQIIREIEERSGGSWKPSPGSVYPTLQLLTDEGLVQS
FT                   EESNGRKTYSLTAEGREAAGEETTERTAPWESAGSRDGGRMTALPKAGVELAQAAAQVA
FT                   RTGDKEQVAQAVEILDDARRKLYAILAQG"
FT   regulatory      complement(15527..15532)
FT                   /locus_tag="MTES_0007"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(15612..16541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0008"
FT                   /product="outer membrane phospholipase A"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0008"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ72972"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:E8N7D9"
FT                   /protein_id="BAJ72972.1"
FT                   /translation="MLRSDLKLLPVHRARRTLTTAMTCAGLALGMVATTGLAVAAPLSM
FT                   PDASASAFSAPAATTAPAAMSVATLGSTPTLQAVTQTADSATTDAQSALAGASAVQADI
FT                   ATAGLPLAVGDTSIDTAALSDAVERLSASDLLPTVLLPALSQNAEVETQRVNDRVATLR
FT                   SSLNDAVAAKAAADAAAEAQRQAEAAAAAEAQREAEAAAALARVNTPDGAKAFAAQLAA
FT                   DQYGWGDDQFSCLSSLWTKESGWNYQAYNPSGATGIPQSLPGDKMASFGSDWATNAATQ
FT                   IKWGLDYISRGYGTPCAAWGHSQATNWY"
FT   regulatory      complement(16548..16553)
FT                   /locus_tag="MTES_0008"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(16894..18609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgi"
FT                   /locus_tag="MTES_0009"
FT                   /product="glucose-6-phosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0009"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ72973"
FT                   /db_xref="GOA:E8N7E0"
FT                   /db_xref="InterPro:IPR001672"
FT                   /db_xref="InterPro:IPR018189"
FT                   /db_xref="InterPro:IPR023096"
FT                   /db_xref="InterPro:IPR035476"
FT                   /db_xref="InterPro:IPR035482"
FT                   /db_xref="UniProtKB/TrEMBL:E8N7E0"
FT                   /protein_id="BAJ72973.1"
FT                   /translation="MCATVGIASVDTVTAPIDPTTTAAWSRLSALRDSFDPDLRGWFAA
FT                   DADRVRDLTRTVGDLHVDLSKNLVTPEVLEALVALAGETGVRERFADMLRGAHLNTSED
FT                   RAVLHTALRRPAGVEPALVVDGQRVDHDVHEVLDRLSAFADRVRSGEWRGVTGKKVTTV
FT                   VNIGIGGSDLGPVMVYEALLPYADAGIHARFVSNIDPTDIAQKTADLDPETTLFIVASK
FT                   TFTTLETLTNARLARDWLWEKLGSAGVIDDTDAARTDAVAHHFVAVSTALDKVEAFGID
FT                   PTNAFGFWDWVGGRYSVDSAIGLSLAITLGPDAFRELLAGFHTVDEHVASTPIEQNVPV
FT                   LMGLLNVWYTNFLGAQSHAVLPYAQQLHRFAAYLQQLTMESNGKSVRWDGTPVTTDTGE
FT                   VFWGEPGTNGQHAFYQLIHQGTRLIPADFIAFVNPAYPLADDGRDVHGLFLANFLAQTK
FT                   ALAFGKTAEEVEAEGTTGALVAARTFPGNRPTTSIFAPSLTPAVLGQLIALYEHITFTQ
FT                   GTIWGINSFDQWGVELGKQLALQIAPAIEGDDEALAAQDASTAGLLAYYRDHRA"
FT   regulatory      complement(18619..18624)
FT                   /gene="pgi"
FT                   /locus_tag="MTES_0009"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(18637..19353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0010"
FT                   /product="NTP pyrophosphohydrolase including oxidative
FT                   damage repair enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0010"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ72974"
FT                   /db_xref="GOA:E8N7E1"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:E8N7E1"
FT                   /protein_id="BAJ72974.1"
FT                   /translation="MPSPRAQLENLVRRPHADDFAALHAVPVDGDARAAAILVLFGVLD
FT                   GIPSRREAAHVPSDLDVLLLARASTLRAHPGQVAFPGGRVDPGDADAVAAALREAREET
FT                   GLDPDGVDVLGTLPAVPLAFSRHEVTPVLGWWSRPTPVRAVDHAESAEVFRAPVADLLD
FT                   PDRRGSTVIRREGRVWRGPAFTLETAGGPQTVWGFTAMVLDGLFDRLGWTEPWDATREI
FT                   ALPEQGSTSPAHPVDL"
FT   regulatory      complement(19361..19366)
FT                   /locus_tag="MTES_0010"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(19383..19772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0011"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0011"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ72975"
FT                   /db_xref="InterPro:IPR011098"
FT                   /db_xref="UniProtKB/TrEMBL:E8N7E2"
FT                   /protein_id="BAJ72975.1"
FT                   /translation="MSVDDGNLPRGQSRVDVGGVDGEKVSVFRVTTVDGVETGRTLVSE
FT                   SVSREPVSEVTAVGTYDVPPPAAEPPVSEGCHPSYADACVPIDSDVDCAGGSGNGPSYF
FT                   DGVARVVGPDEYDLDRDGDGWACNG"
FT   regulatory      19780..19785
FT                   /locus_tag="MTES_0012"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(19785..19790)
FT                   /locus_tag="MTES_0011"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        19789..20472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0012"
FT                   /product="uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0012"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ72976"
FT                   /db_xref="UniProtKB/TrEMBL:E8N7E3"
FT                   /protein_id="BAJ72976.1"
FT                   /translation="MEETDTSDTRTTGVEDGAGVRVGSGFEDGVCFGEAFGVGEAGAVV
FT                   ERGGVPDGEGTVGDRLEPSTGWASGAGSANVAVAGGKVRAAAVRPPVARTTTAATEVAA
FT                   TAAAGDENRNQVRDLVARATTPVTRTTRAAAPRRGQSTRRTGKTITPATTQIHTGTRRF
FT                   RLAVGVSGELRCRPLSPIWSDQAVPFHQRQRRPSVGSGYHPGCGALIVSPPTDPRALAR
FT                   AVRAQ"
FT   CDS_pept        complement(20466..21023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0013"
FT                   /product="Sec-independent protein secretion pathway
FT                   components"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0013"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ72977"
FT                   /db_xref="UniProtKB/TrEMBL:E8N7E4"
FT                   /protein_id="BAJ72977.1"
FT                   /translation="MFGLTFEKLLLVGFLAAVILGPHRLPTVVARVAALVRSLRRTVDA
FT                   ARLRAADELGVPADAAQWRALDPRQYDPRRIIAEALAAPSVSAPPSSAPHESAPPPSDV
FT                   APAGSTLLAPTIEGETSEVGEARHPVPPPPETTPAPRRVRVGTSAHPRWIVLAEEGEPE
FT                   SSGENADGGLSRTGPERPVLLY"
FT   CDS_pept        complement(21011..21829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0014"
FT                   /product="Sec-independent protein secretion pathway
FT                   component TatC"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0014"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ72978"
FT                   /db_xref="GOA:E8N7E5"
FT                   /db_xref="InterPro:IPR002033"
FT                   /db_xref="UniProtKB/TrEMBL:E8N7E5"
FT                   /protein_id="BAJ72978.1"
FT                   /translation="MTTAVAPSAASSRSEAPRSAPMPVAAHLEEATRRAVWAAVAIALG
FT                   AIAGWFLYEPVMDLVRTPIAQIAAERNASLNFDSVTGAFDLHLRVALVAGFVLSSPVWL
FT                   YQLFAFVLPGLTRRERRYVLGSVGAAAPLFIAGCATGLLLFPHMVSVLAGFASAEDSTI
FT                   LDAGTYIDFVLKIVVATGIAFVVPVLLVVLNLAGVLPARTLARSWRYALVGIVVFSALA
FT                   TPSADVLSMFLVAVPMSGLFAAALAVAALHDRSVARRTTAPAGEEPPCSA"
FT   regulatory      complement(21028..21033)
FT                   /locus_tag="MTES_0013"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(21826..22074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0015"
FT                   /product="Sec-independent protein secretion pathway
FT                   components"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0015"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ72979"
FT                   /db_xref="GOA:E8N7E6"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/TrEMBL:E8N7E6"
FT                   /protein_id="BAJ72979.1"
FT                   /translation="MLQNLTGWHALIVLAVIVLIFGAAKLPALARSLGQSVRILKSEVG
FT                   DSRADAAEAPTDETSVHAHAERPAASATPVLSPPSTP"
FT   regulatory      complement(21833..21838)
FT                   /locus_tag="MTES_0014"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(22084..22089)
FT                   /locus_tag="MTES_0015"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(22099..23061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0016"
FT                   /product="protocatechuate 3,4-dioxygenase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0016"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ72980"
FT                   /db_xref="GOA:E8N7E7"
FT                   /db_xref="InterPro:IPR000627"
FT                   /db_xref="InterPro:IPR015889"
FT                   /db_xref="UniProtKB/TrEMBL:E8N7E7"
FT                   /protein_id="BAJ72980.1"
FT                   /translation="MSRIPDTQMTPEGPAYEGRLLDRADEPVVDQGAPFDIRTLVSRRG
FT                   ILGLVALGAGAVTLVACTPAATGTTTATTATPTATASATPTASATTSAAALPAGEIPDE
FT                   TAGPYPGDGSNGADVLEQSGIVRSDLRSSLDGGATAAGTPMTLNLTIFDTANGDTPMTG
FT                   AAVYVWHCDTEGNYSMYSSGIENETYLRGVQVVGDDGVVSFTSIFPGCYDGRWPHIHFE
FT                   VYPSVDAITDASNAIATSQVALPKETCDVVYADTSLYPSSASNLTRVSLDSDNVFGDDG
FT                   GALQLATTSGDNASGYTVSLGVRVDTATTPTAGAAPGGR"
FT   regulatory      complement(23066..23071)
FT                   /locus_tag="MTES_0016"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      23204..23209
FT                   /locus_tag="MTES_0017"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        23215..23526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0017"
FT                   /product="aspartyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0017"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ72981"
FT                   /db_xref="GOA:E8N7E8"
FT                   /db_xref="UniProtKB/TrEMBL:E8N7E8"
FT                   /protein_id="BAJ72981.1"
FT                   /translation="MSDTLHAVTLVVDMPITKLDALDVIAFAADGGVEDAGTSRPRVWL
FT                   APHAWAEVEIPKFADPPPFAIDVYSDVSREVAWAQARRLHDALERLGWEVEPPRAGAR"
FT   regulatory      23562..23567
FT                   /locus_tag="MTES_0018"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        23574..24185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0018"
FT                   /product="response regulator consisting of a CheY-like
FT                   receiver domain and a winged-helix DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0018"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ72982"
FT                   /db_xref="GOA:E8N7E9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:E8N7E9"
FT                   /protein_id="BAJ72982.1"
FT                   /translation="MTLEVLRETYEVVHETDGTTGRDQALRGRFDVILLDRRLPGRDGA
FT                   EIVRDLRAAHMTTPVLMLTALGAVSDRVEGLDAGANDYLLKPFDFDELLARLRALLRGF
FT                   RAEGRRRAVADWTYLPDTGVVYGPGGARVALTATENAVLDLLSRSPDHVFSREEIAGAV
FT                   FSSPEAVTTVDTYVHYVRRKTATDVIETVRSRGYRAGAEQ"
FT   regulatory      24170..24175
FT                   /locus_tag="MTES_0019"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        24182..25150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0019"
FT                   /product="signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0019"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ72983"
FT                   /db_xref="GOA:E8N7F0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E8N7F0"
FT                   /protein_id="BAJ72983.1"
FT                   /translation="MSVDDDRRIVHRSAVRVGTLVAGASAVAIAVGVGILVSVLLTQAR
FT                   TEGGGHRPSPGGVAGDRFVVDLDDVLPWVLALGVAGVVVLGVVAWAAARWSVRPLDEAL
FT                   RRQRAFVSDASHELRTPLTALTSRIQIVQRRQSRGEAIDEPLEQLRRDAQVMDDVLADM
FT                   LLTAEGSAHAGAARVDESVPAAVSTLASLATDAGVSLRVGELPDVTVAVPAVTVVRMCT
FT                   ALLDNAIGHTPAGSAVTISAVAESHDVVIRVADTGSGIRDDDLPRIFNRFARGAESGRR
FT                   RGFGLGLSLVREAATRYGGRVEVERTSAAGTVFALHLPRAR"
FT   CDS_pept        complement(25161..25952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0020"
FT                   /product="membrane-associated lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0020"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ72984"
FT                   /db_xref="GOA:E8N7F1"
FT                   /db_xref="InterPro:IPR003374"
FT                   /db_xref="InterPro:IPR024932"
FT                   /db_xref="InterPro:IPR042159"
FT                   /db_xref="UniProtKB/TrEMBL:E8N7F1"
FT                   /protein_id="BAJ72984.1"
FT                   /translation="MSAAFTVTAPVMGTVASITVLGAARRDGDVGAAVSACIQRLRDDE
FT                   RVFSTYRDDSDISRLRDEELELGAIDPRVAEVAERCRDLRERSGGRFDAHWRGWFDPTG
FT                   YVKGWSTDAAAQAFDALLENGGIEAVGVNVGGDMRLRTAATSSHVWRVGIAHPTHEGEL
FT                   LATVEVVDGAVATSGTAERGAHLIDPRTGVHLAGPVSATVIADDLTTADAWATVAAIAG
FT                   IDDLEWLPVAPVASGIVWEHGRSRRFAGGIEVSAFRDTVVG"
FT   CDS_pept        complement(25949..26470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0021"
FT                   /product="uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0021"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ72985"
FT                   /db_xref="GOA:E8N7F2"
FT                   /db_xref="InterPro:IPR007329"
FT                   /db_xref="UniProtKB/TrEMBL:E8N7F2"
FT                   /protein_id="BAJ72985.1"
FT                   /translation="MKKIVYALMATVTGLVLLFSYRTSTVPESTSALADAPSSGVATAP
FT                   KTTTTTPSPSASASSGSTTSGSSSSGSTMQTSSSGLTDGTYTGQAVNTRYGAVQVQITV
FT                   SQGVITDVQVPRYPSESGRDQQINSRALPVLVKETVQAQSAQVDMVSGATYTSTGYRTS
FT                   LQSALDQARG"
FT   regulatory      complement(25960..25965)
FT                   /locus_tag="MTES_0020"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(26476..26481)
FT                   /locus_tag="MTES_0021"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(26481..27911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0022"
FT                   /product="predicted ferric reductase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0022"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ72986"
FT                   /db_xref="GOA:E8N7F3"
FT                   /db_xref="InterPro:IPR013130"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:E8N7F3"
FT                   /protein_id="BAJ72986.1"
FT                   /translation="MTAAPALAAPPAAAVRGARRVPRRTPNSRAIWNLAAIVVIWATSL
FT                   VVVAVWVAGGEVQSLLAGGADSLNALGRAAGLASANLLFYQVLLMARVPLFERGFGRDG
FT                   ITRMHRIVGFWSFALFTAHITLQILGYAVQAGINPLEQAWQFVWDYPGMLLATAGTGLL
FT                   LLVVVTSVRKARTRLRYESWHLLHLYGYLGLGLAIPHMLWTGADFTVSPAATVYWWAMW
FT                   AVTAATVVVFRLGLPLARSLRHGIRVSAVERDGRSGVSVRMTGRRIDALKARGGQFFVW
FT                   RFLDGAGWTRGHPFSLSTDPAGGELVISARFVGDGTQRLAALRPGTRVLIEGPYGTMTA
FT                   DERRGGHLLMIGAGAGVAPLLAMLEGADWAPGEATLIVRDHTAGDALRAEAIDRLVRER
FT                   GLRHAPLPGPRAHTASSWLPSSHAQWAGADLIRYVSPRPADTDVFLCGPQPWMDAVRAD
FT                   LRRAGVLAERVHLEAFTV"
FT   regulatory      complement(27917..27922)
FT                   /locus_tag="MTES_0022"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(28065..28439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0023"
FT                   /product="lactoylglutathione lyase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0023"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ72987"
FT                   /db_xref="GOA:E8N7F4"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="InterPro:IPR041581"
FT                   /db_xref="UniProtKB/TrEMBL:E8N7F4"
FT                   /protein_id="BAJ72987.1"
FT                   /translation="MPFASLRIVTDDLDALVAFYERVTGQQAERPAAVFAQFSGPGAKL
FT                   AIASTATVAMLDGALVPAANRSVFIEFEVDDVDAAFAALPLEGEDIVLEPTTMPWGNRS
FT                   ALIRDPDGNVVNLFRTPGVR"
FT   regulatory      complement(28444..28449)
FT                   /locus_tag="MTES_0023"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(28533..29228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0024"
FT                   /product="predicted transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0024"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ72988"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR026881"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E8N7F5"
FT                   /protein_id="BAJ72988.1"
FT                   /translation="MNRTDRLYGLVEELRAASPRPRSARRLAERFEVSVRTIERDLSAL
FT                   QESGVPIWAEPGRTGGYVIDASATLGPAGFTLDEALAVLIGLGTLGRSPFRQSARTAAR
FT                   KILAVMPDGDAARARASASRVHFLESEDEVVVPPEFAAALRADRVVRLRYQDANGAESF
FT                   RDVEPLGSIRKERQWYLIAWCRLRDGVRAFRGDRMLSIEVTEERPAQRAVRAADLGILY
FT                   GRLRSVVED"
FT   regulatory      complement(29234..29239)
FT                   /locus_tag="MTES_0024"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(29276..30103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0025"
FT                   /product="dehydrogenase with different specificities"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0025"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ72989"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E8N7F6"
FT                   /protein_id="BAJ72989.1"
FT                   /translation="MTRTIVITGASDGIGAASAKQLVQVGEEVVVVGRNPEKTARVARS
FT                   LGVDSFVADFSDLAQVRELAASLLERYPRIDVLANNAGGVFGERTLTKDGYETTFQVNH
FT                   LAPFLLTNLLLERLLQSQASVIQTSSAAAKLFPRFDINDLQGERRYSSTAAYGNGKLAN
FT                   VLFTKELHRRFGEFGLSAAAFHPGVIASNFGASSGGPWKFLYGGPLAKSLMTSTAVGGA
FT                   RLTWLALGKPGIDWEPGGFYANNKPARTSRLADDPMIARQLWERSAVLVDLDD"
FT   regulatory      complement(30109..30114)
FT                   /locus_tag="MTES_0025"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      30278..30283
FT                   /locus_tag="MTES_0026"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        30292..30750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0026"
FT                   /product="conserved domain frequently associated with
FT                   peptide methionine sulfoxide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0026"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ72990"
FT                   /db_xref="GOA:E8N7F7"
FT                   /db_xref="InterPro:IPR002579"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="InterPro:IPR028427"
FT                   /db_xref="UniProtKB/TrEMBL:E8N7F7"
FT                   /protein_id="BAJ72990.1"
FT                   /translation="MSTEYRKTSEALSRLTDHQFAVTQDDATEPPFRNEYWDNHEDGIY
FT                   VDVVSGQPLFSSTDKFESGSGWPSFTKPIDDAAVVEKTDRSLWMTRTEVRSAGADSHLG
FT                   HLFDDGPHDAGGLRYCMNSAALRFVPVAELEEQGYGAYLSLFPESRAS"
FT   regulatory      30776..30781
FT                   /locus_tag="MTES_0027"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        30789..31343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0027"
FT                   /product="peptide methionine sulfoxide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0027"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ72991"
FT                   /db_xref="GOA:E8N7F8"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/TrEMBL:E8N7F8"
FT                   /protein_id="BAJ72991.1"
FT                   /translation="MTSGPTDTGEITRRPGTETAVLAGGCFWGVEDLIRRQPGVLDTRV
FT                   GYTGGQNDHATYRNHPGHAEAVEIVFDPMQTSYRDILAFFFQIHDPSTLNRQGNDVGTS
FT                   YRSAIFPLSPEQEKVARDTIADVDASGIWPAKAVTTIEPEAPFWEAEPEHQDYLVRIPN
FT                   GYTCHFVRPGWVLPKREEASA"
FT   CDS_pept        complement(31387..31785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0028"
FT                   /product="protein-tyrosine-phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0028"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ72992"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:E8N7F9"
FT                   /protein_id="BAJ72992.1"
FT                   /translation="MASVTILFVCVHNAGRSQMAAGYARALGGGRVTVLSGGSAPGSAL
FT                   NPVAVAAMAEEGIDITAEVPQLLLTDDVRASDAVITMGCGDACPIFPGKRYEDWELIDP
FT                   AGKGIEEVRAIRDDIKARVQRLLDDLLT"
FT   regulatory      complement(31788..31793)
FT                   /locus_tag="MTES_0028"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      31837..31842
FT                   /locus_tag="MTES_0029"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        31850..33085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0029"
FT                   /product="phytoene dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0029"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ72993"
FT                   /db_xref="GOA:E8N7G0"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E8N7G0"
FT                   /protein_id="BAJ72993.1"
FT                   /translation="MSEYDVIVVGAGLAGLRCATRLAEAGRDVVVLEAGDDVGGRERTD
FT                   IVDGFRLDRGFHVLNPAYPAVRRGVDIEALALRRFPVAVGVRLEDRLARLAHPARHPSS
FT                   LLETLRSGLVRPADLAALARWAGPTLVSARAAKTGIDRPLGEAWDRAGLRGPLRESVLE
FT                   PFLAGVLADDRQRTSDAFVRLLIRSFAFGRPGVPAAGIGALPAQLADTARRAGAGIRLG
FT                   HRVVSTRRRASGWHVGIEGRDAVTARTVVIAAGLDPAMDVELPRTRGLQTWWFAADSAP
FT                   SDDAALRVDGRRRGPIVNTAVMTNTAPTYAPRGQHLVQATCVMPSMATEEGIRSQLAEI
FT                   WDADTRPWRLLRRDDIARALPAQDPPLRLRRSVRLDDGRFVAGDHRDTASIQGALVSGE
FT                   RAAEAVLADAAG"
FT   CDS_pept        complement(33038..33547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0030"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0030"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ72994"
FT                   /db_xref="GOA:E8N7G1"
FT                   /db_xref="UniProtKB/TrEMBL:E8N7G1"
FT                   /protein_id="BAJ72994.1"
FT                   /translation="MRFHETLVGPRWLAIAGALTLAFVAVLAVIALPVLITRIDRVGIG
FT                   TLVVCGVGLVAVVGAGAMGLARRITVTVDDTHVDVRLVPFRVMHLPRGRVAEVRVCQVD
FT                   PAMAGGIGWRIVGRRRLALWSAGPAVRLTLEDGSLRILQTSRAEELRSAISAGRVGEDG
FT                   LGRALA"
FT   regulatory      complement(33555..33560)
FT                   /locus_tag="MTES_0030"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(33664..34164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0031"
FT                   /product="histone acetyltransferase HPA2"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0031"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ72995"
FT                   /db_xref="GOA:E8N7G2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:E8N7G2"
FT                   /protein_id="BAJ72995.1"
FT                   /translation="MTDLRDGAVLRPARAGDEEGVLACIQALADYENEPDAVDNTAEMI
FT                   AATLFGDDPRAFAFVVEREGEIRAIAIWFLTYSTWTGRHGIWLEDLYVHEQFRSHGYGV
FT                   ALLAALAAECVEKQYSRLEWTVLDWNEPAIGFYRALGAEAMDEWTTRRVTGEALTALAA
FT                   RAR"
FT   CDS_pept        complement(34161..35114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0032"
FT                   /product="Zn-dependent dipeptidase, microsomal dipeptidase
FT                   homolog"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0032"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ72996"
FT                   /db_xref="GOA:E8N7G3"
FT                   /db_xref="InterPro:IPR008257"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:E8N7G3"
FT                   /protein_id="BAJ72996.1"
FT                   /translation="MLWDQHACVELVETADIAELRRYRGAGGGYVSLNVGYAPHAPELT
FT                   ASLLRSFRAQVDAIDGLELAATVADIDRIAARGDTAVAFDLEDCAPLGGNLDAVGPLVA
FT                   QGVRTLGPTYNHANRAGGGCLDPVDDGLTPWGRDLVAEMNRRGMVPDGSHVGARTTFDM
FT                   CAISTRPVVFSHSNMRAVWDHPRNITDDQARAAAETGGVIGITGVGIFLGPNTPTLDAM
FT                   VRHIEYAVGVVGIRHVGVSTDFSFDWPTFRDTIAESPALYDESYTRWGPMEWMPPETFV
FT                   GLGSALSARGWADTDTAAVLGGNFRRVAAESWEPLT"
FT   regulatory      complement(34173..34178)
FT                   /locus_tag="MTES_0031"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(35114..35851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0033"
FT                   /product="predicted sulfurtransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0033"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ72997"
FT                   /db_xref="GOA:E8N7G4"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="InterPro:IPR040503"
FT                   /db_xref="UniProtKB/TrEMBL:E8N7G4"
FT                   /protein_id="BAJ72997.1"
FT                   /translation="MASVLNVSAYLFTRIDDPAAVRDALRERAVEAELRGTILLAEEGI
FT                   NLFLAGPADPVRAFLDELRTDERFAALETKDSWSDAVPLGKLLVKVKREIIRMDRPEVR
FT                   PQDGRAPAVSPDTLRRWLDRGTDDAGREVVLVDTRNAFEVDYGTFSGAKDWRIERFTQF
FT                   PDAASSHRDELAGKTVVSFCTGGIRCEKAALYLRDEGLDAYQLDGGILGWFAAHGDAHW
FT                   DGDCFVFDEREALDAGLAPRAGA"
FT   regulatory      complement(35124..35129)
FT                   /locus_tag="MTES_0032"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(35862..35867)
FT                   /locus_tag="MTES_0033"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      35929..35934
FT                   /locus_tag="MTES_0034"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        35939..36697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0034"
FT                   /product="glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0034"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ72998"
FT                   /db_xref="GOA:E8N7G5"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E8N7G5"
FT                   /protein_id="BAJ72998.1"
FT                   /translation="MPAGPLVSVVIPVLDDGPHLWRCLRALAAQTLIADEIVVVDNDST
FT                   DDSADIARAAGARVVFCGERGIPAATATGYDAARGELILRLDADSLPAPTWIATMVEAL
FT                   ADPDVDAVTGGAVFHDGPRSQRVTMARAFLGTYNAFAFPALGHTPLWGSNMAFRRAAWD
FT                   AVRHEVHLDPEVHDDLDLAYHLGLRHRIRRVPGRHMRVSSRTVEPRRFVRCFRRGAGTV
FT                   FAHWPRDIPPVRWARLARARRRAAGTGAAR"
FT   regulatory      36680..36685
FT                   /locus_tag="MTES_0035"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        36697..37533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0035"
FT                   /product="metal-dependent hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0035"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ72999"
FT                   /db_xref="GOA:E8N7G6"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:E8N7G6"
FT                   /protein_id="BAJ72999.1"
FT                   /translation="MAGILFPDVAAPDLHVMSFNIRRRFDRMTWPPADRWPMRKQRLRT
FT                   FLSANRPHLLGSQEAMPDQALWVQQSLGSAYGRIGLGRGKNRDGEGTPLFYDRDRIEVE
FT                   EWEQVMLSDTPDVPGSTGWGNTIPRVAVIAQLRDRATDARFTFVNTHFDAFSRRARRRS
FT                   ASWLHDLVAARERPLLFTADVNAHVRSAELAGMFADGLLVDTWAYAPARRTAEWGTFNN
FT                   YASPRVGARRIDALLATPDVGVRAVGIDPRPTGTQWPSDHLPVQAVVRIHPGSDAR"
FT   regulatory      37518..37523
FT                   /locus_tag="MTES_0036"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        37530..38117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0036"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0036"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73000"
FT                   /db_xref="GOA:E8N7G7"
FT                   /db_xref="UniProtKB/TrEMBL:E8N7G7"
FT                   /protein_id="BAJ73000.1"
FT                   /translation="MIRAMYANLKRPPRSVTDWLADVVRAVAIVVVIVSLFTLPFTDFA
FT                   VLSMSLPAVMLSRMIGLRSGLDLVTCVTVFVAAGSNVIDLYRAWTGWDLLVHLACTGVL
FT                   AAVALVLLDDARVVEPTGHRRTPIVVATIAGLALSAVWEMVEWFGYRFITDAIFVTYDD
FT                   TIGDMMAGGAGALIAGVLASRWRLTRADRAKL"
FT   CDS_pept        complement(38145..38657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0037"
FT                   /product="glycopeptide antibiotics resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0037"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73001"
FT                   /db_xref="GOA:E8N7G8"
FT                   /db_xref="InterPro:IPR006976"
FT                   /db_xref="UniProtKB/TrEMBL:E8N7G8"
FT                   /protein_id="BAJ73001.1"
FT                   /translation="MISTILVEISRWVPLLFWAGCAAVAATAWILHRLRLRVALFVLSG
FT                   LALLAVAGLTLLPDGEPSDGGCTVQFSVPLQGIDTLANVAMMLPLALFLGVATRRPVLV
FT                   IGAVSALSAAVETVQALVPALGRRCDTDDWLMNTVGAAVGGLAALAILWVERRRSCRGE
FT                   SVSAAHV"
FT   CDS_pept        complement(38654..38941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0038"
FT                   /product="predicted transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0038"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73002"
FT                   /db_xref="GOA:E8N7G9"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:E8N7G9"
FT                   /protein_id="BAJ73002.1"
FT                   /translation="MMVRLPHTSEVVARGKRLGVLLRNARGARSIADVAASAAVSPETL
FT                   RKIETGRLVTPSFATVAAVAGALGLSLDDLAAQWNAGGAENAAGAERGAA"
FT   regulatory      complement(38662..38667)
FT                   /locus_tag="MTES_0037"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(38949..38954)
FT                   /locus_tag="MTES_0038"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      39008..39013
FT                   /locus_tag="MTES_0039"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        39020..39790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0039"
FT                   /product="methionine aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0039"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73003"
FT                   /db_xref="GOA:E8N7H0"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:E8N7H0"
FT                   /protein_id="BAJ73003.1"
FT                   /translation="MIEILNATQLAHARTTGAIVGETLAELRRRATVGVNLLEIDEWAR
FT                   ELIADAGARSCYVDYAPAFGNGPFGHHICTAVNDAVLHGLPRDYALRSGDLLTLDLAVS
FT                   KNGIAADAAVSFVVGPDRPAGSAALIQVTEDALAAAIDVARPGNRIGDISHAIGRVLAG
FT                   AGYTVNTEFGGHGIGSTMHGDPHVPNDGRPGRGFRLRPGLLLALEPWVMDDTDVLVTDA
FT                   DGWTLRSATGCRTAHSEHTIAITDGPAEILTLPR"
FT   CDS_pept        complement(39852..41381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0040"
FT                   /product="catalase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0040"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73004"
FT                   /db_xref="GOA:E8N7H1"
FT                   /db_xref="InterPro:IPR002226"
FT                   /db_xref="InterPro:IPR010582"
FT                   /db_xref="InterPro:IPR011614"
FT                   /db_xref="InterPro:IPR018028"
FT                   /db_xref="InterPro:IPR020835"
FT                   /db_xref="InterPro:IPR024708"
FT                   /db_xref="InterPro:IPR024711"
FT                   /db_xref="InterPro:IPR037060"
FT                   /db_xref="InterPro:IPR040333"
FT                   /db_xref="UniProtKB/TrEMBL:E8N7H1"
FT                   /protein_id="BAJ73004.1"
FT                   /translation="MTEPTTTNGGAPVASDEHSQSVGADGSIALTDHYLIEKLAQFNRE
FT                   RVPERVVHAKGGGAFGTFRTTGDVSAYTRAALFQPGVETEMLARFSSVAGEQGSPDTWR
FT                   DPRGFSLKFYTTEGNYDLVGNNTPVFFVKDGIKFPDFIRSQKRLPGSHLRDNTMQWDFW
FT                   TLSPESAHQVTWLMGDRGIPASWRHMNGYGSHTYQWINAEGERFWVKYHFHTDLGHKTL
FT                   TQDEADQIAGQDADFHIRDLYAAIERNEFPTWTLKVQIMPYEDAKTYRFNPFDLTKVWP
FT                   HSDYPEIEVGTMELNRNPGNYFAEIEQAAFEPSNFVPGIDGSPDKMLQARIFSYADAHR
FT                   YRVGTNYQQLPVNRPHTEVHSYSKEGAMRYEYNPPEVPVYAPNSAGGPAADPRRAGDGG
FT                   WQSDGELVRSAATLHPEDDDWGQAGTLVREVMSAEARDRLVETITGHVGGVTRKDVRDR
FT                   AVQYWKNVDAEIGSRLEAALPPLESSTAPGEQLSEPNPDGDLVGTDVAGNI"
FT   regulatory      complement(41385..41390)
FT                   /locus_tag="MTES_0040"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      41549..41554
FT                   /locus_tag="MTES_0041"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        41562..41777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0041"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0041"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73005"
FT                   /db_xref="InterPro:IPR021331"
FT                   /db_xref="UniProtKB/TrEMBL:E8N7H2"
FT                   /protein_id="BAJ73005.1"
FT                   /translation="MSKDLSKGDRVSWDTPQGRTQGEVVEKKTKDFQHDGQKFTASDDE
FT                   PAYIVKSEKSGSTAAHKGSALNKLKS"
FT   CDS_pept        complement(41934..43370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0042"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0042"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73006"
FT                   /db_xref="InterPro:IPR007357"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR036134"
FT                   /db_xref="UniProtKB/TrEMBL:E8N7H3"
FT                   /protein_id="BAJ73006.1"
FT                   /translation="MKAALILATQQFAEHPAYDDDIEEFFFIESAPRFRKLPYHRHKIV
FT                   LLISAMRHTAARLEGEGRTVRRITLDDDLTFKAGLERLLKAHRVTELTWMSDPNRPVDE
FT                   RIARICQAHDVETEVLPDGLFLTPEEDVDGWFAEHPTPLMEDFYHWQRRRTGILMDGGK
FT                   PAGRRWNFDADNRKALPKKGVDIPPLPQIEPDEITRAVIAEVDELFPEHPGAAEEFWLP
FT                   VTPEESRDWLDTFVAERLHDFGRYEDAMKADEPFLFHAIISPMLNIGLLTVEEVVAAAT
FT                   RTDAPLASVEGFVRQVIGWREYMRGMYRAHPKLEHVNALHLEKRIEKYWYSGERMPSDL
FT                   PIPVRTVLERVHRWGYAHHIERLMVLGNWFLLQGYAPRQVNAWFLALFVDAYDWVMVPN
FT                   VMGMSQFADGGFVATKPYVSGGAYLQKMGSWWPSAQDAKDSVFTDAYWEFLERHEDVLA
FT                   GNHRLGLALAQMRKRREARG"
FT   regulatory      complement(43381..43386)
FT                   /locus_tag="MTES_0042"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(43405..43674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0043"
FT                   /product="uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0043"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73007"
FT                   /db_xref="InterPro:IPR017136"
FT                   /db_xref="UniProtKB/TrEMBL:E8N7H4"
FT                   /protein_id="BAJ73007.1"
FT                   /translation="MGAPDHEPRRARAGLARTPRLCQRKPPRLDAAFCDHDDMSRPEVR
FT                   AKPCAYCGRPFTDRKRWSGRDQWDQVLYCSRGCRANAAKQRRRA"
FT   regulatory      43660..43665
FT                   /locus_tag="MTES_0044"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        43673..43801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0044"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0044"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73008"
FT                   /db_xref="UniProtKB/TrEMBL:E8N7H5"
FT                   /protein_id="BAJ73008.1"
FT                   /translation="MDTTPDRTNDTADEPDELETADAPRIPDTTDDDAPVDNPSGG"
FT   regulatory      complement(43681..43686)
FT                   /locus_tag="MTES_0043"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(43856..44347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0045"
FT                   /product="uncharacterized stress protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0045"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73009"
FT                   /db_xref="GOA:E8N7H6"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR038725"
FT                   /db_xref="UniProtKB/TrEMBL:E8N7H6"
FT                   /protein_id="BAJ73009.1"
FT                   /translation="MSSTDTELDTLNELLKKFRFAMVTTRAEDGALHAHPLTVQENESD
FT                   GDLWFIVGTHASAVEHVRRDPKVGLSFSSDSTWLSLAGEAEVVDDLAKLKELWSTTVEA
FT                   WFPDGPESPGVTLMKVSALTGEYWGSAGGRLATAIALVTSKVTGERPKGGENEKFDLTD
FT                   "
FT   regulatory      complement(44352..44357)
FT                   /locus_tag="MTES_0045"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(44400..44750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0046"
FT                   /product="2-polyprenylphenol hydroxylase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0046"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73010"
FT                   /db_xref="UniProtKB/TrEMBL:E8N7H7"
FT                   /protein_id="BAJ73010.1"
FT                   /translation="MASGTDDSADAERWLVIDGRRWRRTDPALPHDLAARLRSHLGRAR
FT                   SAVRTTKRAGDADGTADARRRVGLAKAGLGERGPRWWEEDVADRTRRAREAVEELDRLA
FT                   PPRADDGSDVNT"
FT   regulatory      complement(44759..44764)
FT                   /locus_tag="MTES_0046"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      44970..44975
FT                   /locus_tag="MTES_0047"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        44980..45264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0047"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0047"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73011"
FT                   /db_xref="UniProtKB/TrEMBL:E8N7H8"
FT                   /protein_id="BAJ73011.1"
FT                   /translation="MSSLYPSPLSWRQADLDVYVATAGSDYAGFVGAATSGYEAQGPLG
FT                   ENLGIHTSVGAAQAAVDGHRVRGTTSVLRRPRPLRVRRNGAHGRLCGPT"
FT   regulatory      45267..45272
FT                   /locus_tag="MTES_0048"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        45281..45484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0048"
FT                   /product="cold shock proteins"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0048"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73012"
FT                   /db_xref="GOA:E8N7H9"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:E8N7H9"
FT                   /protein_id="BAJ73012.1"
FT                   /translation="MATGTVKWFNSEKGYGFIAPDDGSADLFAHFSAIQGNGFKELTEA
FT                   QKVEFDAEQGPKGMQAANIRPL"
FT   regulatory      45674..45679
FT                   /locus_tag="MTES_0049"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        45688..46815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0049"
FT                   /product="fatty acid desaturase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0049"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73013"
FT                   /db_xref="GOA:E8N7I0"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="InterPro:IPR012171"
FT                   /db_xref="UniProtKB/TrEMBL:E8N7I0"
FT                   /protein_id="BAJ73013.1"
FT                   /translation="MNTEEQFIASTIVESRLGPVRQTYSGTTEFPPIAKAYTELSQVVR
FT                   ESGLLVRTRVFYALVGSALVLAFAGCIAGFVLLGDSWFQLLIAAALGILFTQVAFLAHE
FT                   ANHRQILASGPANDRLALWIGNGIVGMSQSWWASKHTRHHANPNRVGKDPDIEIDTISF
FT                   LDEDAAKARGIQRWITQRQGWLFFPLLTLEGLNLHVLAIRHLLSRGEVKGRWTELGLIA
FT                   LRFAVFVAPVFVFLPIGMAFAFLGVQLAVFGVYMGASFAPNHKGMAVIAPGAKLDFFSK
FT                   QVRTSRNISGGWWATWLMGGLNYQIEHHLFPNMPRPHLSRAREIVREHCQTLGVPYVET
FT                   TLLQSYGIVIQYLNRVGLAARDPFECPLTSAARRV"
FT   CDS_pept        complement(47566..48069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0050"
FT                   /product="predicted phosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0050"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73014"
FT                   /db_xref="GOA:E8N7I1"
FT                   /db_xref="InterPro:IPR000979"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:E8N7I1"
FT                   /protein_id="BAJ73014.1"
FT                   /translation="MATRLLLVADTHVPKRARTLPDAVRRVASEVDLIVHAGDWVTAGV
FT                   LDELLALGPVLGVWGNNDGADLRARLPEVARAEIEGVRVAVIHETGAATGREKRMDAAF
FT                   ADTDLLVFGHSHIQWDTTTPAGLRLLNPGSPTDRRRQPRCTMMTLTLTDGELRDLELHG
FT                   VARD"
FT   CDS_pept        47962..48789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0051"
FT                   /product="response regulator consisting of a CheY-like
FT                   receiver domain and a winged-helix DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0051"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73015"
FT                   /db_xref="GOA:E8N7I2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:E8N7I2"
FT                   /protein_id="BAJ73015.1"
FT                   /translation="MDDQVDLGCHAPHGIREGPGPLRHVRIGHEEQSGRHASTLHTLAI
FT                   HRPAYDDGMRVLIVEDEPYLAEAIRDGLRLEAIAADIAGDGDSALEQLSYTAYDVVVLD
FT                   RDIPGPNGDEIARHLVAQPAAPRVLMLTAADRLDDKASGFESGADDYLTKPFVLKELVL
FT                   RLRALARRPAVGAPPILELDGIRLDPFRREVYRDGRYVSLTRKQFAVLEVLMTAGGGVV
FT                   SAEVLLERAWDENADPFTNAVRITISTLRKRLGEPWLIQTVAGVGYRIGPADA"
FT   regulatory      complement(48080..48085)
FT                   /locus_tag="MTES_0050"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      48769..48774
FT                   /locus_tag="MTES_0052"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        48782..49900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0052"
FT                   /product="signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0052"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73016"
FT                   /db_xref="GOA:E8N7I3"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E8N7I3"
FT                   /protein_id="BAJ73016.1"
FT                   /translation="MRERPAGLSVRIKLTLSYAVFVVIVGIALFTVGFLVLRFLPEGNL
FT                   YADNGLFTPARSNLAEVFVKYAWFTLAALAVIGLGGGWIVAGLMLRPLTRITDAARAVR
FT                   DGSLDRRVDLPGRRDELTDLADTFDAMLSRIAETVQEQRRFAANASHELRTPHATMRTM
FT                   LEVARADPDNVDVERLLGRLDDTNERAIRLTEAILALSRASHGGVIARSEVRIDALTAE
FT                   VCAELAPLAVDAPARLTTRIASPAVAVADETLARQMITNLVHNAIVHSAAEGTASREIQ
FT                   VTVRTDARSVVIDVANTGAELSRETVATLPEPFVRAAGRARTAAAGTGLGLAIAVAIVR
FT                   AHEGSLELWPREGGGLHARVRLPRPTGDQARG"
FT   CDS_pept        complement(50056..50508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0053"
FT                   /product="glycopeptide antibiotics resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0053"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73017"
FT                   /db_xref="GOA:E8N7I4"
FT                   /db_xref="InterPro:IPR006976"
FT                   /db_xref="UniProtKB/TrEMBL:E8N7I4"
FT                   /protein_id="BAJ73017.1"
FT                   /translation="MPNAPILTPARVLVAAAALAVVGVLTLAPRALIRPFQERAVDAFF
FT                   LVAERWGGLTLAYNSDVVMNIALFVPLGIAVAALLPLRFTPLTVPFGLAVSLAVETAQS
FT                   LIPGRVPDVDDVLHNTLGAAVGTLIVIVLRLSTRAAVRAGETVSRG"
FT   regulatory      complement(50513..50518)
FT                   /locus_tag="MTES_0053"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      50603..50608
FT                   /locus_tag="MTES_0054"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        50612..51007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0054"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0054"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73018"
FT                   /db_xref="GOA:E8N7I5"
FT                   /db_xref="InterPro:IPR021414"
FT                   /db_xref="UniProtKB/TrEMBL:E8N7I5"
FT                   /protein_id="BAJ73018.1"
FT                   /translation="MDAVTSSRTRLALVLLVDVVLVIVFAAIGRATHDGDVLGPLGSGL
FT                   ATTAWPFLVALVLGWLIARAWRAPLAPLRTGLIVWAVTVVVGMVLRAVSGQGVAVAFVI
FT                   VASITLALFLVGWRVVARLASRRRRAV"
FT   regulatory      51110..51115
FT                   /locus_tag="MTES_0055"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        51120..51713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0055"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0055"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73019"
FT                   /db_xref="GOA:E8N7I6"
FT                   /db_xref="UniProtKB/TrEMBL:E8N7I6"
FT                   /protein_id="BAJ73019.1"
FT                   /translation="MTNLDEDLRAADPAHHLEGSRAETIAARTWDHMRAMAPPSRPRRR
FT                   RLVLPLTLAVIALSTGAALAAPIWLGVGEDATRVDPDAQIPITYTTLSGVKVDCVWAVR
FT                   VGEDQRSAADDRVARALAQTDWEGIGQEIYDYAIANPRGPQPGEVWTNDTPEVRDALAF
FT                   RIAVTPIIERRLPAEIRALEPGWASTSTCTGPFR"
FT   regulatory      51662..51667
FT                   /locus_tag="MTES_0056"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        51674..52309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0056"
FT                   /product="DNA-directed RNA polymerase specialized sigma
FT                   subunit, sigma24 homolog"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0056"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73020"
FT                   /db_xref="GOA:E8N7I7"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:E8N7I7"
FT                   /protein_id="BAJ73020.1"
FT                   /translation="MGEHQHLHGSVPVSRRPDARSEDWATRVAADNGADLLRYFARRHP
FT                   DDADDLLSETLAVIWRRRDHLPTNPSDARMWSFGVARNVSHRHRRGLLGRRRLYDALAS
FT                   EADVTEAAPADPSAAAERRERETDVRRAIGRLRATDRELIMLVHWDGFTLVDAAALLGL
FT                   NASTARTRYGRAKACFVVHLEEHRSAPRRDDAESHSTRRRYGPGVQDA"
FT   CDS_pept        complement(52326..52838)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0057"
FT                   /product="glycine cleavage system regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0057"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73021"
FT                   /db_xref="GOA:E8N7I8"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR016867"
FT                   /db_xref="UniProtKB/TrEMBL:E8N7I8"
FT                   /protein_id="BAJ73021.1"
FT                   /translation="MTTLVLTIVGDDRAGLVSSVADIIDAHGGNWENSELAELAGAFAG
FT                   IVEVSVAADQADALRAALEGMAGTLAVTVHTGAPEGTASAPHSVTLEVIGNDRPGIVRE
FT                   ISAALTARGVSIERMSTQTTDAAMAGGRLFEASITVTLIEGVETDDLVEELERLAAEIQ
FT                   VDVSLAD"
FT   regulatory      complement(52847..52852)
FT                   /locus_tag="MTES_0057"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      52885..52890
FT                   /locus_tag="MTES_0058"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        52899..53177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0058"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0058"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73022"
FT                   /db_xref="GOA:E8N7I9"
FT                   /db_xref="UniProtKB/TrEMBL:E8N7I9"
FT                   /protein_id="BAJ73022.1"
FT                   /translation="MIASLIALLNLLLATAELALTPGTGAPLLAVVLAAAVVVTVAIVL
FT                   VVLPALLAGASPRAPRPIDPSAPLTQSDPDAAGHPRPRAPGFVARAA"
FT   regulatory      53199..53204
FT                   /locus_tag="MTES_0059"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        53210..54022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0059"
FT                   /product="preprotein translocase subunit YidC"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0059"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73023"
FT                   /db_xref="GOA:E8N7J0"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="InterPro:IPR028055"
FT                   /db_xref="UniProtKB/TrEMBL:E8N7J0"
FT                   /protein_id="BAJ73023.1"
FT                   /translation="MASVPEGRWRSDPSITDPLIAATNGTLMDLFTLPPLAFLLDLTTR
FT                   ALLALTDTLTPLTGGLAAALAVVAVTLVVRLALIPVGVSQARAEQTRARLAPRLRVLQE
FT                   RWRKNPERLQRETMQLYRDENTSPAAGCLPLLAQAPVVGLLYAVFLHPTVGGHANTLLT
FT                   HDLFGVPLGRSLVGALTSGTMDATTLAVFASLVVVIAGVAELTRRLLRPATDPSAPTWM
FT                   TGMVGVLQFTTAGVALFVPLAAALYLTVTTMWTLGQRLLLRRRYPLQA"
FT   CDS_pept        complement(54026..55255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0060"
FT                   /product="permease of the major facilitator superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0060"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73024"
FT                   /db_xref="GOA:E8N7J1"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E8N7J1"
FT                   /protein_id="BAJ73024.1"
FT                   /translation="MTLPVTTHRSLIHHTGLWYFPVAFVARLPFAMMTVGVLALVVAVR
FT                   GSVALGGLTSAAVGLGVVVAGPVLGDLADRFGQRRVLVPVGLANGILLSLFPLVVAASS
FT                   SDALLLASAAAIGLTGPQTAAMSRSRVMALIGERVDPQRRERTFSRAMAYESAADETAF
FT                   VIGPFVVGLLAALIAPWAPIVGAAVLSFVFVTAFALHPTGRAVPERAERAAMAPARELV
FT                   HPKLLVLVAAVFGVGLFFGSTLTSLTAFMEAQGAPEAGALLYGVMGVGSAVLALAVALL
FT                   PARFSLRWRLVAFASILTASAGAYTVGGSVPTVTLVLCLMGIGVGPSLVTLFSLAGHRA
FT                   PRGRTASTMTVLASALTLAQALSSAVTGAVAEQVSVETAMLFPAGAALLVLATAGLNAA
FT                   RSPRWDRRTP"
FT   regulatory      complement(55262..55267)
FT                   /locus_tag="MTES_0060"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(55357..55572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0061"
FT                   /product="ribose/xylose/arabinose/galactoside ABC-type
FT                   transport systems, permease components"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0061"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73025"
FT                   /db_xref="GOA:E8N7J2"
FT                   /db_xref="UniProtKB/TrEMBL:E8N7J2"
FT                   /protein_id="BAJ73025.1"
FT                   /translation="MEPVLIALLFANAVFNAVVWPRFYVRVAKDPRAKNAAGKATPFLI
FT                   VHTVLIGLALALALASLIAAIAALVS"
FT   regulatory      complement(55578..55583)
FT                   /locus_tag="MTES_0061"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(55601..55942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0062"
FT                   /product="DnaK suppressor protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0062"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73026"
FT                   /db_xref="GOA:E8N7J3"
FT                   /db_xref="InterPro:IPR000962"
FT                   /db_xref="InterPro:IPR020458"
FT                   /db_xref="UniProtKB/TrEMBL:E8N7J3"
FT                   /protein_id="BAJ73026.1"
FT                   /translation="MDAAHAERMLDDRQREVDHRLARLREDEASLRHDRADATADDEHD
FT                   PEGSTLSGEWAQVDALRRGAEAERVEIQAARERVASGTFGVCENCGRPIGDARLEARPF
FT                   ARRCIACAV"
FT   regulatory      complement(55951..55956)
FT                   /locus_tag="MTES_0062"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      56014..56019
FT                   /locus_tag="MTES_0063"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        56031..56351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0063"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0063"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73027"
FT                   /db_xref="GOA:E8N7J4"
FT                   /db_xref="InterPro:IPR021362"
FT                   /db_xref="UniProtKB/TrEMBL:E8N7J4"
FT                   /protein_id="BAJ73027.1"
FT                   /translation="MLFLVLAVAGLVGTWTFNVLAIVQMSDFLGDLVTSGPAVSSITVD
FT                   LLVVAIAGSAFIIIEARRLGMRFGWAYVVLSGITAFAFTFPLFLAMRQRHLTARREATA
FT                   GA"
FT   CDS_pept        complement(56386..57246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0064"
FT                   /product="predicted nucleoside-diphosphate-sugar epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0064"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73028"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E8N7J5"
FT                   /protein_id="BAJ73028.1"
FT                   /translation="MTLLVTAASGHLGRLVVDALLERGVPASDIVAGVRTPAKAGDLAD
FT                   RGIRVVEFDYARPETLAPALEGVTRVLLISGTDVDRVTGHGNVIDAARAAGVERLVYTS
FT                   APRNDEIDYALGAEHKATEALIAASGVEATILRNNWYTENYLDAVARAAETGEIVAAVG
FT                   DARVASASRRDYAEAAAIALIGDDLRGQTLELGGDVAWTYDELAAAASEVVGRPVAYTA
FT                   VTVEQLAAGLEAAGLDAGTAAFVAGIDDAIARGALGQTDGTLSRLLGRPTTPLAQGLRE
FT                   GLAAR"
FT   regulatory      complement(57254..57259)
FT                   /locus_tag="MTES_0064"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      57327..57332
FT                   /locus_tag="MTES_0065"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        57340..57708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0065"
FT                   /product="predicted transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0065"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73029"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E8N7J6"
FT                   /protein_id="BAJ73029.1"
FT                   /translation="MSVSLAEIRAEHPEVFADGCPTRTVLDHVMGKWGILVLMALSDGT
FT                   QRWGVLRRNVSGISEKMLASTLKTLEADGLVVRTAYPEVPPRVEYGLTDRGRGLMEHVL
FT                   PLMGWVAENAAAIVARPE"
FT   regulatory      57702..57707
FT                   /locus_tag="MTES_0066"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        57711..58769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0066"
FT                   /product="predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0066"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73030"
FT                   /db_xref="GOA:E8N7J7"
FT                   /db_xref="InterPro:IPR023188"
FT                   /db_xref="UniProtKB/TrEMBL:E8N7J7"
FT                   /protein_id="BAJ73030.1"
FT                   /translation="MLSIPSRYLRESLSFRTKRRAPFLQVAKSAIATVAAWLVAGWLVQ
FT                   GPPPIFAAIAALLVVQPSINQSLTRAVERSVGVVVGVVIASLLGIALGSPTWVILLSAG
FT                   VALVFAWALRMSPGATNQVAISAILVLALGTATPNYALDRVLETLIGALVGIVVNVALV
FT                   PPVLVPPAREKLEVLGRELAAALERLAQALEAPQTPASLEELLLEARLLRPVRDAAATA
FT                   IADGADSLSLNPRSGRHRADLLAMQDLLDRFTPVVTQAIGMTRAVYDGYDATIAEEPSV
FT                   RAIAEQLHRAAHDVRRAFAVDTGADLPIAAEEPALTRPLQIRTPSAAHWVLVGSLLMDL
FT                   HRVHETLRDGEG"
FT   regulatory      58913..58918
FT                   /locus_tag="MTES_0067"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        58923..59576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0067"
FT                   /product="uncharacterized protein, similar to the
FT                   N-terminal domain of Lon protease"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0067"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73031"
FT                   /db_xref="GOA:E8N7J8"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:E8N7J8"
FT                   /protein_id="BAJ73031.1"
FT                   /translation="MGTAMFPLGAVLFPHTPLALRIFEERYLVMLGRLLDESAPAFGVV
FT                   LIERGTETGGGDQRFAIGTMARLSHVLPEADQLQIVARGTERFEIVTWLDDDPYPRADV
FT                   RALPDLEWNEALAPVLEEAERIVRRVLGRAVQFGGSRWDPEVELSEDPLERAWQLAAIA
FT                   PLGELDQIELLRSETAGGLLRATIDLTLAAEPLLSEPIPDGVIVIEDDDDTAGE"
FT   CDS_pept        complement(59599..60264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0068"
FT                   /product="predicted nucleoside-diphosphate-sugar epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0068"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73032"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E8N7J9"
FT                   /protein_id="BAJ73032.1"
FT                   /translation="MERIVIIGGHGKVALHLAGLLAERGDEAVSVIRNPDQSADVEKAG
FT                   GTPLVLDVEKADVDALADALAGADAVVWAAGAGGGDADRTYAVDRDAAQRAVDAAGAAG
FT                   KRRFVMVSWIGSVPDHGISPDDSFFAYADAKLAADDYLRASDLDWTILGPGTLTLDPPT
FT                   GRITTAPQGSAEVGRADVAAVAAAVLLQSATIGRFIRFGAGDTLIAEAIVEEKTAPSD"
FT   CDS_pept        complement(60266..60649)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0069"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0069"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73033"
FT                   /db_xref="GOA:E8N7K0"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR019920"
FT                   /db_xref="UniProtKB/TrEMBL:E8N7K0"
FT                   /protein_id="BAJ73033.1"
FT                   /translation="MIPDRLRDLLEKPYYGALGTVRPDDTVQVNPMWFEFDGEYILFTH
FT                   TVTRQKYRNLQHNPSMSFMVYDPAEPYRYIEVRGRLVEEVADPEGAFYVRLGQRYGNPA
FT                   QQAPPDRADRVILKMSVEKVGGQ"
FT   regulatory      complement(60274..60279)
FT                   /locus_tag="MTES_0068"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(60655..60660)
FT                   /locus_tag="MTES_0069"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(60724..61122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0070"
FT                   /product="uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0070"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73034"
FT                   /db_xref="InterPro:IPR023006"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:E8N7K1"
FT                   /protein_id="BAJ73034.1"
FT                   /translation="MSFGSVRVRPSSTSPCPCGGGEFGRCCGPILDGEAAPSAERLMRS
FT                   RYTAYVVGDLAHLVRSWHPRTRPDDLDLDDGTEWEGLTVDDAQEEADTAVVAFRAEWRR
FT                   GGEREVLSERSRFVRRAGRWVYLDGDVN"
FT   regulatory      complement(61127..61132)
FT                   /locus_tag="MTES_0070"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      61204..61209
FT                   /locus_tag="MTES_0071"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        61213..62172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0071"
FT                   /product="predicted metal-binding integral membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0071"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73035"
FT                   /db_xref="GOA:E8N7K2"
FT                   /db_xref="InterPro:IPR001322"
FT                   /db_xref="UniProtKB/TrEMBL:E8N7K2"
FT                   /protein_id="BAJ73035.1"
FT                   /translation="MTNQTPQDRRPPFAAYGPASAGYGQTATVSAPPPPGATAPWPSPQ
FT                   AAPTHSPGFVPAPGSAGPRPPRRGLGIVALVIACAGALFAFSASPLVWLLLVTALVLAI
FT                   VQVARRGSARVPAVVAIVIVVLGIIIAMGAAILSGLTSSASTADPDPETDTYTLAQRLS
FT                   VAPGRGSPSELAWGTAQTIVDSDSGDDVWSIRALAPVDITAEAGSASPAPFSASGSLVA
FT                   VPIELTNLTDESIDPDGWQLRFSSSYLSPEGNYLESVYDPSVTDAYPSRYDIPGPIAPG
FT                   ETVTFYLVEDTSFTGADRGSVEVGLYSGDIITWRTTGG"
FT   regulatory      62222..62227
FT                   /locus_tag="MTES_0072"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        62241..63170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0072"
FT                   /product="5'-3' exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0072"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73036"
FT                   /db_xref="GOA:E8N7K3"
FT                   /db_xref="InterPro:IPR002421"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="InterPro:IPR020046"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="InterPro:IPR038969"
FT                   /db_xref="UniProtKB/TrEMBL:E8N7K3"
FT                   /protein_id="BAJ73036.1"
FT                   /translation="MASRPEKLLLLDTASLYFRAFYGVPDKVRAADGTSVNAVRGLLDM
FT                   IAKLVSTYGPTRVVACWDDDWRPAWRVELLPSYKAHRVVEAVSTGPDREETPDPLLAQI
FT                   PLIREALAVLGIPVVGAAEHEADDVIGTLATAADVPVDIVTGDRDLFQLIDDDHHVRIV
FT                   YTARGMSNLELVDDAVVVSKYGIHAAQYADFAVLRGDPSDGLPGVAGIGEKSAAALLTA
FT                   HGDLDGILTAAEAGTGGTPAQRAKILAAADYLAVAPTVVRVVRDLDLDVPDDELHPLDD
FT                   HRLAAANALAEKWNLGSSMTRALAALPH"
FT   CDS_pept        complement(63202..64194)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0073"
FT                   /product="histidinol phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0073"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73037"
FT                   /db_xref="GOA:E8N7K4"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR010996"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR027421"
FT                   /db_xref="UniProtKB/TrEMBL:E8N7K4"
FT                   /protein_id="BAJ73037.1"
FT                   /translation="MRPLDALNEIAYLLERERASRYKSKAFRTAAAAIEGLSDAELRDP
FT                   GLRRRPGIGDSTLAVIQQALAGGVPERLAALRETKGATGGEALRAALRGDLHSHSEWSD
FT                   GVTPIEAMVEAGRALGHEYLALTDHSPRLTVANGLSPARLREQLEVVRGLSGGGFTLLS
FT                   GIEVDILDDGDLDQEDALLRELDVVVASAHSKLRMDREPMTRRLVAAASDPRVDVLGHV
FT                   TGRLVEGARGTRPPSEFDARAVFAACAASGVAVEINSRPERQDPPDELIALALEAGCLF
FT                   SIDSDAHAPGQLSLLDYGAARAEAAGVPHERIVTTWTLDRLRSWLERAR"
FT   CDS_pept        complement(64198..65259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpD"
FT                   /locus_tag="MTES_0074"
FT                   /product="anthranilate phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0074"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73038"
FT                   /db_xref="GOA:E8N7K5"
FT                   /db_xref="InterPro:IPR000312"
FT                   /db_xref="InterPro:IPR005940"
FT                   /db_xref="InterPro:IPR017459"
FT                   /db_xref="InterPro:IPR035902"
FT                   /db_xref="InterPro:IPR036320"
FT                   /db_xref="UniProtKB/TrEMBL:E8N7K5"
FT                   /protein_id="BAJ73038.1"
FT                   /translation="MAERLTWPDVLTSLLEGRDLSVSESTWAMRRVMAGEATPSQLAGF
FT                   LVALRAKGETVEEIVGFRDAILEAAVPLPVRAEVLDIVGTGGDRYGTVNVSTMAAVVAA
FT                   ASGVPVVKHGNRAASSASGSSDVLSSLGIALTLDPAHVAETLDRTGITFAFAAAFHPGF
FT                   RHAGPTRSELGVPTVFNFLGPLCNPARAEANAVGVAHLDRVPLITGVFRTRGATALVFR
FT                   GDDGLDELTTTGHSRLWEISRGDVHEHDLDPRDLGIPLVEIDALLGGTPDHNAEVVRRT
FT                   LAGETGPVRDIVLLNAAAGLVSYRLFQDAAEVQRPILERLAEAMADAAAAVDDGRASAK
FT                   LDAWISTTRELAG"
FT   regulatory      complement(64199..64204)
FT                   /locus_tag="MTES_0073"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(65266..65271)
FT                   /gene="trpD"
FT                   /locus_tag="MTES_0074"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      65410..65415
FT                   /gene="ctaE"
FT                   /locus_tag="MTES_0075"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        65429..66064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctaE"
FT                   /locus_tag="MTES_0075"
FT                   /product="heme/copper-type cytochrome/quinol oxidase,
FT                   subunit 3"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0075"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73039"
FT                   /db_xref="GOA:E8N7K6"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:E8N7K6"
FT                   /protein_id="BAJ73039.1"
FT                   /translation="MVTTSATYSQAVRAVKRPDPVAVGTIVWLGSEVMFFAGLFAIYFT
FT                   LRSTSASLWAQETELLNVPFATVNTIILVLSSVTCQMGVFAAERYQPYRTGKSFRFVQW
FT                   GMVEWFYLTFILGAVFVSGQVWEYATLVAEGMPISANPYASAFYLTTGFHALHVTGGLI
FT                   AFLLVIGRAYAVKNFGRKEMTTSIVVSYYWHFVDVVWIALFFVIYFLK"
FT   regulatory      66062..66067
FT                   /gene="qcrC"
FT                   /locus_tag="MTES_0076"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        66081..66890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="qcrC"
FT                   /locus_tag="MTES_0076"
FT                   /product="cytochrome c, mono-and diheme variants"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0076"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73040"
FT                   /db_xref="GOA:E8N7K7"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR009152"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:E8N7K7"
FT                   /protein_id="BAJ73040.1"
FT                   /translation="MAREKKPRRASGRRSPLAAAALIGIGLLLTGGVYAGASAAMAATD
FT                   TPTSSASSATAVEEGKKLFQANCATCHGLDLEGSQQGPSLFGVGELSVHFQVSTGRMPL
FT                   QAQGPQAPQKPVQFTEEQIDAIAAFVQSSAPGPTYPSAELTDGEGDLSHGAELFRINCA
FT                   MCHNVAGAGGALTEGKWAPDLHTVTPVNMYAAMVTGPQNMPVFNDLNLTPEDKRDVISY
FT                   LMFLQKSESPGGFSLGSLGPVSEGLFIWIFGIGALIALTVWITAKSN"
FT   regulatory      66921..66926
FT                   /gene="qcrA"
FT                   /locus_tag="MTES_0077"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        66930..67988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="qcrA"
FT                   /locus_tag="MTES_0077"
FT                   /product="rieske Fe-S protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0077"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73041"
FT                   /db_xref="GOA:E8N7K8"
FT                   /db_xref="InterPro:IPR014349"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:E8N7K8"
FT                   /protein_id="BAJ73041.1"
FT                   /translation="MAHEEDALEHERASWKPSAGLAVAIPDPVENPGLPGHRHRMTDQD
FT                   PQAMKRAVRTVYTLFYFSVAASIWASIAYMIFPIESGALIDIRYNNLFIGLGIGFALLA
FT                   IGIGTIHWGKSVMSDKEYIEDRHATRGRDDTREGAVNVFVEANKDSGFGRREIIRNSLF
FT                   AALAASIIPGITLFRGLAPQDADPVKLLSHTMWKEGSRLSHDPSGRPIRAADVTLGSAF
FT                   HVIPEELAGLGHDEGYLEEKAKAIVLLMRLQPEQLNPETNNMDWTYDGIVAYSKVCTHV
FT                   GCPVALYEQQTHHLLCPCHQSQFDVANGAAVIFGPAARPLPQLPITVDAEGYLVAQSDF
FT                   HEPVGPSFWERK"
FT   regulatory      67974..67979
FT                   /gene="qcrB"
FT                   /locus_tag="MTES_0078"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        67985..69823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="qcrB"
FT                   /locus_tag="MTES_0078"
FT                   /product="cytochrome b subunit of the bc complex"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0078"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73042"
FT                   /db_xref="GOA:E8N7K9"
FT                   /db_xref="InterPro:IPR005797"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR027387"
FT                   /db_xref="UniProtKB/TrEMBL:E8N7K9"
FT                   /protein_id="BAJ73042.1"
FT                   /translation="MSIGTHPTENVTTEPAVSSGPQPAGRDGRPLGGRFVGAAANYLDE
FT                   RTSISGIVKELGRKIFPDHWSFMLGEIALWSFVVVLLSGTFLTFFFQASMVETHYNGAY
FT                   EPMRGIAMSAAMESALHISFDLRGGLLVRQIHHWAALVFVAGIGVHMLRVFFTGAFRKP
FT                   RELNWVVGFILFILAMAEGFTGYSLPDDLLSGNGLRIIDGMIKGLPIIGTWTSFLLFGG
FT                   EFPGTAIVGRLYTLHILLLPAILVALLAVHLMLMIINKHTQFAGPARSNSNVVGYPMLP
FT                   VYASKMGGFFFITFGVIVLIAALVTINPIWNYGPYDPSPVSAGTQPDWYIGFADGMLRL
FT                   IPPHLEFVLWDHTFSWNIIIPVGVLGLFIVLVLVYPFIEAWITGDTREHHIAQRPRNAA
FT                   TRTAIGAAGVTFYAVMWAAASSDIMATHFHLTMEGVIHALQALLILGPILAYFVTKRIC
FT                   IALQKKDREIALHGYESGRIVRLPGGEYIEVHQPVDEYERWKLVDNETYEPLVVRPNAQ
FT                   GQIPWYANFRAGVSRWFFEDRLAPLTQAEVDAAVAHQHHEPDHIDHEETDEIAGANARA
FT                   DEDGRPHMAIGERAEVEFPAPKGLEEKNRPQGDKSE"
FT   regulatory      69971..69976
FT                   /locus_tag="MTES_0079"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        69987..70448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0079"
FT                   /product="rhodanese-related sulfurtransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0079"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73043"
FT                   /db_xref="GOA:E8N7L0"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:E8N7L0"
FT                   /protein_id="BAJ73043.1"
FT                   /translation="MASVPSPAAPWASYRERMTSTQEYFAARLAAESDPSDVYAAQKAG
FT                   DRFVLVDVRGDDAWRQGRVSGAVHIPYREIAARAPVEIPIDTPVVVYCWSPGCNAGQKG
FT                   ALAFASLGYSVREMIGGYEYWVREGQPFENDEGPCDRVFDATVMVVRPR"
FT   CDS_pept        complement(70510..70995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0080"
FT                   /product="predicted
FT                   tRNA(5-methylaminomethyl-2-thiouridylate)
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0080"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73044"
FT                   /db_xref="GOA:E8N824"
FT                   /db_xref="UniProtKB/TrEMBL:E8N824"
FT                   /protein_id="BAJ73044.1"
FT                   /translation="MFVRVRDGDLLDADRVGLADFLSRAGLDLPDDSGELSRRSDSAPL
FT                   AFDGRSTDLQLDDLSQEGPVTGRIDHATLGPEEAEFIFRLCVAGKMMVVNPQGSPMYIV
FT                   PGDTHAREELPDPDDAVWVRTSAELAHVLGSSFEDLSSFRDRVLERPGPDAEGEPAR"
FT   regulatory      complement(71007..71012)
FT                   /locus_tag="MTES_0080"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(71102..71893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0081"
FT                   /product="serine/threonine protein phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0081"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73045"
FT                   /db_xref="GOA:E8N825"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:E8N825"
FT                   /protein_id="BAJ73045.1"
FT                   /translation="MPLRLNTAAVSDAGAHRPTNQDAAFVASWGAAVADGVGGGPSGDL
FT                   ASAALIHRLVATRGSAIDADGLLVRIREANWDIRAHVERDPALRGMATTFTGLFLGADG
FT                   QLLLAHTGDSRAYLLRGGEFTRETRDDSYVQALVDHGIIPPEAAAAHPRRNIITASLGG
FT                   AEGDVVSVAERPPVVGDRWVLCSDGLTDYVPEADVARLIAEADDPRSAAASAVALALEA
FT                   GTRDNVTVVVCDVVDDDQPVAGEPVFSGSAARWFAEDVETA"
FT   CDS_pept        complement(71898..72314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0082"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0082"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73046"
FT                   /db_xref="GOA:E8N826"
FT                   /db_xref="InterPro:IPR021050"
FT                   /db_xref="UniProtKB/TrEMBL:E8N826"
FT                   /protein_id="BAJ73046.1"
FT                   /translation="MRTNVGLWWLLAGFGFFIAAVYTVWSLIQHGGVEWVGTVALVFLG
FT                   LMSSMIAFYVGRVLKAQNGELPEDTLTADIDDGDPEMGEFSPWSWWPIVLAASAAIAVI
FT                   GLAVGSWMVPIGFMVFVVAIVGWVYEYYRGYFAR"
FT   CDS_pept        complement(72318..74087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0083"
FT                   /product="heme/copper-type cytochrome/quinol oxidase,
FT                   subunit 1"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0083"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73047"
FT                   /db_xref="GOA:E8N827"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR014241"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:E8N827"
FT                   /protein_id="BAJ73047.1"
FT                   /translation="MIMATTLPLQEKGTSRPTTLPPRQAALLSTSRVEQKGNLVVKWIT
FT                   STDHKTIGYMYLIASVIFFMLGGVMALIIRAELFEPGMQIIPTKEQYNQLFTMHGTIML
FT                   LMFATPLFAGFANALLPLQIGAPDVAFPRLNAFAFWLFLFGSTIAVSGFLTPQGAAGFG
FT                   WFAYQPLANASFSPGVGGNLWMLGLGISGFGTILGAVNFITTILTMRAPGMTMWRMPIF
FT                   SWNTLITSILILLAFPVLAAAIFAAAADRVLGAHIYSPENGGVLLWQHLFWFFGHPEVY
FT                   IIALPFFGIVSEIFPVFSRKPIFGYKTLVYATIAIAALSVAVWAHHMYVTGGVLLPFFA
FT                   LMTMLIAVPTGVKIFNWIGTLWRGSVTFETPMVFALGFLVSFVFGGLTGVILASPPLDF
FT                   HLSDSYFVVAHFHYVVFGTVVFAMFAGFYFWWPKWTGKMLNERLGMVHFWMLFIGFHMT
FT                   FLIQHWLGVDGMVRRYADYAAADGWTWENQLSTIGSMILGASMIPFLLNVWITARKAPR
FT                   VTVDDPWGYGASLEWATSCPPPRHNFTSIPRIRSERPAFDLNHPEAGIPVGVGPAKDAP
FT                   DTPVVDAAAGEVK"
FT   regulatory      complement(72326..72331)
FT                   /locus_tag="MTES_0082"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(74084..74965)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0084"
FT                   /product="heme/copper-type cytochrome/quinol oxidase,
FT                   subunit 2"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0084"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73048"
FT                   /db_xref="GOA:E8N828"
FT                   /db_xref="InterPro:IPR001505"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR014222"
FT                   /db_xref="InterPro:IPR036257"
FT                   /db_xref="UniProtKB/TrEMBL:E8N828"
FT                   /protein_id="BAJ73048.1"
FT                   /translation="MPSKRRLRWAALPVGIASVALLSGCTTTQLHGFLPGFVDDGTPAT
FT                   NHTDMVAGLWVNSWIVLLAVGVITWGLMLWAVIAYRRRKGQSGLPVQLRYNMPVEIFYT
FT                   IVPLILVIGFFAFTARDQNTLETQYDNPDVSITAYGKQWAWDFQYNGTKEDNSDAVYSM
FT                   GVQAKATADGYDLEDVPTLYLPVNKSVKIDLRSRDVIHSFWIIDFLYKKDMYIGRDNEW
FT                   SFTPTREGTYEGKCAELCGEYHSAMLFNVKVVSDAEYENYLKSLRDAGDVGDISDLSRL
FT                   QNLTTAGAEGNK"
FT   regulatory      complement(74092..74097)
FT                   /locus_tag="MTES_0083"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(74971..74976)
FT                   /locus_tag="MTES_0084"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(75131..75496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0085"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0085"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73049"
FT                   /db_xref="GOA:E8N829"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="InterPro:IPR017870"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/TrEMBL:E8N829"
FT                   /protein_id="BAJ73049.1"
FT                   /translation="MTDTTLSSAADTREHGVGLTAAASDKVKSLLSQEGRDDLRLRVAV
FT                   QPGGCSGLIYQLYFDERYLDGDKVVDFDGVEVIVDDMSVPYLDGASIDFKDTISEQGFT
FT                   IDNPNAQGSCACGDSFH"
FT   regulatory      complement(75503..75508)
FT                   /locus_tag="MTES_0085"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(75568..76962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0086"
FT                   /product="acetylornithine
FT                   deacetylase/Succinyl-diaminopimelate desuccinylase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0086"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73050"
FT                   /db_xref="GOA:E8N830"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="UniProtKB/TrEMBL:E8N830"
FT                   /protein_id="BAJ73050.1"
FT                   /translation="MTPDVSLQNAVRDAAAAGIPSALADLGALVRIPSIAWPAFDQSAL
FT                   VRSADAVADLFRGTGMFDRVEVKRAAIPGTDKLGQPAVLASRAPKNGRPTVLLYAHHDV
FT                   QPPGDEKLWDSPPFEPTVRDGRLYGRGAADDKAGVMAHVAAIRALAEVVGDDLDLGLAV
FT                   FIEGEEEYGSRSFAQFLADNADALRSDVIVVADSGNWDDRTPGLTVSLRGNARFTLTVR
FT                   TLEHASHSGMLGGAVPDAMLATVKLLSTLWDDDGAVAVEGLHVRDAETPEYDESTLRAE
FT                   SGLLEGVSPIGRDSILSRIWNKPSVTITGWDATPVASASNTLSPQTSVVISARVAPGQR
FT                   AEDAYAAIEAHLRAHAPFGAHLEFSDVDCGDAFLVDTSGWAVEDARASFAEGYGVPSVD
FT                   VGVGGSIPFIADLVREFPGAQILVTGVEDPHARAHSPNESLHLDTFRNAVVSEALLLAR
FT                   LNARTV"
FT   regulatory      complement(76970..76975)
FT                   /locus_tag="MTES_0086"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      76999..77004
FT                   /locus_tag="MTES_0087"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        77009..77581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0087"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0087"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73051"
FT                   /db_xref="GOA:E8N831"
FT                   /db_xref="InterPro:IPR021403"
FT                   /db_xref="UniProtKB/TrEMBL:E8N831"
FT                   /protein_id="BAJ73051.1"
FT                   /translation="MAKSPAPAPNDTPVDPTETGSGKGRATPSRAEQEAARKRPLVPDT
FT                   KEAKARARAELAAQREKARVGMAAGEERYLPVRDKGPQRRFARDFVDAGWHLGEGVMPF
FT                   MLIVILLTVLPVQFFQYWAFVALWIFILFVIGDMIITSIRVKRAAKDKFGESKLEKGLG
FT                   WYAAMRTVQMRFMRLPKAQVKRGQYPV"
FT   CDS_pept        complement(77661..78686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrD"
FT                   /locus_tag="MTES_0088"
FT                   /product="dihydroorotate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0088"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73052"
FT                   /db_xref="GOA:E8N832"
FT                   /db_xref="InterPro:IPR001295"
FT                   /db_xref="InterPro:IPR005719"
FT                   /db_xref="InterPro:IPR005720"
FT                   /db_xref="InterPro:IPR012135"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:E8N832"
FT                   /protein_id="BAJ73052.1"
FT                   /translation="MYPLLFRTVLTRLDPEFAHHLGALVIRVAGVEPVASVVRRFTAPA
FT                   PDQAVSALGLRFDSPFGVAAGFDKNVTMVRGLGALGFGHVEVGTVTALAQPGNPKPRLF
FT                   RLVADRAVINRMGFNNDGATAAAAKLRRLRRSRRRPVIGVNIGKSRVVAVDDATTDYVR
FT                   SARLLAPLADYLVVNVSSPNTPGLRGLQAVETLRPLLTAVQDAAGSTPLLVKIAPDLDD
FT                   DEVHDIARLAVDAGLAGLIATNTTIARTGLSTDAAKVEAAGAGGLSGAPLKRRAAEVLR
FT                   LVRAVVPAEFVVISAGGVETADDVRERLAAGANLVQGYTGFLYRGPLWARQINRGLARS
FT                   R"
FT   regulatory      complement(78696..78701)
FT                   /gene="pyrD"
FT                   /locus_tag="MTES_0088"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(78697..79188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdR"
FT                   /locus_tag="MTES_0089"
FT                   /product="predicted transcriptional regulator, consists of
FT                   a Zn-ribbon and ATP-cone domains"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0089"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73053"
FT                   /db_xref="GOA:E8N833"
FT                   /db_xref="InterPro:IPR003796"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="UniProtKB/TrEMBL:E8N833"
FT                   /protein_id="BAJ73053.1"
FT                   /translation="MHCPFCRNPDSRVIDSRTSDDGLSIRRRRQCPKCGGRFSTVETAS
FT                   LNVIKRSGVVEPFSREKVMSGVRKACQGRPVTDADLAMLAQQVEEAIRQTGSSQIDANE
FT                   IGLSILGPLRELDEVAYLRFASVYQAFESLDDFDTAIAQLRADHAHRPLPASGAGDDVQ
FT                   "
FT   regulatory      complement(79195..79200)
FT                   /gene="nrdR"
FT                   /locus_tag="MTES_0089"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(79201..80502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisD"
FT                   /locus_tag="MTES_0090"
FT                   /product="histidinol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0090"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73054"
FT                   /db_xref="GOA:E8N834"
FT                   /db_xref="InterPro:IPR012131"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR022695"
FT                   /db_xref="UniProtKB/TrEMBL:E8N834"
FT                   /protein_id="BAJ73054.1"
FT                   /translation="MLRTIDLRGRVLSPAELLAVVPRADSARDEALIIAARIVDDVAVR
FT                   GEEALREQAAQFDHVTDHAIAVPASHLDEALDTLDPSVRSALEEAIARVRVASTAQVPA
FT                   PVVTEIGPGARVTQRWQPVRRVGLYVPGGKAVYPSSVVMNTVPAQVAGVREIALASPPQ
FT                   EEFGGRVHPAILAAARLLGVTEVYAMGGAGAIGAFASGVASLGLDPVDVVTGPGNNFVA
FT                   SAKRAVAGRVGTDSEAGATEILVVADGSADADLVAADLVSQAEHDEQASAVLVTDSPAL
FT                   ADAVRAALPARVAATRHSARVAAAFEGPQSAVVLVDDVAQATAFSNAYAPEHLELHLAD
FT                   PRPEDFVNAGAVFVGPYTPVSLGDYLAGSNHVLPTGGQSRYGAGLSAATFLRPQQVIEY
FT                   DREALRSVHDAIVTLAEAEALPAHGEAVTARFPE"
FT   regulatory      complement(80511..80516)
FT                   /gene="hisD"
FT                   /locus_tag="MTES_0090"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(80567..81976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0091"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0091"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73055"
FT                   /db_xref="GOA:E8N835"
FT                   /db_xref="UniProtKB/TrEMBL:E8N835"
FT                   /protein_id="BAJ73055.1"
FT                   /translation="MTDRIDDPVPPADSAADGPLASAASEDSGPRVARSTMMQPRGAET
FT                   DPRETGDIDVDHGDDGGAPVGPSEGQVSARSHVNTHGISLPSSASGSGSGTVSYGVGPF
FT                   SVREVALLGIWAVAFLVSFFPDNNVTGAARLLVGGSNVWVSGLWWIAAIALPTVAVGLL
FT                   VLRRLSPQGIRRVGSLGIDQFASVAFSIAAFIWVAWLWETVSIAIDTGGWVRSWVVWVE
FT                   AILMLAGVVLTVAAPFIPPFAADFAGREEVPAHRNARPVRPVVPRPAAPRSARRSPAPA
FT                   GSAVAPSIDAATSSHDGADVGAPGDYVRSTEGPRPGPTDPPTSVLTAVEHAPDPHASSD
FT                   HASANHASANHANANHASADQASADHANANQASADHAITDHANASDDHPTDVLTRLHDL
FT                   SAEPAHPAAQAFWALAPVEREVVDDYGTPIFRIGPSAWALVIEDRGETFVIRHDDGRIG
FT                   YLHDVSGVTRG"
FT   regulatory      complement(81982..81987)
FT                   /locus_tag="MTES_0091"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(82071..85535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaE"
FT                   /locus_tag="MTES_0092"
FT                   /product="DNA polymerase III, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0092"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73056"
FT                   /db_xref="GOA:E8N836"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004805"
FT                   /db_xref="InterPro:IPR011708"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR029460"
FT                   /db_xref="InterPro:IPR040982"
FT                   /db_xref="InterPro:IPR041931"
FT                   /db_xref="UniProtKB/TrEMBL:E8N836"
FT                   /protein_id="BAJ73056.1"
FT                   /translation="MLDGAARIGPMVQEAVKQGMPAIAVTDHGNTFAAYEFYKTAKDAG
FT                   IKPIIGIEAYVTPGTHRSDKTRVRWGSPEQQSDDVSGSGAYTHMTLLSETTEGMHNLFR
FT                   LSSKASMEGYYFKPRMDRELLQTYSRGLIATTGCPSGEVQTRLRLGQYEAARAAAAEFQ
FT                   DIFGKENYFAEIMDHGLSIERRVMSDLLKISKDLNIPLLGTNDLHYTHQHDATSHAALL
FT                   CVQSGSTLDDPKRFKFDGDGYYVKSPAEMRQVFRDNPEACDNTLLIAERCDVEFDTSAN
FT                   YMPRFPVPPGETEGSWMIKEVENGLQDRYPGGIPDAVRKQAEYETDVILQMGFPGYFLV
FT                   VADFINWAKNNGIRVGPGRGSGAGSMVAYAMKITDLDPLQHGLIFERFLNPDRVSMPDF
FT                   DVDFDDRRRGEVIQYVTEKYGDERVAQIVTYGTIKAKQALKDAGRVLGFPFSMGDKLTK
FT                   AMPPAVMGKDMPLDGMFNPEHPRYKEAGEFRTLIETDPEAKTVFDTALGLENLKRQWGV
FT                   HAAGVIMSSEPLIDIIPIMRREQDGQIVTQFDYPACESLGLIKMDFLGLRNLTIINDAL
FT                   DNIEANRGHPLVLEDLALDDAASYELLARGDTLGVFQLDGGPMRSLLRLMRPDNFEDIS
FT                   AVLALYRPGPMGVNSHINYALRKNKQQEIEPIHPELEEPLADILDTTYGLIVYQEQVMA
FT                   VAQRVAGYTLGQADLLRRAMGKKKKSELDKQKEIFFGGMTERGYGDVAQQTLWKVLESF
FT                   ADYAFNKAHTAAYGLVSYWTAYLKAHYPAEYMAALLTSVGDSKDKMAVYLNECRRMGIR
FT                   VLPPDVNESIRFFAAVGEDIRFGLGAVRNVGANVVDGIVAARQDAKYTSFHDFLAKVPM
FT                   HVANKRTVESLIKAGAFDTLGSTRRALLEIHEDACEGAVSDKRREANGEVGFDFDSLWD
FT                   EPQQVTKVPERPEWTKKDKLAFEREMLGLYVSDHPLAGLEVPLAKHASTSIHDLLSSED
FT                   VQDGDQVTVAGLLTSVQHRVAKQSGNPYGMVTVEDFNGEVTVMFMGKTYAEFAPILQGD
FT                   SILVVRGRVSRRDDGLNLHAQSAFAPDLEGMDAASGLTLVVPEQRANEALIGELAQTLQ
FT                   RHAGDTEVLLKLHKGGTAKVFEVPLPVRVTADLFGELKGLLGPNCLG"
FT   regulatory      complement(85542..85547)
FT                   /gene="dnaE"
FT                   /locus_tag="MTES_0092"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      85630..85635
FT                   /locus_tag="MTES_0093"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        85647..86189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0093"
FT                   /product="NTP pyrophosphohydrolase including oxidative
FT                   damage repair enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0093"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73057"
FT                   /db_xref="GOA:E8N837"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:E8N837"
FT                   /protein_id="BAJ73057.1"
FT                   /translation="MPRVAVRSPALSHRLGYGGRVPTPDFVLDLRRLVGTRPLPLVGVT
FT                   AVIERDGAVLLGRRSDNGRLTPITGIVDPGEEPADAAVREAAEEAGVRIRADRLAWVHQ
FT                   IPRVTYANGDQSDYLDLVFACRWLSGEPRPVDGEMTDLGWHPVEHLDDILDEEMLARVR
FT                   AGLTPGAARFEQAAERP"
FT   CDS_pept        complement(86196..87119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rlu"
FT                   /locus_tag="MTES_0094"
FT                   /product="pseudouridylate synthase, 23S RNA-specific"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0094"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73058"
FT                   /db_xref="GOA:E8N838"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:E8N838"
FT                   /protein_id="BAJ73058.1"
FT                   /translation="MESRHLPVPDGLDGTRVDQALAKMLGFSRTFAAEIADAGGVSVDG
FT                   RTVARSDRLRAGGWLSVEWEPKREPEIVPVEVADLGIVWDDDDIVVVDKPAGVAAHPSV
FT                   GWEGPTVLGALAAAGFRIATSGPAERRGVVHRLDAGTSGLMVVAKTERAYTLLKSAFKE
FT                   REVDKIYHAVVQGHPDPLSGTIDAPIGRHPHHSWKFAVVPDGKDSVTHYETLEAFPRAS
FT                   LLEIHLETGRTHQIRVHMAAHRHPCVGDPLYGADPTLSARLGLERQWLHAHRLAFTHPA
FT                   TGEWVGFESAYPADLAKALEILRDGL"
FT   CDS_pept        complement(87121..87708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0095"
FT                   /product="lipoprotein signal peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0095"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73059"
FT                   /db_xref="GOA:E8N839"
FT                   /db_xref="InterPro:IPR001872"
FT                   /db_xref="UniProtKB/TrEMBL:E8N839"
FT                   /protein_id="BAJ73059.1"
FT                   /translation="MRSRPPLRSAAASTLIAILAVVVLAADQLAKMIAIENLPPERVVP
FT                   VIGEALQLYLVRNPGAAFSLGEGVTWIFTIALAVVACVILFLAITRVRSRLWAVVLGLL
FT                   LGGVLGNLSDRLFREPGFPVGHVVDFISTPWMMPAIYNVADVFIVSMMISVALLVLFGL
FT                   RLDGTRETRASRAAEAATSGDSVDATTDPGSR"
FT   regulatory      complement(87717..87722)
FT                   /locus_tag="MTES_0095"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(87718..88338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0096"
FT                   /product="cell division initiation protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0096"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73060"
FT                   /db_xref="GOA:E8N840"
FT                   /db_xref="InterPro:IPR007793"
FT                   /db_xref="InterPro:IPR019933"
FT                   /db_xref="UniProtKB/TrEMBL:E8N840"
FT                   /protein_id="BAJ73060.1"
FT                   /translation="MALTPDDVVTKQFQHVRFKEGFDPDEVDDFLDEIVVEWRKTIAEN
FT                   DELKAKLAAYESGEAAPAAAAPVVEAPKEAAPVVAEAPAPVAEAPAAEVDAAPAAQSAG
FT                   IIELAQRLHDEHVAEGKAQRDQLISEAQAQAASIVAEAEQKGREERARLEKERVTLEGR
FT                   ITELRNFERDYRSQLRSYIEGQLRDLDTTASSSGSTPVSAIGL"
FT   regulatory      complement(88347..88352)
FT                   /locus_tag="MTES_0096"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(88460..88762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0097"
FT                   /product="predicted integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0097"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73061"
FT                   /db_xref="GOA:E8N841"
FT                   /db_xref="InterPro:IPR003425"
FT                   /db_xref="UniProtKB/TrEMBL:E8N841"
FT                   /protein_id="BAJ73061.1"
FT                   /translation="MAVLSLVGSILSALLFIYIVLLLARLVLEYIPMFNREWRPRGATL
FT                   VIAEIVYTVTDPPIKLIRRFIPPLRIGGIAFDFGFAITMFLCFLLLSVTRSLSTL"
FT   regulatory      complement(88768..88773)
FT                   /locus_tag="MTES_0097"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(88769..89239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0098"
FT                   /product="uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0098"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73062"
FT                   /db_xref="GOA:E8N842"
FT                   /db_xref="InterPro:IPR007561"
FT                   /db_xref="InterPro:IPR023052"
FT                   /db_xref="InterPro:IPR038594"
FT                   /db_xref="UniProtKB/TrEMBL:E8N842"
FT                   /protein_id="BAJ73062.1"
FT                   /translation="MSNPLKKTMVYLGLADEEETYEEPAQPAARKQQPQQTAPVEKAAP
FT                   VTPLHRPAVVRQPTAGPVSEILTVHPKQYRDAQTIAENFREGIPVIINLSQMSDADARR
FT                   LIDFASGLSLGLYGRIERVTSKVFLLSPENIAVSGDGAIAQADPEVAPFASQ"
FT   regulatory      complement(89247..89252)
FT                   /locus_tag="MTES_0098"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(89271..89954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0099"
FT                   /product="predicted enzyme with a TIM-barrel fold"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0099"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73063"
FT                   /db_xref="GOA:E8N843"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR011078"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:E8N843"
FT                   /protein_id="BAJ73063.1"
FT                   /translation="MSTALADRLADVDARIADAARSAGRDLSGITRIVVTKFHPVSLVR
FT                   ELRALGVRDVGENRQQELTAKRDELADVVDLHWHFIGQAQTNKARAVRAAADVVHSVDR
FT                   PRIADALDAAGSGDPLDVLLQVNLTDDAGRGGVAPRDVEALATHVAGLSTLRVRGVMAV
FT                   APLDEEPARAFERLRGSADAVRTVVPDATWISAGMTGDFPEAVAMGATHLRIGSAITGP
FT                   RPVRG"
FT   regulatory      complement(89959..89964)
FT                   /locus_tag="MTES_0099"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(90018..91205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsZ"
FT                   /locus_tag="MTES_0100"
FT                   /product="cell division GTPase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0100"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73064"
FT                   /db_xref="GOA:E8N844"
FT                   /db_xref="InterPro:IPR000158"
FT                   /db_xref="InterPro:IPR003008"
FT                   /db_xref="InterPro:IPR008280"
FT                   /db_xref="InterPro:IPR018316"
FT                   /db_xref="InterPro:IPR020805"
FT                   /db_xref="InterPro:IPR024757"
FT                   /db_xref="InterPro:IPR036525"
FT                   /db_xref="InterPro:IPR037103"
FT                   /db_xref="UniProtKB/TrEMBL:E8N844"
FT                   /protein_id="BAJ73064.1"
FT                   /translation="MSHNQNYLAVIKVVGVGGGGVNAVNRMIELGLRGVEFIAINTDAQ
FT                   ALLMSDADVKLDVGRELTRGLGAGADPEVGRRAAEDHAEEIEEALRGADMVFVTAGEGG
FT                   GTGTGGAPVVAKIAKSIGALTIGVVTKPFSFEGRRRQSQAEAGVGRLKEEVDTLIVVPN
FT                   DRLLEISDRGISMIEAFATADQVLLAGVQGITDLITTPGLINLDFADVKSVMQGAGSAL
FT                   MGIGSARGADRAIKAAELAVESPLLEASIEGAHGVLLSIQGGSNLGIFEINDAAQLVKE
FT                   AAHPEANIIFGTVIDDTLGDEVRVTVIAAGFDGGEPSLRIDAVGAQRAVSAPVVPVIPA
FT                   DDVARDLHAAEEQKASTERAPERKPEPAPVAAHVPESSYDGGFADDDLDVPDFLK"
FT   regulatory      complement(91213..91218)
FT                   /gene="ftsZ"
FT                   /locus_tag="MTES_0100"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(91357..92250)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0101"
FT                   /product="cell division septal protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0101"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73065"
FT                   /db_xref="GOA:E8N845"
FT                   /db_xref="InterPro:IPR005548"
FT                   /db_xref="InterPro:IPR013685"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="UniProtKB/TrEMBL:E8N845"
FT                   /protein_id="BAJ73065.1"
FT                   /translation="MSRPRVEPEAAPEGVTAPVVPLVAPPSRQEDELADATPPADENGT
FT                   GLRDVWRASRARRRALRAEVRRFTVRQRRRRRIWIGVGTALAVMILGTVGAAYSPLFAL
FT                   ERVDVVGTSQLDAAAVTDALSDQVGTPLALIDDSRIKAALVRFPLVESYTLEAQPPHDL
FT                   VVRIVERTPIGVVQTPAGFTVVDAAGVVLSTTPDAPAGQPVIDVPAGTTSEPFRAAGRV
FT                   MRALPDGIRSQVTAVSATTPDDVTLTLGATGTRVMWGSADRSPEKARVLDLLMQKSPPE
FT                   NTREYDVTSPEAGVIR"
FT   regulatory      complement(92257..92262)
FT                   /locus_tag="MTES_0101"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(92316..93722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murC"
FT                   /locus_tag="MTES_0102"
FT                   /product="UDP-N-acetylmuramate-alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0102"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73066"
FT                   /db_xref="GOA:E8N846"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005758"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:E8N846"
FT                   /protein_id="BAJ73066.1"
FT                   /translation="MIRPDLSLPIPETITSAHFIGVGGSGMSGLARMFLDRGIRVSGSD
FT                   RADSAALRDLAARGATVYVGHDAAHLGDADTVVHTGAIWPENPEFVTAKERGLHVIHRS
FT                   QALHWLIGGRRLVSVAGAHGKTTSTGMIVTALRALELDPTFVNGGVIADLGASSGTGSD
FT                   DLVVIEADESDGTFELYDTSVALITNVDPDHLDHYGSRDAFDAAFARFADAASEAVVIS
FT                   ADDAGARAVRERITHANVITFGEDPGADVRLSGIRTDGPVAFTLTADGESVEVQLRVPG
FT                   AHNAVNAAGAVAVLRVLGHSLADAARAVEGFGGTVRRFELHGVQHGVSVYDDYAHHPTE
FT                   VAAALSAARTVVGEGRIIAIQQPHTYSRTQEMYREFAEVLETHADHTVMLDVYGAREDP
FT                   VPGVTGELVSGAFADPEHVHYVPDWQAAADYTARIARPGDYVITLGCGNVYQIIPQVLE
FT                   ALSRTEAAAV"
FT   regulatory      complement(93734..93739)
FT                   /gene="murC"
FT                   /locus_tag="MTES_0102"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(93784..94857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0103"
FT                   /product="UDP-N-acetylglucosamine:LPS N-acetylglucosamine
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0103"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73067"
FT                   /db_xref="GOA:E8N847"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="InterPro:IPR006009"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/TrEMBL:E8N847"
FT                   /protein_id="BAJ73067.1"
FT                   /translation="MTTTLLAGGGTAGHVNPLLAVADGLRARDGSDEVLVLGTREGLEA
FT                   RLVPLRGYELLFVDKVPFPRRPNAAAARFPARFLRAVAQVRRIIRERGVDVVVGFGGYA
FT                   AAPAYVAARRERVPFVVHEANAKPGLANVLGARGAAGVGVAFEGTPLRGSRVVGMPLRR
FT                   EIVELDADALRAEAARHFGLDATRPTLLVFGGSLGALRLNTAFGDAWRDVLDAGWQLLH
FT                   VTGQNSDLPDPGASGYAVVRYVDRMDLAFALADLIVSRSGAATVSEISALGIPAVYVPY
FT                   AVGNGEQRLNAASAVRAGAARLIDDADFTADRVRDEIVPLLRDDASRTSMRSAAARTGT
FT                   RTGTENVIALIDAALAR"
FT   regulatory      complement(94866..94871)
FT                   /locus_tag="MTES_0103"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(94875..96110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0104"
FT                   /product="bacterial cell division membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0104"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73068"
FT                   /db_xref="GOA:E8N848"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR013437"
FT                   /db_xref="InterPro:IPR018365"
FT                   /db_xref="UniProtKB/TrEMBL:E8N848"
FT                   /protein_id="BAJ73068.1"
FT                   /translation="MRVTTTAPPPRQSPDEPSTPGLAARVSLGRAFRPVSIEFLLITSA
FT                   ALLLTGFGLMMVLSATSALDGAQSPFDHVLKQGVFAVVGIPLMFVLSRAPVRFWKRMAW
FT                   PALIFATVFQLLVFTPLGISANGNRNWINLAGIQAQPAEFLKLALALWLGYVLYRKQTL
FT                   LGDWRHVFIPIVPVFALVAATVMGGKDLGTTMILVLVLLGALFFSGMKLRIFVLPALGA
FT                   LAGIAVFAITSADRMRRIMSFLDQDCIANYLGDCYQPLHGIWGLAAGGIFGVGLGNSAE
FT                   KYDWLPAAANDYIFAIVGEELGLIGCVVVLALFGLFAVGAFHVIRRTDDPFVRIVAGGI
FT                   TIWIVGQAMVNVAVVLRVFPVLGVPLPFMSQGGTSLLSVLIACGVLLSFARTLPDRRVV
FT                   EPVARPRAARRR"
FT   regulatory      complement(96120..96125)
FT                   /locus_tag="MTES_0104"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(96121..97632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murD"
FT                   /locus_tag="MTES_0105"
FT                   /product="UDP-N-acetylmuramoylalanine-D-glutamate ligase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0105"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73069"
FT                   /db_xref="GOA:E8N849"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005762"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:E8N849"
FT                   /protein_id="BAJ73069.1"
FT                   /translation="MSDLSSLTSWYADWKGLRVAVLGLSVTGFSAADTLAELGAEVLVV
FT                   TEKADDEYARLLPVIGARLHVGPLAQPPAEMLDFAPEVVLASPGFSPSHPLIRWAVEQG
FT                   IPLWGDVELAWRVRDKVVRPDGSPADWILITGTNGKTTTTRLTAEMLVAGGLRAVPVGN
FT                   IGTPVLDAVRDPSGFDALVVELSSHQLWYLNRQNGPDALSPHASVCLNLADDHLEWHGS
FT                   ADAYRDAKAGVYARTRVACVYNKADVATREMVEEAEVEEGARAIGFDLGVPGPSDLGVV
FT                   DGILVDRAFLEERATSALELTTVADLAERGLAAPHVVANILAASALARSLGVAPADIHD
FT                   ALERFRLDPHRIQVVAAHAGITWVDDSKATNPHAAASSLAAYPGAVWVVGGLLKGVDLS
FT                   DLVRARGIRSRAAIIIGTERAEVVAAFERHAPEVPVFEVDHTETEDVMARVVELAAGLA
FT                   QDGDTVLLAPAAASFDQFASYSDRGDRFADAVRTWLANSEDGTNR"
FT   CDS_pept        complement(97629..98735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0106"
FT                   /product="UDP-N-acetylmuramyl pentapeptide
FT                   phosphotransferase/UDP-N-acetylglucosamine-1-phosphate
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0106"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73070"
FT                   /db_xref="GOA:E8N850"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR003524"
FT                   /db_xref="InterPro:IPR018480"
FT                   /db_xref="UniProtKB/TrEMBL:E8N850"
FT                   /protein_id="BAJ73070.1"
FT                   /translation="MRSLLTSAGISLAFTLFLTPVFLRSFRKWGWGQVIRTPENVHNPS
FT                   HGAKRGTPTMGGTIFILGTIIGYFIGSYAGNNPPTISGLLVLWLMLGFGVVGFIDDYMK
FT                   VRLQNSLGLSGWRKIAGQVIVTVPFAVVALNFPNAFGQTPASGYISIFRDIQVLSLFAL
FT                   GPIVGWLLYLAWISLIGTAASNSVNVADGLDGLAAGSGIFVIGAYSLMAFWQNKQMCAD
FT                   VLDPTVQAGCYAVRDPFDLAIVSASFVGALVGFLWWNAPKAKVFMGDCGSMAIGGVVAA
FT                   MAILTRTELLLILIAGVYVIASGSVILQRAYFKVTRGKRLFLMSPLHHHLEMRGWPEVT
FT                   IVVRMWIIAGLLAVSGVGFFYVEWLSRV"
FT   regulatory      complement(97644..97649)
FT                   /gene="murD"
FT                   /locus_tag="MTES_0105"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(98732..100144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murF"
FT                   /locus_tag="MTES_0107"
FT                   /product="UDP-N-acetylmuramyl pentapeptide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0107"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73071"
FT                   /db_xref="GOA:E8N851"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005863"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:E8N851"
FT                   /protein_id="BAJ73071.1"
FT                   /translation="MISTSLSHLADALGGRLVVRGDDTPDTLVAGLVDTDSRLIEPGDI
FT                   FVAKPGETTDGHLFVGTAVERGAALAIVERELDDPVSQIVVPDAVTALSDLARDVVARV
FT                   REHGRLRIVGITGSNGKTTTKNLLARILSDEGETVSPRASFNNEVGAPLTMLRVTEDTR
FT                   FLVSEFGASAPGAIAHLAGLVTPDVGVVLMVGMAHAGGFGGIESTFRAKSELVHATREG
FT                   GLAVLNVDDPRVAAMEPFARERGQDVRWFGRGERAAVRAVDVEVSASGTRADLLVDGEP
FT                   FTLTLRVLGEHHVMNALAALATATALGVPAAEAIARLETVEIAERWRMQPLGSDRVRII
FT                   NDAYNASPDSMAAALRTLAQITGPGERTVAVLGAMSELGEYADEEHDRVGLLAVRLRIQ
FT                   RIVVIGPEARRMYLEAIAQGSWDGEAVFFADADAAYDYLATELRDGDRVLVKSSNSAGL
FT                   RFLGDRLGELFA"
FT   regulatory      complement(98746..98751)
FT                   /locus_tag="MTES_0106"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(100158..100163)
FT                   /gene="murF"
FT                   /locus_tag="MTES_0107"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(100209..102005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0108"
FT                   /product="cell division protein FtsI/penicillin-binding
FT                   protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0108"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73072"
FT                   /db_xref="GOA:E8N852"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:E8N852"
FT                   /protein_id="BAJ73072.1"
FT                   /translation="MTSSLTRSPRRRTVVALGVVLVVLIAFVIRLVDIQVVNAREHVDD
FT                   SLAMGLQSSRTVYASRGSIVDENGVTLASSVNRYDVDIDPSLAVQGLTERTDDGGVKVT
FT                   QTWTQIAEQIAAITGQNASDVEKTVVDAHAADPTSQWASIAKNVSTEQYRALAALGLPF
FT                   LSFPPQAGRVYPDGAVAGNLIGFVGSDGEPLAGLESADNACLASTNGKVVFQQGRDGNV
FT                   LPGTEVETEPAVDGGTLKLTIDRDLQWYLSQLIAEQVQNTGSLRGTITVVEAKTGKIRA
FT                   LAEYPTVDPNDPSSSPVADRGSTAFGDPNEPGSTMKAITAAIGLDSGSFTADTTVTASG
FT                   SETLPGDARVSDSFSHGPNNYTLTGVLIDSSNVGISKFGDMIPLDTRVSYLEKFGLTQQ
FT                   TAVNFPGESSGIMRDPSQWDKQTFYNTTFGQGISVTVPQLAGAYQTIANGGVRMPLSLV
FT                   EGCTAADGTVTDVPDTQGTRVVSEDAAKRVSLMLENVATQGTLAKQVEIPGYRVAIKTG
FT                   TGEKTDPATGAYKGDAYFTTMIGFAPADDPQYVVEVNLDEPRTVKSSAATAPAFQKALT
FT                   QVLKTYRVIPSGTTTPELPKFG"
FT   CDS_pept        complement(102010..102651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0109"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0109"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73073"
FT                   /db_xref="GOA:E8N853"
FT                   /db_xref="UniProtKB/TrEMBL:E8N853"
FT                   /protein_id="BAJ73073.1"
FT                   /translation="MSASPAIDLRAVHTDVEPEFPIPVREPRRLQAVPAPERRRVPRRA
FT                   FGVIAVAGAVLIALVQMGLSILTTQSSFEISSLTQQQRDLTYQKQILYDDVAGLSSPQY
FT                   LAANAAALGMVIDESPTYLRLSDGSVVGSGKPAEGVSSVDALGRGSVRNALITGVPLAT
FT                   QPQTAAEPAATPPAGATDNAAGATPDAATPPAVSPTPPPISDGLPTPATR"
FT   regulatory      complement(102013..102018)
FT                   /locus_tag="MTES_0108"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(102648..103601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mraW"
FT                   /locus_tag="MTES_0110"
FT                   /product="predicted S-adenosylmethionine-dependent
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0110"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73074"
FT                   /db_xref="GOA:E8N854"
FT                   /db_xref="InterPro:IPR002903"
FT                   /db_xref="InterPro:IPR023397"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E8N854"
FT                   /protein_id="BAJ73074.1"
FT                   /translation="MDIRDIHTPVLLERCAELLAPALERPDAVFVDGTLGMGGHSEAFL
FT                   ERFPTARLIGLDRDTDALRIAGERLARFGDRVTLVHTVYDGIAEAVASAGVDKVDGILF
FT                   DLGVSSLQLDEASRGFAYAQDAPLDMRMDQTQGVTAAEVLATYGEGDLRRIFERYGEEK
FT                   LAGRYARAIIAARAEAPLERSGQLVDVLQAATPAAVLRERHPAKRVFQALRIEVNAELS
FT                   VLERTIPAALKVLGVGGRIVVLSYQSLEDRLVKRVFAEAAASTAPRGLPVELPEHAPKF
FT                   RLLVRGAELASDEERAANPRATPVRLRAAERTKEDA"
FT   regulatory      complement(102657..102662)
FT                   /locus_tag="MTES_0109"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(103614..103619)
FT                   /gene="mraW"
FT                   /locus_tag="MTES_0110"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(103701..104132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0111"
FT                   /product="uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0111"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73075"
FT                   /db_xref="GOA:E8N855"
FT                   /db_xref="InterPro:IPR003444"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR020603"
FT                   /db_xref="InterPro:IPR035642"
FT                   /db_xref="InterPro:IPR035644"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR038619"
FT                   /db_xref="UniProtKB/TrEMBL:E8N855"
FT                   /protein_id="BAJ73075.1"
FT                   /translation="MLLGTHTPKLDDKGRVILPAKFRDDLGAGVVITRGQDRCLYVFST
FT                   EEFERVHERIREAPLSNKQARDFLRMFLSGASAEKPDSQNRITVPPALRTYAGLGRELV
FT                   VTGVGAHAEIWDAEAWNTYAESNEETYAEMEQEVIPGLF"
FT   regulatory      complement(104145..104150)
FT                   /locus_tag="MTES_0111"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(104445..104828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0112"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0112"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73076"
FT                   /db_xref="GOA:E8N856"
FT                   /db_xref="InterPro:IPR021401"
FT                   /db_xref="UniProtKB/TrEMBL:E8N856"
FT                   /protein_id="BAJ73076.1"
FT                   /translation="MPLSEQEQRLLDEMERHLMSHDADVVTAPSRALSYRNIVYGSILV
FT                   LAGLGALVAGVSIGFNTGFLGIAVGVLGFLFMVTGVVLAVTPLKGSARASATSPSAARA
FT                   PRASGASFMDRMNDRWDRRNEER"
FT   regulatory      complement(104837..104842)
FT                   /locus_tag="MTES_0112"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      104879..104884
FT                   /locus_tag="MTES_0113"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        104893..105984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0113"
FT                   /product="geranylgeranyl pyrophosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0113"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73077"
FT                   /db_xref="GOA:E8N857"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:E8N857"
FT                   /protein_id="BAJ73077.1"
FT                   /translation="MVTSPEPIEAVSQRLDKFLSDQLSYASSLGPEAETMSRAGAASLR
FT                   GGKRLRARFCLTGWRAVAESTAARTVAPAAAAISVAAALEIFQAAALVHDDIIDNSDTR
FT                   RGQPAAHRALEAAHAAAHWAGDAAMFGRSGAVLLGDLLVAWSDDLLEDALADQPTASAT
FT                   RRLYAHMRRDVTIGQFLDVAEESAYAVYPDDQHAERALRVASYKSARYSIQKPLEIGAA
FT                   LAGADDDQLDALARFGHDVGMAFQLRDDVLGVFGDTAATGKPVGDDLREGKRTVLVAFA
FT                   REALPASTRRTVDELLGDPDLDATQIGALQNTIIDTGALARTEELIADYSRRADRALSG
FT                   ARLGNAAVGELRDLAHAATQRSS"
FT   CDS_pept        complement(106055..106399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0114"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0114"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73078"
FT                   /db_xref="InterPro:IPR041098"
FT                   /db_xref="UniProtKB/TrEMBL:E8N858"
FT                   /protein_id="BAJ73078.1"
FT                   /translation="MSETPRYETAWLTIPDLVEILGEPHGRVRRLLDEHYLVGSRRDGV
FT                   LRIPAVFIVDGRPLPALRGTIIVLHDVGFDEDETIDWLLTPEDSIGVAPIEALLAGRKS
FT                   EVRRVAATLA"
FT   regulatory      complement(106407..106412)
FT                   /locus_tag="MTES_0114"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      106520..106525
FT                   /locus_tag="MTES_0115"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        106537..107520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0115"
FT                   /product="FOG: LysM repeat"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0115"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73079"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:E8N859"
FT                   /protein_id="BAJ73079.1"
FT                   /translation="MRRLPSPVLPSLPRSSVILPAAVVGTIALALTGESSAHAAPPAPP
FT                   LTALPPAPASLAQIPVMQAAAAVPATHTVEPGDTVWGIAQRYGLDVGALQAANGLAGDS
FT                   IIRPGQVLSLGVAMPAPAAPAPEVAPVGYEVTAGDTVSAIAAAHGVSTDAVLAANGLTR
FT                   DSIIYPGEVLQIPSAAAPGPASVDPVLAPGLDAEQSENARLIIRVGRELGVSDRGILIA
FT                   LGTAMQESWLRNLDWGDRDSLGLFQQRPSTGWGTPDQILDRERSTRVFYGGPADPNGSD
FT                   TRGLLDIPGWENLPYADAAQAVQISAYPDRYAQWEQPATTWLAVLG"
FT   regulatory      107559..107564
FT                   /locus_tag="MTES_0116"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        107575..109524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0116"
FT                   /product="serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0116"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73080"
FT                   /db_xref="GOA:E8N860"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:E8N860"
FT                   /protein_id="BAJ73080.1"
FT                   /translation="MSTSQQADPLIGRLVDGRYRVRARIARGGMATVYVATDLRLERRV
FT                   ALKVMHGHLSDDTVFQSRFIQEARSAARLSDPHVVNVFDQGQDGEMAYLVMEYLPGITL
FT                   RELLREHKRLTVDQTLTIMDAILSGLAAAHRAGIVHRDVKPENVLLAEDGRIKIGDFGL
FT                   ARATTANTASGAQLMGTIAYLAPELVTRGTADARSDIYSLGIMLYEMLTGEQPYKGEQP
FT                   MQIAYQHATDSVPRPSAKNPSVPEQLDELVLWSTEREPDDRPLDAGAMLQRLREVEKEL
FT                   GLAPQVARAVSVGTVGPASPAESRELTKVLPQTATIPDAPTEDVDNATRLRAKTRRRTA
FT                   RGVWLLLLVLVLAGGSAATGWWFGSGPGSLVEVPDVSQRSFADAESLLTQNQLRAQSQD
FT                   VNDREIPAGTTVGSDPVAGSRLDKETVVTVFVSAGPATHQLPELQGKSVEEVRGILEAA
FT                   FVGVGDVAQEFTDAGPDTVLSASITPRSGGDAIDCTGGCTVYEGDAATLTASLGPVPDV
FT                   AGLKTADAESKLQAANLKTTTSEEYSNSVASGTVIAIGDRDGGGNWRPGDTVTLRVSIG
FT                   PKPVMIPENIVGMSIRDAVTALENLGFEVNAGIDDGTLPLGFKYWDIYKVRSSNPKAGT
FT                   TAPQGSTITLTPTL"
FT   CDS_pept        complement(109739..111076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroH"
FT                   /locus_tag="MTES_0117"
FT                   /product="3-deoxy-D-arabino-heptulosonate 7-phosphate
FT                   (DAHP) synthase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0117"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73081"
FT                   /db_xref="GOA:E8N861"
FT                   /db_xref="InterPro:IPR002480"
FT                   /db_xref="UniProtKB/TrEMBL:E8N861"
FT                   /protein_id="BAJ73081.1"
FT                   /translation="MNQQLHDLDHWRSLPIKQQPQWYDEGAVAAASAELATLPPLVFAG
FT                   EVDILRDRLARAAAGQAFLLQGGDCAETFAGATAEQIRNRIKTVLQMAVVLTYGASMPV
FT                   VKMGRMAGQFAKPRSSDVETRGGVTLPAYRGDIVNGYDFTEESRKADPARLLKGYHTAA
FT                   STLNLIRAFTQGGFADLREVHSWNKGFASTPANQAYEAMATEIDRAIKFMEAAGADFDE
FT                   LTRVEFYTGHEGLLMDYERPMTRIDSRTGLPYNTSSHFQWIGERTRELDGAHVDYFSKI
FT                   RNPIGVKLGPTTTAETALALIDKLDPEREPGRLTFITRMGAGKIRDALPPLLEAVRDSG
FT                   ATPLWVTDPMHGNGITTPTGYKTRRFDDVVDEVRGFFEAHRAVGTHPGGIHVELTGDDV
FT                   TECLGGAEQIDEATLATRYESLCDPRLNHRQSLELAFLVAEELEKR"
FT   regulatory      complement(111085..111090)
FT                   /gene="aroH"
FT                   /locus_tag="MTES_0117"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(111086..111799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plsC"
FT                   /locus_tag="MTES_0118"
FT                   /product="1-acyl-sn-glycerol-3-phosphate acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0118"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73082"
FT                   /db_xref="GOA:E8N862"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:E8N862"
FT                   /protein_id="BAJ73082.1"
FT                   /translation="MFYWLMKYVVIGPVIKAVFRPWLVGRRNIPREGAAILASNHLSFS
FT                   DSIFLPLMIDRRMAFLAKSDYFTGKGLKGWATRLFFTATGQLPIDRSGGKASEASLNTG
FT                   LGVLGRGELLGIYPEGTRSPDGTLYRGRTGIARMAIEARVPVIPVVMVDTGAVMPIGQR
FT                   LPRVGRVGIVVGEPLDFSRFEGMEGDRYILRSVTDEIMVALQRLGEQRYEDVYASTVKD
FT                   RLATSQAAKAPSSRH"
FT   CDS_pept        complement(111802..112737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0119"
FT                   /product="transcriptional regulator/sugar kinase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0119"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73083"
FT                   /db_xref="GOA:E8N863"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR004654"
FT                   /db_xref="UniProtKB/TrEMBL:E8N863"
FT                   /protein_id="BAJ73083.1"
FT                   /translation="MQNVGIDIGGTKIAGGVVAEDGTIVEKLRVDTPIDPSALVDAVVD
FT                   MADHLRRTHEIHAIGVAAAGFISSDRSTVIYAPNIDWRNEPLRARLEDRLHAPVTIEND
FT                   ANAAGWGEYRFGAGQGVRDMVMLTMGTGVGGAVVTDGELFRGGHGIGAELGHMRFVRGG
FT                   HPCGCGQNGCLEQYASGRALQREANAIADEGGIGAALAAVRDEKGAIPGPAVSRLVLAG
FT                   DPGAVEALRRVATALGEACGGFQAVLDPELFVIGGGVAQLGADLLVPVKLAYETSLPGY
FT                   GERPVAEFTIARLGNDAGLIGVADLAGKER"
FT   regulatory      complement(111808..111813)
FT                   /gene="plsC"
FT                   /locus_tag="MTES_0118"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(112743..112748)
FT                   /locus_tag="MTES_0119"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      112882..112887
FT                   /gene="fadD"
FT                   /locus_tag="MTES_0120"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        112893..114719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fadD"
FT                   /locus_tag="MTES_0120"
FT                   /product="long-chain acyl-CoA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0120"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73084"
FT                   /db_xref="GOA:E8N864"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:E8N864"
FT                   /protein_id="BAJ73084.1"
FT                   /translation="MIQFDLPPIVEADPDANTSDLLADRVRATPDRPLFAVPDADGWRD
FT                   ITAAEFERQVIALAKGFVAAGVQPGEKVAFIARTTYDWTLVDFALFYAGAIMVPVYETS
FT                   SPSQISWILSDSGAIAVVLESPEHADRLDEVRSDLPLVREVWPMHSGALDALVANGTHI
FT                   TDEEIERRRHLAKASDVATLIYTSGSTGRPKGCVLVHSNFVELARNSAKALHEVVETPG
FT                   ASTLLFITTAHVFARFISLLNVHAGVKTGHQPDTKQLLPALGSFKPTFLLAVPRVFEKV
FT                   YNSAEQKAEAGGKGKIFRAAAEAAIEHSQRLQDGKSIPLLLKIKFALFDKLVYSKLRDA
FT                   MGGRVVYAVSGSAPLGPRLGHFFRSLGVVILEGYGLTETTAPATVNLATKSKIGTVGPV
FT                   LPGVGIRLAEDGEIQVRGVNVFREYWQNPEATAEAFDGEWFKTGDIGAFDSDGFLAITG
FT                   RKKEIIVTAGGKNVAPAALEDPIRANPIVGQVVVVGDHKPFISALVTLDPEMLPTWLAN
FT                   NGLPADMSLADAATNEKVRAEVQGAIDRANTRVSRAESIRKFTILPTEWTEASGHLTPK
FT                   MSIKRNVIVKDYADAIEDIYAVPINTTNVSLP"
FT   CDS_pept        complement(114865..115356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0121"
FT                   /product="N-formylmethionyl-tRNA deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0121"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73085"
FT                   /db_xref="GOA:E8N865"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/TrEMBL:E8N865"
FT                   /protein_id="BAJ73085.1"
FT                   /translation="MTVRPIRLFGDPVLRAPSAPIETIDDGIHALVRDLLDTVEPPGRA
FT                   GVAAPQIGVGLRAFSYNIDGDIGYVLNPVLVETRGEPQLVGEGCLSVPGLWHEATRYPW
FT                   AKVVGIDLDGNEVVLEGEGLLAQALQHETDHLDGMLYLSRLPADTRREAMRQIRESDWF
FT                   "
FT   CDS_pept        complement(115353..118016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0122"
FT                   /product="ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0122"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73086"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E8N866"
FT                   /protein_id="BAJ73086.1"
FT                   /translation="MTPDRIDANPDENAEHGVLDESGNLDTASITILGGHIAQVSVDLP
FT                   VTSHDDDIDDDVVEDEVPVDEAEIRSFETIGQPFTLDGGNGAPSLTYVPEPQTDPQPTV
FT                   HDDVHVEHLPTGDIILEPHDDVESDAEPHDELEVHDAEIVGEHEHEHGSEPVHELGDVQ
FT                   ELGDEGGDEREREDAVEVSSREELIVAGFGEDRIEPQIVLSTDGFDPEPIPQFVLSTDV
FT                   FEPEDGDDEQVEDAPEDDERLESERAAAERAHDDHAEDVPAHDERVAEAQDAEPADVEP
FT                   AEVEPADAEPADAEPAEVEPADTAPADVEVAEAESADEEFAERDVDEPQRAEDDLAEEQ
FT                   PAGHESVGQEFAEDETAAHEPRGHDDVVPESPEPPVAEDAAAEVETEEREQDGADMSDA
FT                   ASHELEPSGGEPGAVDETTPVSELQGAETEATGAEPVDDEPEEDAPAPEAAPADTGAAT
FT                   APAAATTGAVPTDAAPTDAAPTGAVPTTTGTVPTTTGAVPTATGAVATTTGSIPRTRAE
FT                   RAATGAIGTVPLTRREVHQADEAARVGRAHATERVRTPGPDLTLTSKRSSAIDDARESP
FT                   DLLTADRLLDPRQVARPEPEGLWQQLVYSMSGHRINLGDGRRARQRKELDRRIAAPLSG
FT                   GARFVPVLSRKGGVGKTTVTSLLGMALADARDDRVIAVDANPDRGTLADRVGRPNGRTV
FT                   RDLVRAHDEVDGYHDVSSIVARDATRLDVLASDSDPRVSEAFSDDDYRQVADVAAHYYS
FT                   IVLTDTGTGIVHSVMEATLERADSLVVVAGLSVDEARLASETLTWLETNGYADRVRSAV
FT                   VVINSARPGTPLVRESELEAHFRTRVQTVIRMPYDPRIAAGSAISFRDLQPETRLAARQ
FT                   LAAAVVEGLRAPVAAA"
FT   regulatory      complement(115363..115368)
FT                   /locus_tag="MTES_0121"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(118024..118029)
FT                   /locus_tag="MTES_0122"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(118063..121470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pycA"
FT                   /locus_tag="MTES_0123"
FT                   /product="pyruvate carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0123"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73087"
FT                   /db_xref="GOA:E8N867"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR003379"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR005930"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:E8N867"
FT                   /protein_id="BAJ73087.1"
FT                   /translation="MFSKILVANRGEIAIRAFRAAYEVGARTVAVYPYEDRSSLHRLKA
FT                   DEAYQIGERGHPVRAYLDVDEIIRVARECGADAIYPGYGFLSENPELAEKAAANGITFI
FT                   GPPAEVLSMAGNKVTAKEHAIAAGVPVLRSTPASDDIDALLAQAEEIGFPLFAKAVAGG
FT                   GGRGMRRVESLGELAPALAEAMREAQSAFGDPRMFLEQAVQRPRHVEVQILADATGETV
FT                   HLFERDCSVQRRHQKVIEIAPAPNLDDAVRQDLHRYAVAFARSIGYQNAGTVEFLLETA
FT                   GPRAGEVVFIEMNPRIQVEHTVTEEVTDVDLVQSQMRIAAGQTLADLHLQQDDIHLRGA
FT                   ALQCRITTEDPTQGFRPDTGKITTYRSPGGAGIRLDGGTTAAGSQVSPHFDSMLSKLSC
FT                   RGRDFPAAVARARRALAEFRIRGVSTNIPFLQAVLDDPAFVAGDLSTSFIDERPELLKG
FT                   RESKDRGTKILSWLVDTTVNRPNGENPLSVDPGAKLPALDLVAPAPAGSRQLLRELGPA
FT                   GFVKALREQTALAVTETTFRDAHQSLLATRVRTRDLVRVAPYVARMTPGLLSVEAWGGA
FT                   TYDVALRFLGEDPWERLDALREALPNVAIQMLLRGRNTVGYTPYPTEVTDAFVAEAAAS
FT                   GVDIFRIFDALNDVAQMRPAIDAVLSSGTAVAEVALCYTGDLLDPAENLYTLDYYLGLA
FT                   EQIVDAGAHVLAIKDMAGLLRPAAAAKLVTALRDRFDLPVHVHTHDTAGGQLATLLAAS
FT                   AAGADAVDAAAAPMAGTTSQPSLSALVAALAHTERDTGLDLAAVSDLEPYWEAVRHLYR
FT                   PFESGLAGPTGRVYRHEIPGGQLSNLRQQAIALGLADDFELIEDMYAAADRILGRVPKV
FT                   TPSSKVVGDLALHLAAVKADPADFEQNPEKYDVPDSVVSFMAGELGDLPGGWPEPFRSK
FT                   VLAGRDAKIGVTPLSDDDTTALAGESAERRARLNRLLFPGPTRTFEETREAYGDLSVLD
FT                   TADYLYGLRAGGEHTVEIERGVQLFVGLEAVGEADDKGMRTVMTTLNGQLRPVFVRDRS
FT                   IDVEARQAEKADTSKPGQVAAPFSGVVTLKVAPGDRVTAGQAVASIEAMKMEAGIASQI
FT                   DGVVERVAIVTTQQVEAGDLLLVIRPAQ"
FT   regulatory      complement(121475..121480)
FT                   /gene="pycA"
FT                   /locus_tag="MTES_0123"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      121526..121531
FT                   /gene="parA"
FT                   /locus_tag="MTES_0124"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        121539..122351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="parA"
FT                   /locus_tag="MTES_0124"
FT                   /product="ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0124"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73088"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E8N868"
FT                   /protein_id="BAJ73088.1"
FT                   /translation="MHVLSVSSLKGGVGKTTVTLGLASAAFARGVRTLVVDLDPQSDVS
FT                   TGMDISVAGRLNIADVLANPKEKVVRQAITTSGWAKVHPGTIDVLIGSPSAINFDGPHP
FT                   SVRDVWKLEEALATIESEYDLVLIDCAPSLNALTRTAWAASDRVIVVTEPGLFSVAAAD
FT                   RALRAIEEIRRGLSPRLQPLGVVVNRVRPQSIEHQFRIKELRDMFGPLVLNPQLPERTS
FT                   LQQAQGAAKPLHVWPGDSAQELAADFDALLDRIVRTGRIPVENDAPSA"
FT   CDS_pept        complement(122671..123216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0125"
FT                   /product="predicted transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0125"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73089"
FT                   /db_xref="GOA:E8N869"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:E8N869"
FT                   /protein_id="BAJ73089.1"
FT                   /translation="MTAGDTVGEPRFATELLFTDGLPEMDDDTGYRGAVAARAAGITYR
FT                   QLDYWARTELVVPTVRGASGSGSQRLYGFRDILVLKLVKRLLDTGISLQQIRTAVDQLR
FT                   AAGIRDLAGTTLMSDGASVYLCTSNDEVIDLVSRGQGVFGIAVGKVLREVESTLVDFEA
FT                   ASADTVDELAARRAARTA"
FT   regulatory      complement(123226..123231)
FT                   /locus_tag="MTES_0125"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(123313..123999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0126"
FT                   /product="predicted transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0126"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73090"
FT                   /db_xref="GOA:E8N870"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:E8N870"
FT                   /protein_id="BAJ73090.1"
FT                   /translation="MGAAPARGRPAASGLLSIGQVLARLTPDFPALTSSKLRFLEVQGI
FT                   VSPTRTESGYRKFSAADLERLRMALTLQRDHYLPLAVIREYLADVDAGRNPAPPTSMPS
FT                   MTATPRRYRRDELLSTTGAGPQLLNDAISTGVITPAETYPEQTVSLLRTLVALDRHGIE
FT                   PRHVRSLRQSAEREAALIESALSALLRRPDAASRARASELAPELAARLDEVRTLFVRDA
FT                   IDRMLS"
FT   CDS_pept        complement(123999..124493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0127"
FT                   /product="FOG: FHA domain"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0127"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73091"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR032030"
FT                   /db_xref="UniProtKB/TrEMBL:E8N871"
FT                   /protein_id="BAJ73091.1"
FT                   /translation="MDETRRFERDDIHRAADVPASERSHDTTQTFGHDADLSFVPFGAD
FT                   LNEAELEAIDALPSRVALLIVRSGPTTGARYLLDTDVTTVGRHPEADIFFDDVTVSRRH
FT                   AEIIRSGTSFEIVDQRSLNGSYVNGERVDRSVLANGAEVRIGKFRLNFFVSPVDLPPAE
FT                   H"
FT   regulatory      complement(124003..124008)
FT                   /locus_tag="MTES_0126"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(124500..124505)
FT                   /locus_tag="MTES_0127"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      124861..124866
FT                   /locus_tag="MTES_0128"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        124875..125522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0128"
FT                   /product="uncharacterized protein, homolog of Cu resistance
FT                   protein CopC"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0128"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73092"
FT                   /db_xref="GOA:E8N872"
FT                   /db_xref="InterPro:IPR007348"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR032694"
FT                   /db_xref="UniProtKB/TrEMBL:E8N872"
FT                   /protein_id="BAJ73092.1"
FT                   /translation="MTSSAPRRSLSTVLASLVLAVVALFVLPAAPAFAHDELVSTDPAA
FT                   DAVLDALPGQITFTYSADILTEEGTAVVEVTDADGASLTEGAPVVSGTDVTQTLAGAAS
FT                   GPVTVVWRVVSSDGHPIDGTFSFTVNAASPTPTATTATPTAAPTPSETALPTTATPDAT
FT                   ATPSETVSTASPLPWILLVVALVIVAGAIVWLFVARGRRGSSGGGSAGTSGR"
FT   regulatory      125519..125524
FT                   /locus_tag="MTES_0129"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        125532..126929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0129"
FT                   /product="pyruvate/2-oxoglutarate dehydrogenase complex,
FT                   dihydrolipoamide dehydrogenase (E3) component"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0129"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73093"
FT                   /db_xref="GOA:E8N873"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006258"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E8N873"
FT                   /protein_id="BAJ73093.1"
FT                   /translation="MPHYDLVILGAGPGGYVAAVRGAQLGLSVAIVEEKYWGGVCLNVG
FT                   CIPSKALLRNADLAHTFHAKADLFGISGDVHFDFGKAFDRSRSVAAGHVKGIHYLMKKN
FT                   KVTEYEGRGFFADDHTLDVTLTDGSKEKVTFDNVIIATGSTVRLLPGVTLSENVVTYEE
FT                   QILNRELPASIVIVGAGAIGMEFAYVMTNYGVKVTIIEFLDRALPNEDAEVSKEIQKQY
FT                   KGYGVDILTSTKVESVTDHGDKVTVAYTAKDGSQGSIDADRVLMSIGFAPKVEGFGLEN
FT                   TGVKLTERGAIEIDDHMRTNVPHIYSIGDVTAKLQLAHVAEAQGVVAAETIAGAETQTL
FT                   GDYRNMPRATFCNPQVASFGLTEQQARDAGHDIKVAKFPFSANGKANGLGEPVGFVKLV
FT                   ADAETLELIGGHLIGPDVSELLPELTLAQKWDLTALEAARNVHTHPTLSEGLQEAFHGL
FT                   TGHMINL"
FT   CDS_pept        complement(127003..127647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0130"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73094"
FT                   /db_xref="InterPro:IPR023577"
FT                   /db_xref="InterPro:IPR033469"
FT                   /db_xref="UniProtKB/TrEMBL:E8N874"
FT                   /protein_id="BAJ73094.1"
FT                   /translation="MSAGSSGAYSVEVESKYDVDETTPLPDWSALPGVVRVGEPEPRDL
FT                   DARYLDTPAADLARAGVAVRRRLGGPDAGWHVKGPARAGGRTETQWPLEADVDPDAEPV
FT                   VPPAVQDAVASIAEPPFTPLARVRNERTAYALLDADGREVAEFVDDHVRARDERRGVES
FT                   SWREWEVELGPAGPADDEGRAAFFAAVDAAVFAAGGRPAASGSKLARALGH"
FT   CDS_pept        complement(127644..127910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0131"
FT                   /product="response regulator consisting of a CheY-like
FT                   receiver domain and a winged-helix DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0131"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73095"
FT                   /db_xref="GOA:E8N875"
FT                   /db_xref="UniProtKB/TrEMBL:E8N875"
FT                   /protein_id="BAJ73095.1"
FT                   /translation="MPGGVGGAVYAGGMAIARLTGGPLDGQVLPLENESDDTLIMPYSE
FT                   GQLVYRREGGLEHTGDSDGPTQAVFTFVEETEDINPDADGRDD"
FT   regulatory      complement(127655..127660)
FT                   /locus_tag="MTES_0130"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(127920..127925)
FT                   /locus_tag="MTES_0131"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      127927..127932
FT                   /locus_tag="MTES_0132"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        127940..128695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0132"
FT                   /product="GMP synthase-Glutamine amidotransferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0132"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73096"
FT                   /db_xref="GOA:E8N876"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:E8N876"
FT                   /protein_id="BAJ73096.1"
FT                   /translation="MTSTDLPGERPFVLLATRAEDRPADEEYALFLRYTGLPPERLLRV
FT                   RLERDALPDLDLDAISGILVGGSPFNASDPPEKKSAVQHRVESEMSALLEDVVARDVPF
FT                   LGACYGVGTLGTYLDAEIDGTYSEPISVVDVTLTAAGRDDPLAAGMPETFTAFVGHKEA
FT                   ITTLPSRATLLASSPTCPVQMFRVGENVYATQFHPELDVDGIVTRIHAYAAFGYFAADE
FT                   LDLTLAAVRRAPVEAPSRMLRTFVERYAR"
FT   CDS_pept        complement(128683..129453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0133"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0133"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73097"
FT                   /db_xref="GOA:E8N877"
FT                   /db_xref="InterPro:IPR004443"
FT                   /db_xref="InterPro:IPR036652"
FT                   /db_xref="UniProtKB/Swiss-Prot:E8N877"
FT                   /protein_id="BAJ73097.1"
FT                   /translation="MADPRRDPAAESKDRPSTERVAAYTADAVRAAEAPLLAEGRPLMR
FT                   TAARALADIAAAEVRTTPGAVLVLAGAGDNGGDALFAAADLASSAERVDVVLVRDRVHR
FT                   EALDAAVAAGARVVSVSDASAGVADYALVLDGILGIGRLADRRLRGSARALVERLLALA
FT                   HRPRVLAVDVPSGLDPDDGTADAVILPADVTVTFGALKAGLVRGRGPELSGRVHLVDLG
FT                   LEPYLRRAHPAVTAAIDVVRETPRAAETDRAQRA"
FT   CDS_pept        complement(129446..130510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0134"
FT                   /product="predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0134"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73098"
FT                   /db_xref="GOA:E8N878"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="UniProtKB/TrEMBL:E8N878"
FT                   /protein_id="BAJ73098.1"
FT                   /translation="MADLIRRVTAWALSLRLVRAFLVYSGARGPILADSVTYRTLFSLF
FT                   AAVLIGFSAAAVWLSGNPEGLAALERSVNNVVPGLVGTDGLLDVSAIKAPTEFTIAGVI
FT                   GTIGLLGAAIGAIGSLRAALRQIAGVTTDDTLPVLVIVRNLAVAVGIGVALVGAALVTF
FT                   LATAGLTFVRGLLGISADSWVTAVLTWALSTIVVLVLDTAAVAVAFAALSGVKTRRRTL
FT                   WRGALLGGVGLVVLQQLSGLFVGGAGNNPLLTTFASLIALLLWLNLSSQVILIAGAWIT
FT                   VATEEDHDRVRAKYGATTLIQFRVRRAEKAVQAAASELDAAREAEAKERETLAQNDPAA
FT                   AAREADADEAASRG"
FT   regulatory      complement(129463..129468)
FT                   /locus_tag="MTES_0133"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(130519..130524)
FT                   /locus_tag="MTES_0134"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(130574..131032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0135"
FT                   /product="type II secretory pathway, prepilin signal
FT                   peptidase PulO"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0135"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73099"
FT                   /db_xref="GOA:E8N879"
FT                   /db_xref="InterPro:IPR000045"
FT                   /db_xref="UniProtKB/TrEMBL:E8N879"
FT                   /protein_id="BAJ73099.1"
FT                   /translation="MPWPPVPALSAFAVLSGVLAVVDARTRRLPDAIVLPGGAVVVLLL
FT                   GAAALAAGEPARFAGVGSGALSAFAACLAVRLARPGAFGGGDVKLAAVCGAVLGWGGLG
FT                   AVASGIVLAFLAAGIGAAGVLLAGRRGASIAFGPFLLFGAWWRVITGL"
FT   CDS_pept        complement(131041..131337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0136"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0136"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73100"
FT                   /db_xref="InterPro:IPR015018"
FT                   /db_xref="InterPro:IPR037079"
FT                   /db_xref="UniProtKB/TrEMBL:E8N880"
FT                   /protein_id="BAJ73100.1"
FT                   /translation="MIVRFEGEVYRWEARTDSDWYFVALPPDLSEEIRETQTYRRGFGG
FT                   VRVDATIGSSTWRTSIFPQSGGVYVLPLKRAVRDAEGIAPDGVVLVDLLVLDA"
FT   regulatory      complement(131345..131350)
FT                   /locus_tag="MTES_0136"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(131365..131787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0137"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0137"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73101"
FT                   /db_xref="GOA:E8N881"
FT                   /db_xref="InterPro:IPR021257"
FT                   /db_xref="UniProtKB/TrEMBL:E8N881"
FT                   /protein_id="BAJ73101.1"
FT                   /translation="MTRAHRRPAAAVALAGVVILGLTVARGLPASDATDIAGDALYAVA
FT                   AYTGLVLVWPRARRAVLGMVAAAWCVGVEFLQLTGMPLALADRFPPAALVLGSGFDPRD
FT                   LAVYVLAVAAAAAVDAGVSALLLHGGERPARVGGPE"
FT   CDS_pept        complement(131784..132350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0138"
FT                   /product="G:T/U mismatch-specific DNA glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0138"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73102"
FT                   /db_xref="GOA:E8N882"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR015637"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:E8N882"
FT                   /protein_id="BAJ73102.1"
FT                   /translation="MGYTRAELESFRDATIPDLVEPGVRLLFVGINPGLWTAATGTPFS
FT                   RPGNRFWPALVQAGILPRLPVYAEPLSDADRRMILDAGIGVSNLVSRATARADELSREE
FT                   LRAGAAALTGRAASWRPRAIAVVGLTAYRDGFQRPKAVAGRQDEGIAGLPTWVLPNPSG
FT                   LNAHDTVATLARAYAEPARAAGVLG"
FT   regulatory      complement(131794..131799)
FT                   /locus_tag="MTES_0137"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(132354..132359)
FT                   /locus_tag="MTES_0138"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      132399..132404
FT                   /locus_tag="MTES_0139"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        132408..133205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0139"
FT                   /product="predicted hydrolase or acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0139"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73103"
FT                   /db_xref="GOA:E8N883"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E8N883"
FT                   /protein_id="BAJ73103.1"
FT                   /translation="MDAVPALTEIPAPQFVIVGDNVRLATYTWGDADAEAVLCVHGFGS
FT                   STRDNWVNTGWVRDLLRAGFRVVAVDQRGHGASDKPHDAASYTMPTLVSDLVAVLDTYL
FT                   LDSVRYLGYSLGGRVGWQLAVDAPEHVERAVLGGIPDGRPLARLKVDQARAFLDHGIPV
FT                   EDATTLRYVSLAERVPGNDLRALVAIAEGMRLGETDPDPASPPQQPVLIATGTEDPIHD
FT                   QSQHLASLLPRGEFADIPGRHHVNAPGARAFREAGREFLSREG"
FT   CDS_pept        complement(133327..135381)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0140"
FT                   /product="4-amino-4-deoxy-L-arabinose transferase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0140"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73104"
FT                   /db_xref="GOA:E8N884"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/TrEMBL:E8N884"
FT                   /protein_id="BAJ73104.1"
FT                   /translation="MTATLDPIAAPLPEAAVPPTARRSRAWTGGLIAVGALALVLTGWQ
FT                   VWAGAPSEYYASIALSMSRSWSNFFFGAVDPAGTVTLDKIPGSFWIPALFVRVFGYSAW
FT                   TVILPNALAATAAAVITAVAGRRLAGVRAGLLAGAIVAVTPILVAVSRSNQPESFFVLG
FT                   LALTAWASVRAVQARSVGWLVVAGAFVGLSFQFYMLEAWAVWPALAAAYLCTRQSWARR
FT                   ILHLAVAGVVSLAASLWWVAIVSLIPSGSRPYIGSTIGDDPWEMVFGYNGLGRFTATAD
FT                   SSTYESFTPPFSGDPGILRLFNAQLAGQIAWLIPAAILGIVVLWLLRFPRPLTVLLTVW
FT                   TVTFAAMFSTVAGMHQFYTAALAVPLALVVAVALSVAHRAGKVWPRAAIVGLAGLTAVV
FT                   IGFSYGGYSIPVSLVQAAAAAAAIVLLFSRHRARRVTAIVTVVGLLLTPTVWSAVTIAH
FT                   PSSINPVAGGVSEMSAGGMGGAGRGPGGQGAGARFDGGSMPGGAQGGGQNGPQGGGSRA
FT                   GSGAGGAQTAPGTGRSGATQGFGGQAGMSRGADTELVAWLEAHDTGSTYVAAAFGAQQA
FT                   ASLILATDGASILPIGGFNGSDDVPTLDRFISLVQSGELRYVIGGEDRGAGAGATGFGA
FT                   AGGTGGGGAGGSGSGRSTTTDTASAQIRQWVEQNCAIDSSAPGTVYDCG"
FT   CDS_pept        complement(135527..137221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0141"
FT                   /product="endoglucanase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0141"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73105"
FT                   /db_xref="GOA:E8N885"
FT                   /db_xref="InterPro:IPR001547"
FT                   /db_xref="InterPro:IPR001919"
FT                   /db_xref="InterPro:IPR008965"
FT                   /db_xref="InterPro:IPR012291"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018087"
FT                   /db_xref="UniProtKB/TrEMBL:E8N885"
FT                   /protein_id="BAJ73105.1"
FT                   /translation="MRVWRAGVRAAGVRAAAVRAAAVAATAVLLIAGAVVPAASAATVP
FT                   GWLSTKGSTIVTAAGSAYTIKATAWFGMETSNCAPHGLWSISLDEGMDAIAAMGFNAIR
FT                   LPFSNECLAAKSSNSINASVNPGLVSLSPLKLMDAVIARAKAHGLSVILDRHRPDSGAQ
FT                   SELWYTAQYSEKRWIDDWKMLAARYKNESAVIGADLHNEPHGPACWNCGDASRDWRAAA
FT                   TRAGNAVLSVNPKLLIIVEGVENQRDGSATWWGGGLKDVRSAPVTLSVKNRVVYSPHEY
FT                   PATVHAQPWFSASNYPANLEGIWDANWGYLVRENIAPVLLGEFGTKLETTSDQAWLKTL
FT                   VAYLAKTKMSYAYWSFNPNSGDTGGLVADDWRTWQTAKLTALRPILTPGAVPTPKPTSS
FT                   PKPTSSPKPTTKPSSSPKPTSSPKPTSSPQPTTKPSSSPKPTSSPKPTSSPKPTSTPRP
FT                   PASASPKPAGITASWIPQSSWGEGYVAEVEVTATGTVSRWQVSFEAPGTTDVSNAWGMS
FT                   CSLAGSTVTCRGADWAAALTAGQTVRVGLQATATRAPSSPKLTVRAS"
FT   regulatory      complement(137225..137230)
FT                   /locus_tag="MTES_0141"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(137264..138931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0142"
FT                   /product="regulator of polyketide synthase expression"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0142"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73106"
FT                   /db_xref="InterPro:IPR012914"
FT                   /db_xref="InterPro:IPR025736"
FT                   /db_xref="InterPro:IPR042070"
FT                   /db_xref="UniProtKB/TrEMBL:E8N886"
FT                   /protein_id="BAJ73106.1"
FT                   /translation="MHVSDRRESGAVRTDRPAAPDAGLPTLAEALEMPALVQGMPEVLV
FT                   GRAALDARVRWVHVSDSPGVARLLDGGELLLTTASAWPEHPEDLRALVAAFAAAGLVGI
FT                   VIELGAHYRYVPAVVLDAARATGLVLIALHREVKFVAVTEQVHRRIIDEQTTALRARDE
FT                   VRTLFTELALRGAPADYVVQRLARTLRAPVILESLAHEVIVADLADAEHTVLDDWQERS
FT                   RLSGRDPAADRTVVPVQARGTRWGALVALAGPAHPAGRLGVLEQGATALALGRLADTDG
FT                   EDWEHLGRRRLVDALLAGRYGSLPEAAVRLTAAGLLAEGVTLRGLAVSGAGAAEIETAA
FT                   NEVGGRALCGTPRRADEPAEGWMPILLATPSTMSFAGATVDRFLAGLRIGDARVRLVVG
FT                   PRVDPGAPEAVLTRTLDSAREALDLAESGEVGEAGVMWVRRHPLLRFVAALRGDHRLLA
FT                   HAESMLAPVLDLPPARRDDLLDALAAVVAHPGNRTAAATAAHVSRSVFYQRLDALEEVL
FT                   GVRLDDGEVLAALHLALAVHRAHAGAARRASPTPLPST"
FT   regulatory      complement(138941..138946)
FT                   /locus_tag="MTES_0142"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      139011..139016
FT                   /locus_tag="MTES_0143"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        139023..140510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0143"
FT                   /product="NAD-dependent aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0143"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73107"
FT                   /db_xref="GOA:E8N887"
FT                   /db_xref="InterPro:IPR010061"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:E8N887"
FT                   /protein_id="BAJ73107.1"
FT                   /translation="MTLIRHHIAGAAHGTDARTGDVFNPATGEVQAQVAFATAAEVDEA
FT                   IAAAAAALPAWRATSLIKRADVFFRLRHLLVERTDELAAIITAEHGKVLSDAKGEISRG
FT                   IENVEFAAGLVHLLKGEHSEQVSRGVDVHSVKQPVGVVAAITPFNFPVMVPLWMTASAI
FT                   ACGNTVVLKPSEKDPSAALFLAKLFEEAGLPAGVLNVVHGDKVAVDALLDSPTVRAVSF
FT                   VGSTPIAKTIYSRAAENGKRVQALGGAKNHMVVLPDADLDSAADAAVSAAYGSAGERCM
FT                   AVSVLVAVGDDVADALVEKVSARISGLSIGPGTDAASEMGPLITREHRDKVASYVTGAA
FT                   AEGAEVVVDGTTQEFEGDGFFVGVSLVDRVAPGMKVYDDEIFGPVLSVVRVQNYDEAVA
FT                   LINSSPYANGTAVFTRDGGTARQFEFDIEVGMVGVNVPIPVPVGAFSFGGWRNSLFGDS
FT                   HIYGPESIHFYTRSKVVTTRWPDPSESQISLGFPSNH"
FT   regulatory      140526..140531
FT                   /locus_tag="MTES_0144"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        140537..141889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0144"
FT                   /product="4-aminobutyrate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0144"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73108"
FT                   /db_xref="GOA:E8N888"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:E8N888"
FT                   /protein_id="BAJ73108.1"
FT                   /translation="MSITDLDADARVRANDRGHVFHSWSAQALIDPLPVAGGEGATFWD
FT                   YAGNRYLDFSSQLVNLNLGHQHPDLVAAIQRQAGELATIQPAMANDVRGELARRIVEVA
FT                   PAGMSKVFFTNGGADANENAVRMARLVTGKRKVLAMYRSYHGNTSTAITLTGDPRRWAN
FT                   EPADASVVHFFGPYAYRSAFHSSSEEEETARALEHLEQTIILEGASTIGAIILETVVGT
FT                   NGVLVPPPGYLPGVRALCDKYGIVYIADEVMVGFGRIGEWFAVEAFDVTPDLITFAKGV
FT                   NSGYVPLGGVVISDAIAAHFDTVAFPGGLTYSGHPLACAPGVATFEVFERDGILERVRD
FT                   LGARVVEPRLRAMAERHPSVGEVRGRGLFWAIELVRDRETREPLVPFNATGPAAAPMTA
FT                   FAAACKKAGLWPFTHFNRVHVAPPLVIGEEDLVRGLDIIDEALTVADEAMS"
FT   regulatory      141873..141878
FT                   /locus_tag="MTES_0145"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        141886..143310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0145"
FT                   /product="NAD-dependent aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0145"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73109"
FT                   /db_xref="GOA:E8N889"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR015657"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:E8N889"
FT                   /protein_id="BAJ73109.1"
FT                   /translation="MRILHNIVDGAAVASTGPLLDLVSPVTGEVYAQAPVSTAEEVDAA
FT                   VAAAAAAFPAWKRATPAQRQLALFRLADALEARAEEFADLESEDTGKPRATLVADEIAQ
FT                   SVDQLRFFAGAARELNGRAAAEYAEGYTSYVRREPIGVVAQVTPWNYPLNMAVWKIGPA
FT                   IAAGNTVVLKPSETTPQSTVLLAEIAAEILPPGVLNVILGDRDTGRALVEHPTPQLVAI
FT                   TGSVRAGMQVAASAAQSLKRVHLELGGKAPAIVFPDADLEAAASGIAEAAFFNAGQDCT
FT                   AATRLLVHASLHDAFVERLVAYVEQSVRVGAPDDPDAFFGPVNNPDQLARVEGFIQRLP
FT                   AHARIATGGARVGDTGCFFAPTVVTGLRQDDELVQQEVFGPVLAVQSFETEEEALELAN
FT                   DVPYALAASVWTRDNSRALRFGRDLDFGCVWINAHIPFVSDMPHGGFKHSGYGKDLSIY
FT                   GFEDYTRLKHVMASLA"
FT   regulatory      143445..143450
FT                   /gene="asnC"
FT                   /locus_tag="MTES_0146"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        143461..143931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="asnC"
FT                   /locus_tag="MTES_0146"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0146"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73110"
FT                   /db_xref="GOA:E8N890"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E8N890"
FT                   /protein_id="BAJ73110.1"
FT                   /translation="MSSATDRSVTLDRVSKAIVEQLQEDGRRSYAEIGKAVGLSETATR
FT                   QRVQKLQDAGILQIVAVTDPLQLGFARQAMIGVRVSGDTRVVAAEMAELPGVTYVVSTA
FT                   GSFDLLVEVVCESDDDLIDLLNDRVRALPDVVSTETFVYLKLHRQLYNWGTR"
FT   regulatory      143917..143922
FT                   /gene="bioA"
FT                   /locus_tag="MTES_0147"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        143928..145322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bioA"
FT                   /locus_tag="MTES_0147"
FT                   /product="adenosylmethionine-8-amino-7-oxononanoate
FT                   aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0147"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73111"
FT                   /db_xref="GOA:E8N891"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:E8N891"
FT                   /protein_id="BAJ73111.1"
FT                   /translation="MTLLDTDHDAALQAKARDHLWMHFSRQSVMTDGPGVPIIVKGEGH
FT                   HIFDSRGKRYIDGLAGLFVVNAGHGRRRIAQAAAKQAEELAFFPLWSYAHPAAIELAER
FT                   LANLAPGDLNHVFFSTGGGEAVETAFKLAKQYWKTQGKPTKHKVISRAIAYHGTTQGAL
FT                   AITGLPVMKHMFEPVTPGGFRVPNTNYYRAEESGFGGGTPEEFGLWAADRIEQMIQFEG
FT                   PETVAAVFLEPVQNAGGCFPAPAGYFQRVREICDKYDVLLVSDEVICAFGRLGHYFGAS
FT                   AYDYQPDMITFAKAVTSGYSPLGGTIISDRIYEPFAHGDASFPHGYTFGGHPVSAAVAL
FT                   ENLDVFEEEGLLENVRTNSPVFRSTLERLLDLPIVGDVRGDGYFFGIELVKDKATKETF
FT                   DDDESERLLRGFLSKALFDAGLYCRADDRGDPVIQLAPPLTLGPAEFTEIEQILRSVLT
FT                   EASNRL"
FT   regulatory      145628..145633
FT                   /locus_tag="MTES_0148"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        145636..146958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0148"
FT                   /product="amino acid transporters"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0148"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73112"
FT                   /db_xref="GOA:E8N892"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:E8N892"
FT                   /protein_id="BAJ73112.1"
FT                   /translation="MTPTVVFDTFGLVAEKTNNVVPAAYAVALIVLVFTAISYGKMVRV
FT                   IPSAGSAYTYARESIHPGVGFVVGWTALIDYMLLPMVNALILRSYMEALFPDVPGWIWV
FT                   VVFTAGVTGVIYLTMRGTSNVNMILLVFSILVMTVFVVMVVVQLVGGAGAGTPVSIAPF
FT                   AHSEVQFGAVLAGATVVCFSFIGFDAVSMYSEEAKTPKIMPRAIVLTLIVGGIIFLIAS
FT                   YVTQLRFPDSTAFPQEAIEDSTLPEIGVQVGGPVLQAVLTAAGFAATLASWLASHASVS
FT                   RMLMVMGRNNVLPRRIFGFINPKTHTPTFSIVIVGVISLLAISFTLEQISAYINYGALV
FT                   AFSFVNISVIAWFAIRKGLHKTPGDIVKYIVMPGIGLLLTALLWVNLDAHALIGGLIWT
FT                   GLGVVYLVILTRGFRRPIASFDENQPVTGVNKTFPGPRSEI"
FT   regulatory      147038..147043
FT                   /locus_tag="MTES_0149"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        147056..147226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0149"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0149"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73113"
FT                   /db_xref="UniProtKB/TrEMBL:E8N893"
FT                   /protein_id="BAJ73113.1"
FT                   /translation="MPEARRKIVREGIGSGARDGAGRGRRGGGRYSCDDEYVLSPRDRL
FT                   AFRVLAGGPNS"
FT   CDS_pept        complement(147336..147929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0150"
FT                   /product="predicted transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0150"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73114"
FT                   /db_xref="GOA:E8N894"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:E8N894"
FT                   /protein_id="BAJ73114.1"
FT                   /translation="MTRATDADEQRAVETLGAAVRDARKRLGLSVQALSEKAGVSFGLV
FT                   SQLERGLGNPSLQSLQRLAGALGIPVAQLLDEPAVPLAVVTRAKRHIMPVAVDAPASQR
FT                   AVRELLTPRGESMLQLIRSTLPAGFSNEASPFRHIGTETVTVESGVLVVCQADRRVELR
FT                   AGDTVTYGCSEPHWWANGHDAETVVLGAVTPFER"
FT   regulatory      complement(147941..147946)
FT                   /locus_tag="MTES_0150"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(147991..149616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0151"
FT                   /product="ATPase components of various ABC-type transport
FT                   systems, contain duplicated ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0151"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73115"
FT                   /db_xref="GOA:E8N895"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E8N895"
FT                   /protein_id="BAJ73115.1"
FT                   /translation="MTVLDVRDLRVAIGETPIVRGLDFSVEREQTLGIVGESGSGKSMT
FT                   VLAATGLIDAPGRRVAGSSVLKTSPDAAGIELVGATDRTLRSVHGDAVGFVFQDPSTSL
FT                   NPFLTAGRQIAESLEAHRGLTRRAAQTRAISLLEAVGIPDPSSRVEAYPHQFSGGQRQR
FT                   VMIAIALACDPALLVADEPTTALDVTTQAQIIDLVQQLQRDRGTAVVWISHDLGVIGQV
FT                   ADDVIVLRHGEAVEQRPLAELYADPHHAYTRELLAARPRVVGGAGPAPEPEAAPLLEVA
FT                   DLDVRFAVQTPAGRRTVHAVDDVSFTVRRGTTLALVGESGSGKSTIANALTGLVAPHAG
FT                   TATLANATGGGVRDALRAPRRDRRRIAMVFQDPFASIDPRRTVADAIAEPLRVHRLGGR
FT                   TAASRTARVEELLDLVDLDPAFAKRYPHELSGGQRQRVSIARALALEPELVILDEATAS
FT                   LDVSVQARVLALLRRLQVEQGLTYLFIAHDLAIVQQMSHDVVVLRGGRVVEAAPAAELF
FT                   ANPREEYTRALLAAVPPEGPRVRA"
FT   regulatory      complement(149624..149629)
FT                   /locus_tag="MTES_0151"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(149684..150682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0152"
FT                   /product="ABC-type dipeptide/oligopeptide/nickel transport
FT                   systems, permease components"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0152"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73116"
FT                   /db_xref="GOA:E8N896"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E8N896"
FT                   /protein_id="BAJ73116.1"
FT                   /translation="MSSLTPAPRPAAGSGPDTVDGPGVANTRTRVRSWRLLAANPLTVA
FT                   AAIVLTVVVLASALAPWIAPYGVNQIDVANALTPPSAAHWFGTDELGRDVLSRVLLAGG
FT                   TSLTIAVVAVTIALVLGLVLGVVAGYAGGWVDATLMRVVDVMFAFPVLLLALAIIAIFQ
FT                   PGMLTTTIAIGVVYTPIFARVARASTLSLRTSPFVQVSRTMGTPAPVILVRHVLPNIGG
FT                   PIVVQTSLSLAFAILSEAALSFLGLGIQPPAPSWGGMLFTAQGFLSQAWWMSVFPGAAI
FT                   FVTALAFNLLGDGLRDGLDPRQRTLIEARQGERRRRRTTLERPDTSQEISR"
FT   CDS_pept        complement(150679..151644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0153"
FT                   /product="ABC-type dipeptide/oligopeptide/nickel transport
FT                   systems, permease components"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0153"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73117"
FT                   /db_xref="GOA:E8N897"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E8N897"
FT                   /protein_id="BAJ73117.1"
FT                   /translation="MRVAPARLARFLGARLLSSAIVLLGVLIVVFALVHLVPGDPVRLA
FT                   LGTRYTPEAYEALRAASGLDRSLPEQFFSYLAHAVTGDLGVSFRNGQPVTTTLLQRLPA
FT                   TISLALVGLVIALVISIPAGVYSALREGRVSDVIVRLSSQFGVSIPDFWLGMLLISFFS
FT                   VTLGLLPASGYVALTDDPAGWLRQVTLPGITVGLVAGAIMTRYIRAAVIDVASSGYIRT
FT                   AVSKGLPRRIVVSRHIVRGALVPVLTIAGIQLATILGGVIVVEVVFAWPGLGRLVYDAV
FT                   AARDYPLIQGAVLLVAVMFIVVNLIVDVLYAVVDPRIRAA"
FT   regulatory      complement(150691..150696)
FT                   /locus_tag="MTES_0152"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(151651..151656)
FT                   /locus_tag="MTES_0153"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(151733..153262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0154"
FT                   /product="ABC-type dipeptide transport system, periplasmic
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0154"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73118"
FT                   /db_xref="GOA:E8N898"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR023765"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:E8N898"
FT                   /protein_id="BAJ73118.1"
FT                   /translation="MTSRTTLGIAGALAAVLALAGCSAGQSVDLGDSGSASAQTLVAAI
FT                   GGEPDQLDPQKTTSYFAFEVLENVYDTLVQPDANLEMQPALAESWTTSDDQLTWTFTLR
FT                   DGVKFQDGSDFTSEDVVYSYRRIIDEKLANAWKFATVSDVSAPDDKTVVITVSQPTPNL
FT                   LSNLGGFKGMAIVEKANVESGDITTAPVGTGPFSVSDYVAGDHITLKANPDYWGGAPKL
FT                   GGVEYRFISEPATALASLKAGDIDWTDVVPPQQVEQLKSDSSVQLGLTPSSDYWYLALN
FT                   EAKAPWNDVRVRQAIAYAIDRDAIVQAVSYGTAEKNQLAIPKQSVWYTEYNTYSTDVDK
FT                   AKSLLAEAGFTGGTLDLLATSDYPETVTAAQIIAANLEPLGIQVSIRQPDFSTWLDEQN
FT                   SGNFDMLMMGWLGNIDPDDFYYSQHHTGGASNAQKFSDPEVDKLLDAGRVETDTDARKD
FT                   LYAQAATIIADKASYIYLYNPSVTQLWSPKVSGYETRADRAIRFEGTSVDK"
FT   regulatory      complement(153270..153275)
FT                   /locus_tag="MTES_0154"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      153412..153417
FT                   /locus_tag="MTES_0155"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        153424..154047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0155"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0155"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73119"
FT                   /db_xref="InterPro:IPR010430"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:E8N899"
FT                   /protein_id="BAJ73119.1"
FT                   /translation="MTFTVLARDTRHGLIGAATASRSLAVGASVIAVDPAVGVAASQAW
FT                   TNRALRGRLLAAMREGRTAAEAVASVPSWDEGYALRQVAALAWTSPGAARSGEAITAWA
FT                   GHSTTTDAVFAGNLLTGPEVLEAMSAAWVRSSGDLAGRLIEVLRAGDLAGGDARGRQSA
FT                   AVLVASPADTLLDLRVDDHDEPLAELGRLHRLSAAPQEVPGTVR"
FT   regulatory      154299..154304
FT                   /locus_tag="MTES_0156"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        154311..156272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0156"
FT                   /product="4-amino-4-deoxy-L-arabinose transferase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0156"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73120"
FT                   /db_xref="GOA:E8N8A0"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/TrEMBL:E8N8A0"
FT                   /protein_id="BAJ73120.1"
FT                   /translation="MTETLPLARWWREPLWAKGVLAAILAGSALLMSWNLARGGDFAFY
FT                   EAAARSMSESWRALFFGAFDPAGTVTLDKLAGFAVPQAIAIHLLGMSTSAVALPQVIEG
FT                   LVTVMACAVVGLRWGGTGAGLVAALAAASTPIFVSMFGHPMEDGLLTMALAVALVWWQR
FT                   AMLTARWWPLLMAAVFVGVGFQAKMMSAWFVLPALFVGTVIAAPSLRRGLARASALVGA
FT                   SVAASIVWITAIALTPASMRPFIDGSTDDDVFAMVFGYNGLDRFAPGSVPGSVGAPSGG
FT                   GVAEGLTTLGRAFGSHAGAAAGAGSSPTKLLEMPLVTQIGWLYPAALVGLALALWRYWP
FT                   RRGRPRDRAQWALGVVAGLWLATSAAVLSATRVPHTAYVAALGVPLVLLTAMAWSEGCR
FT                   LLRSPRRGGRLVLPALLVVHGVWWSVLVREGQLPAVLAAGAGVVLVAGVVLGVMGAWPR
FT                   RPRPAFARALPAALALALLCAPVAASLQVLDANRDGSGGDAYVGIPTRSDRPDESFAIS
FT                   APALWGGTPAISSAVAQLVATARADGGGTDGAPLLVSDTWAISAQIIDATGASVLTDGG
FT                   YSGHVPVFTASALRTMEQSGRVHLFAVSSGAGKDDPVREVATGPGCHEVQEWRLDGHGE
FT                   GGEVNKVSQVALYSCESA"
FT   regulatory      156340..156345
FT                   /locus_tag="MTES_0157"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        156355..157830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0157"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0157"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73121"
FT                   /db_xref="InterPro:IPR021804"
FT                   /db_xref="UniProtKB/TrEMBL:E8N8A1"
FT                   /protein_id="BAJ73121.1"
FT                   /translation="MTTTRTEAAYLRSVTAFKNPTLDLLHGRFAPFVVAVLSIVFTPDR
FT                   PAVAVADAHVEVAEAIDELRAAGYDTDDDRRIPAGSARDICRGWVRVGWLGLQIEDDVE
FT                   VYRLSAHAVGALEIAGRAGGGRARVSRSRVRTLLDAVDRLARDAESDPVRRREALLEER
FT                   AALDAEIAALDDGIVEPLDDDHLLEEAENVIHLARELPADFSRVAESIAAMQRDVVAEL
FT                   RRDVRPTGEVLREYLERGRQVMQATPEGRAFQGALRLIGDPENIDDLTDQLHAVLAQPF
FT                   SRLMTPEQRGELDAIARRVEAGVQEVLTAQRRASHVITAQVRTHDPIRDRQVDDLLRGV
FT                   MAGLHRWSQTRAPGRVEPVRTLPLADVGHLRQSISDIRPAGAPEPLASGTDDVEFVDAD
FT                   TRAWGGPHYAELEAYVARLGEGFDLAEAFSGADAETRRPVDLVGLLEIVHRSGLTETDE
FT                   VSVVEAVRPDGTTRRFAFGAVRAGNERESTSDD"
FT   regulatory      157811..157816
FT                   /locus_tag="MTES_0158"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        157823..158521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0158"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0158"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73122"
FT                   /db_xref="InterPro:IPR025449"
FT                   /db_xref="UniProtKB/TrEMBL:E8N8A2"
FT                   /protein_id="BAJ73122.1"
FT                   /translation="MTDVDTTGPETSAFISPVAMENDPDALFAGDRGTLDADVRRVLVR
FT                   ILQRRFLLAENSPAEWKLLLEHQQMIESRLNDLFVRLVVDHARGVAYKEQVRSDEVDVP
FT                   ILLKDEAYSRAETLVLVYLRTVFQRETTAGTASARVDVEEVEQTVLTYFAETDGTRASQ
FT                   QRAVRTAIARLDREGIIEEESEGRYRIGPLIEIVLSAETLRELQAWLDEQTAGSSASSS
FT                   PETPQGDLLS"
FT   regulatory      158502..158507
FT                   /locus_tag="MTES_0159"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        158518..161871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0159"
FT                   /product="uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0159"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73123"
FT                   /db_xref="UniProtKB/TrEMBL:E8N8A3"
FT                   /protein_id="BAJ73123.1"
FT                   /translation="MTMLETLFGLIPAASRGQQWVAEDLQLINWGGYDGTHRVRFAPTA
FT                   TLLCGGSGSGKSTLMDAYVALMMPHTTPFNGASNGAVVGRPRGQEQRNILSYGRGKLDE
FT                   SRTDEGTKVRVLRGDGVDTWTAIAMTWADHDGARFTAVRAWYIPAAARTLDDAVKVRAT
FT                   VHGAFDLRSLESAAQNHLSDAAVRATGLDTLATDREFSARLHAVLGIGAAGAGTKAMSL
FT                   LARIQAGQQITTVDDLYKRMVLEEPETLAVADAVVSHFDGLESTRTRMIEARQQVRALQ
FT                   PIRAMKTRIDEAAERLRLIDALGRFGDPESRASLWRAQRRVDLLGAVEDELRERTHATD
FT                   ALVRERQALADAAEAEREGLGDVLRAAGGDRLDAAQRELRGLERRLAGMQRDRERFEAA
FT                   LAVLSVEVSSAKQFDALVADARRTLADTDAKSAVRDAFVAASSRHTDLRQQLAALEAEH
FT                   RRTQTRDDNIPPRLHEAREALAEAAGLTAAELPFVAELVDVRTEFEPWRGAFTLALGGF
FT                   ATTLLVDAAHLSAFRSAIDGVRLSERLRFEGVSTGLPERTGLDPATLPGRLEYRRSPFT
FT                   GWLQDRLEQQFAFVCVDSAPELTGHRLALTISGQTSQGARGAHGGSTRQSILGFSSRVR
FT                   LTELGEQIVTARRDLATAKAAVDEAAAALDAFDERRSAYEKIADLSWDQVDTASVQREL
FT                   DRWNETIVEITAGNPRIAELQEQIDGTRARAARLREEIGGAKTEQQALAARWAEITDDV
FT                   DSANERLERAEDAEMVLSADEAAYLDGLFVAPSGEDSSPSQRLARFDAALESASRLLLE
FT                   EQRSAQETWGDQRDSLRRTLTAFTDRWPSPNLLADPDESLGDFERILADLEASGLHELE
FT                   AEWRDSLLRLSGNDLTSLDSALTRALREIRERIAPINDIMQDLPFYDDEHRLQIVPREN
FT                   QSEVRRRFRRELRDVRAAIDAAGSDEEREAVYGRMARLINRIRPTAPDFADLVDVRNHV
FT                   RVSAERFRADTGEHVALYDHIGEKSGGESQELIAFIVGAALRYQLGDAGAERPRYAPVF
FT                   LDEALIKADAHFTKRAIGAWRGLGFQLVIGAPNDKYSAIEPHVDVEYDILKDTRGRSWA
FT                   KAKVGVTPEA"
FT   CDS_pept        complement(161965..162294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0160"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0160"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73124"
FT                   /db_xref="GOA:E8N8A4"
FT                   /db_xref="UniProtKB/TrEMBL:E8N8A4"
FT                   /protein_id="BAJ73124.1"
FT                   /translation="MIVVLGAVGIIALSGPLDIVDAVASAGATVAIGPRENGLLLQLAA
FT                   TIVIFLLAAPALIVTQRALRRMPVDDPRRRGWEERQNWWFAAATAWVVSLLVGYLLSLA
FT                   ALITM"
FT   regulatory      complement(162306..162311)
FT                   /locus_tag="MTES_0160"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(163305..165260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0161"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0161"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73125"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR003870"
FT                   /db_xref="UniProtKB/TrEMBL:E8N8A5"
FT                   /protein_id="BAJ73125.1"
FT                   /translation="MDITAPANGRPTSVVSSWGVPWPSDDDLLAEADSVWAIEHGLADP
FT                   GPFSDPISGENGSVDLAGEVGFEGELSPAGLLEQLTHQVRDRHRATAAEYRLIALLLRA
FT                   AAADPVPWVGPDPTLDVEWSDSRRRSVAAVRRDRRDMAERAVVAEIATRLRLSEQTVRT
FT                   RAAHAEMLQSRCPEVWTAFSDGLLSERHAVEAARLATSLPDEAPAESTLGCDDPVPDAE
FT                   QSEVLAEGLLAGVTSVPDPSANSSDEAPSAPEAHESWRAFDEGALDRALRLPPARFSVA
FT                   ARALRERVHSESLEARHRRAARDRGVWVTPELDGMATLTALLPADRAHAALTCVDRIAR
FT                   HLRVAPDEERTLAQLRADAVADLLTSGAPTSAGLSAGDALITPRAPTSAGAPAVAGTRP
FT                   AAHARPAAHPRPAEGVATAEGARSAAGAPPGTGARPAAGAPPTGGAPPAAGAAPAASGP
FT                   PAADPLSVDDADAPGDARGGPARETPPSTSFAARPDRRPTVVVTVPALTLLGAGTEPAT
FT                   LDGYGPIDLDTARRLAGEARSWVRVLTHPLTGVPLALDRSTYRVPTALRRWLGVTSPTC
FT                   VFPGCGRAARDCDLDHLTAWRDGGATDDDNLAPECRHHHRLRHESQWEPSRDPGTGEMR
FT                   WTSPLGAEIPEGPPPF"
FT   regulatory      complement(165269..165274)
FT                   /locus_tag="MTES_0161"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      165323..165328
FT                   /locus_tag="MTES_0162"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        165333..165527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0162"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0162"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73126"
FT                   /db_xref="UniProtKB/TrEMBL:E8N8R7"
FT                   /protein_id="BAJ73126.1"
FT                   /translation="MPWQTDTLTGTPRTTRLPRPTDATTSRRTHPPGYRPRRSFPDAGN
FT                   ADHPHQRGIPPATKDPSLC"
FT   regulatory      165522..165527
FT                   /locus_tag="MTES_0163"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        165532..165924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0163"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0163"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73127"
FT                   /db_xref="GOA:E8N8R8"
FT                   /db_xref="InterPro:IPR021560"
FT                   /db_xref="UniProtKB/TrEMBL:E8N8R8"
FT                   /protein_id="BAJ73127.1"
FT                   /translation="MKLLPAVLLRAGIPLVIMTAIGVALLVQGKTADGRATLAVGVIAA
FT                   AVSGASVIYGIDAWGMRKQTLVHFAIMTVTVLPALLLSGWFTLDSVWGYAGVITTFLGV
FT                   GILLWAFFFVLFTKVLARRKTPRSSL"
FT   CDS_pept        complement(165955..166278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0164"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0164"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73128"
FT                   /db_xref="UniProtKB/TrEMBL:E8N8R9"
FT                   /protein_id="BAJ73128.1"
FT                   /translation="MTRFESPESAFLSPLGADWTIVQLLEWIGADDVRCHDVRLLGILD
FT                   AIDRALSPSSAVVMAGVVTLVRSLAMRVAAEPGVGERTLGEFVGASEPEDSAPAGVDVL
FT                   VPV"
FT   regulatory      166285..166290
FT                   /locus_tag="MTES_0165"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(166285..166290)
FT                   /locus_tag="MTES_0164"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        166298..167746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0165"
FT                   /product="transcriptional regulator containing a
FT                   DNA-binding HTH domain and an aminotransferase domain (MocR
FT                   family) and their eukaryotic orthologs"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0165"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73129"
FT                   /db_xref="GOA:E8N8S0"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E8N8S0"
FT                   /protein_id="BAJ73129.1"
FT                   /translation="MTLVDRATSALVDQRTAIVSAERLAARLGRWASTDATLAASLAEA
FT                   IARLVRDGELRGGDRLPSERTLAATVAVSRGTVVSAYSRLYDDGILDRRQGSGTRIAGT
FT                   VPAATRQAAGRGEALYATLPSSIDLLRAVPSISPLAVDIVQRHRPVLDATTVEADPAGL
FT                   PGLRALIAQTMTADGTPTTPAQVLVTHGAQQALSLLVDEIVSPGDTVLTEEVAWPGLTD
FT                   AVRRRGGQVHGIRLTSDGIDVEALERAIVVRRPVLIALNPHNHNPTGMQTSPAIRQRVA
FT                   DLAAEHGVTVVEDRVLAHVSFDGITPPSLAALRPDAPIVVVESLSKWAWEGLRVGWLRA
FT                   DPVLVRRLRGLRQSTDLSTSVPAQLLALDLLAEAPALRRDVATVHREAAIAAGRLLTVH
FT                   LPGWRWQPPRGGLCIWAQLPAGSATAFARHAAGFGVSVAGSAQFASDVDADDHIRIPVT
FT                   AVGQVLEAGVERLGEAWREYAGSR"
FT   regulatory      167865..167870
FT                   /locus_tag="MTES_0166"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        167879..170122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0166"
FT                   /product="subtilisin-like serine protease"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0166"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73130"
FT                   /db_xref="GOA:E8N8S1"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR019931"
FT                   /db_xref="InterPro:IPR019948"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:E8N8S1"
FT                   /protein_id="BAJ73130.1"
FT                   /translation="MTSWKRFAVRGIALGSAAALFLALPATAATPAEPAPPQAIPAWGS
FT                   TQVLAAPLRDLAASGVDLDASEAVRAVAGVGVNVSGGLEVTDGKVTVSVRFADAAAQNA
FT                   AVDAVATLGTVVAVTQSLPTIVVQASPASFAPLAALPGVVSVTPALRPATSAPTNAATS
FT                   TRTASTTADAAASCREIPAEADPVLRSDAARKAFGVDGTGITVGVISDSFDTAADASTT
FT                   PQDDVNIGSLPGPGNPCGYTTPVRVLADAAAPSTDEGRAMLQNVHAIAPGATLLFHADG
FT                   PTPAAMADAVRALKDAGADVIVDDVLFGYEPMYQRGVLASAVAEVVGEGVTYLSAVFNY
FT                   GAIGRSGPAAGQQTGAWESDSFTGMPCPKAVMDTLPPQTTGVDCMDFAPDGDANALLEA
FT                   TIVAGPTFPLYTQWSNPENGIETGVFAVVFDAEGNHVSTFGLVDENTAFSMTTVSTGAA
FT                   KGATVTADYRIALVRTVAGAPDMRTKLVFALDSGGVLGLQYGSWPAGVTVGPAAYGHAA
FT                   DPSAIAVGASSVLTPENLEPYSSPGPATYLFEPVRTDAVPAARLPEPQVISKPDVVAVD
FT                   AVRTSFFVPDGNPPGIFRFSGTSSAAPNAAGVAALAVQHAGKGTSPAVIRAALVGSGRP
FT                   IDGPTGYTGVVDENLIGSGLIDAEATLAALPTPTPTPTPTPTPTPEPTPTPTPDPTGSP
FT                   EPTSSASPGPNATGQLPRTGSDGTSALTLALLGGGVLAAGFLVVLRRRTRATR"
FT   regulatory      170260..170265
FT                   /locus_tag="MTES_0167"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        170279..172039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0167"
FT                   /product="NhaP-type Na+/H+ and K+/H+ antiporters"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0167"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73131"
FT                   /db_xref="GOA:E8N8S2"
FT                   /db_xref="InterPro:IPR004705"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR018422"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:E8N8S2"
FT                   /protein_id="BAJ73131.1"
FT                   /translation="MEGLEVTVLLGLAMLVGTVLAPRLRVATPLVLLVIGLALGFIPEL
FT                   RAIELPPETVLLLFLPVMLFREAWTTSMRSVRRSLRYIVPMSTLLVVASAFAVAGVATW
FT                   MGVPWEAALVIGAAVAPPDATAVAALGRLLPAKTFMKLKAESLTNDGTALVLYAIAVSL
FT                   LLGGQVTPWSITGMVLLSYLGGAAAGIAVAALAYFALRRMQSTLTINLTMLLVPFVSFL
FT                   LAEVIHASGVLAVVFAGLIVAWVSPRITTAMSRRAADATWPFGVYLLNGALFVLIGLEV
FT                   QLVLHEISPSEIGMLSLITVAAWIALFLVRYLFQWLFSPFSRPPAGSTRSLRHRSRLVS
FT                   TVAGFRGAVSLAIALSVPITTDSGAPVAGRDSVVFVTAGVIVLTLLVQGPLLPVVIRWA
FT                   KLPNDDAAIEEYELAERAISGAALAALDDLAVEHGISDRVRDRARREGYERLELANARA
FT                   VARQRAIEERDLAELDASLDSSLDDESDGSASSTMGPVPPAGIDDEGRQSSGGLEMIAV
FT                   SDDIDVTQRSPLVRHKEATRLRLAILDRKREVLLRLRREGTIDDLVARKILANLDLEEI
FT                   RTRGIEKASD"
FT   regulatory      172200..172205
FT                   /locus_tag="MTES_0168"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        172211..172822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0168"
FT                   /product="esterase/lipase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0168"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73132"
FT                   /db_xref="GOA:E8N8S3"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E8N8S3"
FT                   /protein_id="BAJ73132.1"
FT                   /translation="MAASGIPNRPPFDPELETMLGVINELAPPTLTAEMLPLMRMGSLP
FT                   GMPTRDEILETADLQSRDVTILGYEGAEIVVSIVEAKGRTGRGPGIFHTHGGGMVFGDR
FT                   FMAVEGFGEWLHRYNAVLVTVEYRLAPEFPDPYPVEDCYAGLVLTAEHADELGIEHERL
FT                   LIAGGSAGGGLAAGVALLARDRRGPHLLGQMRRDTSSLAD"
FT   CDS_pept        complement(172982..173293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0169"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0169"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73133"
FT                   /db_xref="GOA:E8N8S4"
FT                   /db_xref="UniProtKB/TrEMBL:E8N8S4"
FT                   /protein_id="BAJ73133.1"
FT                   /translation="MHEEPQVVKVVADEFGDHLPVWFPPPIFDDASMMPVSAGLVEEFR
FT                   YWNLVGQGRAGNPKEIAEHYRVGLLLAQRLADEIGSAYRVEILMAGEHPGWTPVTPAD"
FT   regulatory      complement(173302..173307)
FT                   /locus_tag="MTES_0169"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(173305..174042)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0170"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73134"
FT                   /db_xref="UniProtKB/TrEMBL:E8N8S5"
FT                   /protein_id="BAJ73134.1"
FT                   /translation="MQQTIKHFKTQKRTISGIAALAVASAIGAATVPTAALASPQEVND
FT                   VPPPLSAEQMSEHPGATWFAVSDGTVFGSEDKPLIPEPASAPDDGTVTPFLINDPIAWT
FT                   ACFVNHDEDYPLASYTYWGGSDPKIVELQCGYHSTANDTGHGWHHISAGHESQWRDRIK
FT                   QLTSGDPTGAGWDDLMSFANDSNISSPLIDIPRGSNNTRCVSAPILMYDLQGNYEYTFN
FT                   PSVIFSTDTNRVITSIPSSTPSC"
FT   regulatory      complement(174048..174053)
FT                   /locus_tag="MTES_0170"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(174696..174956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0171"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0171"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73135"
FT                   /db_xref="UniProtKB/TrEMBL:E8N8S6"
FT                   /protein_id="BAJ73135.1"
FT                   /translation="MAPTATDPTATLWLVDGTPTRLVYAGRRWRVTDTPTHLEGPGWSA
FT                   PLEPHEPAAGWRLQATDTAGASFVFDVYRVGDAWHVHRSYG"
FT   regulatory      174966..174971
FT                   /locus_tag="MTES_0172"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        174978..175310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0172"
FT                   /product="phenylalanyl-tRNA synthetase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0172"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73136"
FT                   /db_xref="GOA:E8N8S7"
FT                   /db_xref="UniProtKB/TrEMBL:E8N8S7"
FT                   /protein_id="BAJ73136.1"
FT                   /translation="MGSNRRYARHYDRLMDQRILAQTAATAGPLQTLSPAELELDSEPV
FT                   TIDPQPKPVRAWVRFGATPLRVDAEACRWTSRAVGIRFTVGQEQLQAWVWNSAVSERSP
FT                   STSTTA"
FT   CDS_pept        complement(175333..175881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0173"
FT                   /product="protein distantly"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0173"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73137"
FT                   /db_xref="UniProtKB/TrEMBL:E8N8S8"
FT                   /protein_id="BAJ73137.1"
FT                   /translation="MGDLSGPEPGAAASEWVALLRAGDFAAAWQLTTDAFRLANAQAWI
FT                   TGHRGIVGMWPGKPKPDDLARALSQEHAEHELWPYLVREVERQVRGVVLGVLGERPIGT
FT                   STRPRPIAPDIELVHVIPLDQLTASADGVAMWQPGQVVDSVSILLQRASDEWRIAGVAD
FT                   HLPVPGWPPSFERVADLGD"
FT   regulatory      complement(175895..175900)
FT                   /locus_tag="MTES_0173"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      175928..175933
FT                   /locus_tag="MTES_0174"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        175944..176120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0174"
FT                   /product="Zn-dependent protease with chaperone product"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0174"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73138"
FT                   /db_xref="GOA:E8N8S9"
FT                   /db_xref="UniProtKB/TrEMBL:E8N8S9"
FT                   /protein_id="BAJ73138.1"
FT                   /translation="METARAVHSRAAAAHVVDMKSNDRPRPFLDTVREAAVVLGMLNAA
FT                   AKLVEIVSGIFGQ"
FT   regulatory      176246..176251
FT                   /locus_tag="MTES_0175"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        176262..176651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0175"
FT                   /product="esterase/lipase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0175"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73139"
FT                   /db_xref="GOA:E8N8T0"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E8N8T0"
FT                   /protein_id="BAJ73139.1"
FT                   /translation="MYPMLDDRDATVSTHQIEGVGVWDRDSNLLGWNALLGARRGTDDV
FT                   SIYAAPARATDLSGLPPAFIDCGSAEVFRDEDVAYASAIWAAGGQAELHVWPGGFHAFE
FT                   GFAPQAALSHDAVEARDRWIRRLLG"
FT   regulatory      176907..176912
FT                   /locus_tag="MTES_0176"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        176920..177885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0176"
FT                   /product="polyketide synthase modules"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0176"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73140"
FT                   /db_xref="UniProtKB/TrEMBL:E8N8T1"
FT                   /protein_id="BAJ73140.1"
FT                   /translation="MQELAGRLKVLDPAASESVKIIEYFDSLIAGGAGVEAVVRAAAIL
FT                   GGTTAGARVRGRLVGIDADGARTTPTPPPSLPDTDAPSVWLQRDTGAALNDAMIVDRAQ
FT                   VALAIITARADPTTSAVERVIDAGVSRVDREAAAHRLRLDGEVRVVAAPPHSRHVTTAS
FT                   TVLATADGAVWIGLGEVVPPDGPAGTSLARDLDDLPRACADARLALRLADERHRVVDAG
FT                   ELGVLIELARAVDPSGPRHPDLEVLDALDARTLEALDVVVDSESIRAAATRLSLHHSSL
FT                   QSRHETWTRQLGYDPLTPRGRARFLAARMLQRLGSGTRES"
FT   CDS_pept        complement(178019..178996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0177"
FT                   /product="ABC-type branched-chain amino acid transport
FT                   system, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0177"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73141"
FT                   /db_xref="GOA:E8N8T2"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:E8N8T2"
FT                   /protein_id="BAJ73141.1"
FT                   /translation="MTRIVIAVAAVVAAIAPLLLTDQTFFVQTALTALVVTGLSLFMGY
FT                   AGQASLGQGAFVAVGGLTVAVGTVTLGIPPLLALIVAPVLGALVAALVGWPLLRLRGHY
FT                   LAFGSLAVLLIIQTVMATAPLFGAGVGIFGIPPLSVAGFVVPDQRVYSYVALAALAAAL
FT                   VVCHNLVRSRFGRGIRALAGSESAAASSGVPILRSKLTVFAVAGGFAGFAGALGAFFTP
FT                   YVSQDTYPPFASFGYVVMAVVGGLGSVWGGVVGTLALSLWLQVLSALSATPGMPAAAGP
FT                   ILQYAGYGIVLVVFLLFVPRGIVPTLAGLRGKRRAAPAMAVTRG"
FT   CDS_pept        complement(178993..179847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0178"
FT                   /product="branched-chain amino acid ABC-type transport
FT                   system, permease components"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0178"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73142"
FT                   /db_xref="GOA:E8N8T3"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:E8N8T3"
FT                   /protein_id="BAJ73142.1"
FT                   /translation="MSDLATYLLSGLALAGSFALVGSGIVVVYRVTHVLNFAQGSFVVF
FT                   GAFLSQTFRQLGLPPGLSELAAVVVVGLIGLVVGAVAIGKPGTHPMTSLLITLGMSLVA
FT                   AAAIIAVWGQNPVSPAGIGGTVQLFGAEIETQRLVTLAVAVATLGAMSLLFTRTDIGRA
FT                   LTAAASNPRAARLVGIDTRAMGLLSFTIAGVLGGLAGVLIAPTTAVSVTSDLPFVLSAL
FT                   AAAVFGGLRSPWMTFVGALVLGVTGQLVAGYANGSYQTQIALIMMLAIMIARSRSFTAE
FT                   EAK"
FT   regulatory      complement(179001..179006)
FT                   /locus_tag="MTES_0177"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(179857..179862)
FT                   /locus_tag="MTES_0178"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(179936..180613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0179"
FT                   /product="ABC-type branched-chain amino acid transport
FT                   systems, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0179"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73143"
FT                   /db_xref="GOA:E8N8T4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E8N8T4"
FT                   /protein_id="BAJ73143.1"
FT                   /translation="MMLEVNDLVVRYGSATALDGVSLRVDAGELVALVGPNGAGKTSLV
FT                   NAVSGLVRPASGTVRVEETVAQVPEGRQMFGDLSVDDNLRLGAWRRRSRRTDAVYELLP
FT                   DLQRLRRQRADTLSGGQQQMVAVGRALMAEPDLLVVDELSLGLAPLIAADLVRHLAALN
FT                   ADRGTAVLLIEQEVGLAFGLCSRAYVLDAGRIVAEGPTAELAAAPEVRAAYLGGFDEQE
FT                   NPS"
FT   CDS_pept        complement(180610..181407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0180"
FT                   /product="ABC-type branched-chain amino acid transport
FT                   systems, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0180"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73144"
FT                   /db_xref="GOA:E8N8T5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:E8N8T5"
FT                   /protein_id="BAJ73144.1"
FT                   /translation="MNTIEPAESPSAGLELAGLSRRFGGVYANRDISFRIAPGELRGVI
FT                   GPNGAGKSTLFGLISGHVRAQEGVIRLDGQRIDRLPPHRRAQRGIAIVFQGARLFPGMT
FT                   VLENVAVGAHARTRSGALDAAVRSPRHRREEREIIADAEEALARVGLAEWAGRGAEQLP
FT                   LGQQRRLQVARALTARPRVLLLDEPASGLRTDERDDLRGLIRELHDDGTTILLIEHDVA
FT                   MVTALADRIAVLDLGRLIAEGTPDEIRRDPAVIAAYLGSEAAA"
FT   regulatory      complement(180623..180628)
FT                   /locus_tag="MTES_0179"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(181404..182600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0181"
FT                   /product="ABC-type branched-chain amino acid transport
FT                   systems, periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0181"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73145"
FT                   /db_xref="GOA:E8N8T6"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E8N8T6"
FT                   /protein_id="BAJ73145.1"
FT                   /translation="MRRTVPVVATAALVLALTACSGGGSTASGNGSGPVKIGMVVPLTG
FT                   FLSALGQGDKEAAERVVADINSAGGIDGRQVELTVVDDKADVTESVKQFNQLASDPSYS
FT                   AMLASSFVSAATAVGSTAQSARIPTIALGPVDAFADGSNPYAFTSPPIPAVYARALVDY
FT                   WVSQGVKTLAIGYTGGDLYGTNGDKATAEYAKEAGIDVVLDESYDQTATDFTPLITKVV
FT                   SAKPDAFVVWGAGPAPVIITKQIAGKGIATYFTGAEASDLYLQPAGDAAEGVKAAATIA
FT                   LGGDALPGGAYKTKVMAVAKPWMDANNGAYPPEFAFGGASGIELLAAAIDAADSTDRQK
FT                   IRDALEKTDLLTSNGHYSYSPTDHMGLDATSLAIFEAKGGKWVPTDAATKQFATELPQ"
FT   regulatory      complement(181416..181421)
FT                   /locus_tag="MTES_0180"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(182606..182611)
FT                   /locus_tag="MTES_0181"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      182745..182750
FT                   /locus_tag="MTES_0182"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        182758..184992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0182"
FT                   /product="predicted ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0182"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73146"
FT                   /db_xref="GOA:E8N8T7"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR041664"
FT                   /db_xref="UniProtKB/TrEMBL:E8N8T7"
FT                   /protein_id="BAJ73146.1"
FT                   /translation="MIREPRSEFVGRRRELDALADALERTRLITLTGVGGVGKTRLAMR
FT                   LANAHARRTSTTVYFVGLDAVSDPRRVVAAIAQSLPFGDLSARDPLEFVVDVLSDETAL
FT                   LVLDNCEHVIDAAASVVDELLDALPNVTIVATSRRRLDVDGEQVFPVPPLGTEAAGGEP
FT                   AEAVELLLARARAADAGFTLAPAEVAVAEQLCLALDGLPLAIELAAGRLRTLSVSDLAR
FT                   RLSQRFTLLRAGSRAPVSRQRTLRAVVDWSYELCTPPERALWAALSVFAGPFDLPAAAA
FT                   VAGGDEAVTVETLEQLIDQSLVEADRDSGRFHLLETIRGYGRDRAEESGEQHDLVRRHL
FT                   EYYRGLARLARTHWYGPAQRRILAGQRADRAELDAALRTAAATDTDVALELFADLRYHW
FT                   AVGGFLSEGRRWTRRLLRLPAASAASRTPALLVAAWICVLQGALDEARGHLDEARALLP
FT                   SLPPADQERGEVELRRWSGTRALFAGESDLAREELSRSIRLARSLGRPEEALLAQFQLT
FT                   VALVQSELPDTLEPARDAQHLAIEIGERWIRSLSLWAIGLALYAAGELDDAERHARDAL
FT                   AMEEGIDDPVGDCLVLELLSWIDAARSPTERTAVLLGAARSWWRRIDSGIAVHGPQMLA
FT                   QHDRCVAVVRQRLGEEAFQRLSAVGERLSPAEAAAFAGAPGRPAAGLSARESEVAAGVH
FT                   EGLSNREIAERLVLSVRTVDTHVQRILAKLGFTSRAQIAAWYRSTLVSVP"
FT   regulatory      185257..185262
FT                   /locus_tag="MTES_0183"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        185269..185985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0183"
FT                   /product="predicted hydrolase or acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0183"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73147"
FT                   /db_xref="GOA:E8N8T8"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E8N8T8"
FT                   /protein_id="BAJ73147.1"
FT                   /translation="MTPSPPRILLVHGAWSGPWVFDRLAAQLGERGFAVDTVALPSIDS
FT                   TADLYADAAAITAALDAAEGPLNLVAHSYGGAPTTQAGDHPAVERIVYVAAFALDEGET
FT                   LQQAVGGGIPDFWGISDGMVSLGKSREERVAMIAADLPPGVPVALAEQLADTFRPQSLT
FT                   AFTSPVTKVAWRTKPTTYVLTERDELVPPPLQEHFVARSGADVVRVDTGHTPFEDDPVW
FT                   FAGVLADIITPAEVAR"
FT   regulatory      185970..185975
FT                   /gene="betB"
FT                   /locus_tag="MTES_0184"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        185982..187448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="betB"
FT                   /locus_tag="MTES_0184"
FT                   /product="NAD-dependent aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0184"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73148"
FT                   /db_xref="GOA:E8N8T9"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:E8N8T9"
FT                   /protein_id="BAJ73148.1"
FT                   /translation="MSLTVTTAPGRLFIDGRWADATDGGRMDVIAPSTGEKITDVARGT
FT                   TADVDAAVAAARRAFDEGPWPRMSSRERARILQRAYALMRERSEELAAAESLDVGKPIT
FT                   FARVVDVNNAAELYEYYAALGHRLDGDVREIAADAHAYVRNEPLGVVAAITPFNFPLIL
FT                   SSTKIAPALVAGNTVVHKPASDTPLSALLMAELLRDAGVPDGVFNVVTGPGSTLGDHLV
FT                   SHPDVDKVAFTGSTEIGAHAAALAGRTLKPFTAELGGNAANILFADADLDRAIHTVISA
FT                   FVFNAGQFCMAGPRLLVERPIYGVVLGILKDAVPHVPFGDIDDPATVIGPVASRTQLDK
FT                   VTAMVDRARAAGARVVTGGHAVERDGGFYYAPTVLADLDPDAEVVVDEVFGPVLTVQPF
FT                   DTEDEAIALANGTKYGLASGIQTADLARAHRIAGRLRAGITWVNGWAILDPAVPFGGVK
FT                   ASGWGREGGPEALQSYQKAHSIVFDLGGAQ"
FT   regulatory      187434..187439
FT                   /locus_tag="MTES_0185"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        187445..188569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0185"
FT                   /product="Zn-dependent alcohol dehydrogenase, class III"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0185"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73149"
FT                   /db_xref="GOA:E8N8U0"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E8N8U0"
FT                   /protein_id="BAJ73149.1"
FT                   /translation="MTAGRAAIVEEGRDGAALGTRTISVADVDYAEPGHGEVLVRLTAT
FT                   GLCHTDLGVLAGGIPFPTPGIIGHEGAGRVESVGPGVRGVSPGDAVLLSFTSCGACAAC
FT                   AGAHPAYCETWLPRNLLGGIREADSGGIARDGEPVAAHFFGQSSFGTYAIADERSLVRV
FT                   ADDADLAVLAPLGCGVLTGFGSMWNVLDPGPSDVVAVYGTGAVGLSAVMAAATRAPARL
FT                   IAIDRVASRLDLARELGATDTIDAAHEDVAARLAELTDGRGVTLSFDTTGHPGVARSAL
FT                   DAAAARGTVLVCGAPPPGTEIPVDIQGILTGKILRGVTMGDADPRELIPRLVALHAEGR
FT                   LPLEKLERQYALDDIAQAIDDMHHGRTVKPVIVY"
FT   regulatory      188670..188675
FT                   /locus_tag="MTES_0186"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        188683..189366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0186"
FT                   /product="Kef-type K+ transport systems, predicted
FT                   NAD-binding component"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0186"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73150"
FT                   /db_xref="GOA:E8N8U1"
FT                   /db_xref="InterPro:IPR013099"
FT                   /db_xref="InterPro:IPR028325"
FT                   /db_xref="UniProtKB/TrEMBL:E8N8U1"
FT                   /protein_id="BAJ73150.1"
FT                   /translation="MEWPLVIAALLFLAAYAAQILATPEGVVETVAEVVLKATWALFLL
FT                   DYVVRLAIAEHRWRWFWRHLLDLAIVALPVFRPLRLMRFFTIIALIQRNTGTMLRGRVA
FT                   LFTIGATALTVFVAALAVYDAEQRSGGPISTFGDAVWWAFETITTVGYGDYYPVTVTGR
FT                   IVAVGLMVGGIALIGVVTATLASWIVQRVSVEAEEASAATETQVEALRGEIAELKQMLR
FT                   EAPRA"
FT   CDS_pept        complement(189490..190248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0187"
FT                   /product="murein endopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0187"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73151"
FT                   /db_xref="GOA:E8N8U2"
FT                   /db_xref="UniProtKB/TrEMBL:E8N8U2"
FT                   /protein_id="BAJ73151.1"
FT                   /translation="MKKILMRRLSDGRAHIPLAGDARRLSVVQGVTIAIAAGLVLIVAV
FT                   ADDLGIRLLFGAFSLLLVAIAAYVGCLRRLLETGVVRIDTRGPGLRFRPPVWPTAFLVA
FT                   ILLLLALPAVAVVVIGDAGEALSPRRSPLLLPVFSAICLAVMIWRLRVPAGLRLTVDGI
FT                   RGIRARGDLAWSWDEVGEVGVDGPPAALTLTMKDGYVPVTASMRYLGSDPNQVAAIVRF
FT                   FRDHPEERAILARGGQAALDRAADALRPLD"
FT   regulatory      complement(190258..190263)
FT                   /locus_tag="MTES_0187"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      190418..190423
FT                   /locus_tag="MTES_0188"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        190433..191362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0188"
FT                   /product="ABC-type Fe3+-hydroxamate transport system,
FT                   periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0188"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73152"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:E8N8U3"
FT                   /protein_id="BAJ73152.1"
FT                   /translation="MPSHRSSRRLALLAAATGLALALSGCAGGADASLAESSASTHEVT
FT                   HARGTTAVSTAPQRVVTLEPLELDTAVSVGITPVGAAVANMVNGVPSYLGVEGVTPVGT
FT                   VSEPDLEAIAALKPDLILGTESRHSALYDQLSAIAPTVFIATQADPWRDNAALIGDALG
FT                   REDDVKKAVDAVDQRCDEIKAAHDLAGKTAEMIRPRDETTLSLYGPVSFAGSLLECVGY
FT                   TIPDHAWEDGLQADISPENIASATADAVFVTTADVNDPSTVPAAISQNAAAFPVVTLVD
FT                   TSTWVAGVGPKGAQSVLDDIETFLASGK"
FT   regulatory      191351..191356
FT                   /locus_tag="MTES_0189"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        191359..192405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0189"
FT                   /product="ABC-type Fe3+-siderophore transport system,
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0189"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73153"
FT                   /db_xref="GOA:E8N8U4"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:E8N8U4"
FT                   /protein_id="BAJ73153.1"
FT                   /translation="MTSVVPPRVSDTAPGSPRIGRTAIGTLVLVAVLAVSVALSLMIGA
FT                   NPLPWHAVWASLTGAGTPDTDFVVLGLRVPRTIAGVVAGAALGVAGALMQAFSRNPLAD
FT                   PGILGVNAGAAFAVALTVALFGIQSSLLLIWPAFLGALVVTVAVALVGSSGRGPADPIR
FT                   LTLAGVAVGAVLSGITSGMMLSNPDAFDLMRGWNAGSLLGRGLDIVLPVVPFIAAGLAV
FT                   AFVLGRPLNALALGDDLARAQGIPVGAVRVASIAAITVLAAAATALVGPLSFVGLMVPH
FT                   VVRWIVGPDQRRILPLSALAAPIVVLLADVLGRVIIAPAEVPAGIVTAFVGAPVLIALA
FT                   RRRRASTL"
FT   regulatory      192390..192395
FT                   /locus_tag="MTES_0190"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        192402..193436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0190"
FT                   /product="ABC-type enterobactin transport system, permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0190"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73154"
FT                   /db_xref="GOA:E8N8U5"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:E8N8U5"
FT                   /protein_id="BAJ73154.1"
FT                   /translation="MTAVDVGYRRVHLGALPVRLRSIVVGAAVLAAVVVLAVLSLGWGT
FT                   YPVAPDAVVRALLGAGDALDTTVVVGWRLPRVLAAVTLGALLAIAGALFQTVTRNPLAS
FT                   PDILGLSNGAFTGMLLTLVLVSASWPARAVGALIGCLVASVVIWFLSYRGGVQGFRLIV
FT                   VGIGVSAMLASLNTWMLLQVELETAMFASAWGHGTLNGVTGEALGGVLLCAAPFALGAF
FT                   ALVRALRQLELGDDMAAASGVRPHLVRTLALLAGVVLVAAATAIAGPIAFVALAAPQIA
FT                   RRLARTPSLSLALSALVGALLLLGSDAVAQHLLPVTLPVGVVTVSVGGAYLIVMIVTEI
FT                   RRRV"
FT   regulatory      193413..193418
FT                   /locus_tag="MTES_0191"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        193429..194262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0191"
FT                   /product="ABC-type cobalamin/Fe3+-siderophores transport
FT                   systems, ATPase components"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0191"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73155"
FT                   /db_xref="GOA:E8N8U6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E8N8U6"
FT                   /protein_id="BAJ73155.1"
FT                   /translation="MSDPSRLEARSVSLAYDGTTVVPELSVAVPPGSFTVIIGPNACGK
FT                   STLLRGLSRLLAPAAGSVVLDGRDISSYPAKEVARRLGLLPQTALAPDGITVADLVGRG
FT                   RYPHQSLLRQWSSADEIAVKEALDATGTADLSTRPVDALSGGQRQRVWVAMVLAQQTDL
FT                   LLLDEPTTYLDVAHQVELMELFAELNARGRTVVAVLHDLNHAARYASHIIAMRDGRIVA
FT                   EGAPREVITTERVEEVYGLPNVVIDDPVTGGPLVVPLRGGAFAARAAEAAAELDA"
FT   regulatory      194247..194252
FT                   /locus_tag="MTES_0192"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        194259..195095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0192"
FT                   /product="siderophore-interacting protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0192"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73156"
FT                   /db_xref="GOA:E8N8U7"
FT                   /db_xref="InterPro:IPR007037"
FT                   /db_xref="InterPro:IPR013113"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="InterPro:IPR039374"
FT                   /db_xref="UniProtKB/TrEMBL:E8N8U7"
FT                   /protein_id="BAJ73156.1"
FT                   /translation="MSGERMPGAGTRPWEYSAFPVTVARREMISPSFLRLTFAGDALQH
FT                   FAPWGVDQRIKLVLPLPDGGLADFGLLADPTPHPSAWYTRWKALPPDERNVLRTYTPAA
FT                   IRPEAGEIDVDIYLHSPDGPASRWARGARVGETLVITGPDIRNGWTGYGIHWQPPEEYT
FT                   SFLLVADETAIPAVRNIALSLPPTARGIAIVEIGDHADDVTVAGLSPQVDVRVVGRGKT
FT                   EDAVRAWATPDVDVAWLAGESGVVTTSRRVLVREVGVPRERVAFLGYWREGGALVD"
FT   CDS_pept        complement(195328..195804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0193"
FT                   /product="hydrolase of the alpha/beta superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0193"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73157"
FT                   /db_xref="GOA:E8N8U8"
FT                   /db_xref="UniProtKB/TrEMBL:E8N8U8"
FT                   /protein_id="BAJ73157.1"
FT                   /translation="MASLFAAVGAAVAIPVGVLSGPPSAAWGAYVLLLAAELLLLATMI
FT                   LTLGREDAFEGVESLARVPAVLAWPLRVGCWIGGLVASLATVVMVVSAPSTEYPSTGSR
FT                   VALSLMAAVTLVAALFTGARVPGVAVGVLAAVAGLVVLIGVVRGVVGLVARASR"
FT   regulatory      complement(195818..195823)
FT                   /locus_tag="MTES_0193"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(196020..197885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0194"
FT                   /product="Asp-tRNAAsn/Glu-tRNAGln amidotransferase A
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0194"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73158"
FT                   /db_xref="GOA:E8N8U9"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036439"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:E8N8U9"
FT                   /protein_id="BAJ73158.1"
FT                   /translation="MNAPRSAPATAAVKGTPVRRTTIGTVVTALTAAALVFGTVVPAHA
FT                   DTDSVSYLAPAYQRGELTGDAKVDRDDLSVLMSAVGRKVGDPGWDAVAPADADQDGVIT
FT                   VADVAALSKRFVYDDDPFDLQETDVVAIQKAMTAGVLTSQELTAQYLRRIAAYDRTTGL
FT                   DPFEPDAALASIIATNPTAMAEAAALDAERAATGPRSILHGIPIIAKDNINLAGLATTA
FT                   GCGCLADNVTSTDADAIERLKAMGAIVIAKANLSEFAQHTTVSDSAYGSTRNPFGLALP
FT                   PGGSSGGTGASISANLGVVGLGTDTGGSIRVPASTNGLVGLRPTTGLVSREGVIPLDEY
FT                   RDTIGPMTRNVSDAALALDALAGTDPADPMTAPADAHKPVSYAQALDPEALRGARVGYL
FT                   SGFGWDEKQPGSLALVTEARADLETAGATVVDIGEYGIGLDGVHGSRSFAHDMDMYLDT
FT                   FYKPGYTFLDLAQKIIDAEKAGTPLSSFPGETVREWASTTAAEREKFTADFLVLQRSMR
FT                   DRVDQLMAENDLDAIVYPSTSGTVGTAGSNNIISAFTGYPAITVPMGLAPLPPEAPAYA
FT                   GFPEGLEFLAGPYAEEKLFGLAYAFEQRTHHRQEPPLFPDLPPAP"
FT   CDS_pept        complement(197882..199015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0195"
FT                   /product="predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0195"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73159"
FT                   /db_xref="GOA:E8N8V0"
FT                   /db_xref="InterPro:IPR008965"
FT                   /db_xref="UniProtKB/TrEMBL:E8N8V0"
FT                   /protein_id="BAJ73159.1"
FT                   /translation="MPRLRSRWLVPLLSMIGAITFLGSATPAAMAAESSPTLRATLSAE
FT                   EGATGDTLALDLGVTGATDLYAATVRIAYDADRVALDPGAVTSDFPGMFSVSGVEGAID
FT                   FTVTRLGTSSGRTGDLSLGSLGFVAKGPGEALLRIDQVTLVDSALVGTTLAPSIGLTYT
FT                   VASSPSTPEPSAPGEQAVPPTVSVTGYGSGVPRGGDTTFRGSAPQSSAAPTATPPRITA
FT                   SSLTPRVGETITLTVRGLTPDAAHRVELHSDPLLLGEATTDEAGSFLLEATIPAAAPTG
FT                   EHEIVVLARGLAVASLPITIRAADGATSAPRASATPSAGADGDTQDAAADAAPTSADST
FT                   AALVWGLAAVVVVLGGAAIVLMRRRSRRAAGDHGGRA"
FT   regulatory      complement(197893..197898)
FT                   /locus_tag="MTES_0194"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(199024..199029)
FT                   /locus_tag="MTES_0195"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(199324..199911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0196"
FT                   /product="cytochrome c-type biogenesis protein CcmE"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0196"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73160"
FT                   /db_xref="UniProtKB/TrEMBL:E8N8V1"
FT                   /protein_id="BAJ73160.1"
FT                   /translation="MSIRRSAISAAIIAAAAVGLVGCSTTGSVHMDGSRSELYDSVQGI
FT                   SADSSLVAAVEVTGQEVLAASSDRDIPYTLSTVSLISTFAPTGLARELPEGVTATAAKP
FT                   GNQIVVRQMGTAEMETPAPILKTGEKYLLFLTPSMLEGEAASQYYVTGGSAGVFEAPDD
FT                   VASRGSDLAFTHGPYDEGDTLPETLTIKDLAP"
FT   regulatory      complement(199919..199924)
FT                   /locus_tag="MTES_0196"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(199924..200457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0197"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0197"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73161"
FT                   /db_xref="GOA:E8N8V2"
FT                   /db_xref="InterPro:IPR001818"
FT                   /db_xref="InterPro:IPR021190"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="UniProtKB/TrEMBL:E8N8V2"
FT                   /protein_id="BAJ73161.1"
FT                   /translation="MMSTLREKVIASSLGLLFAAAAIVVPGAAASAYTLTGCSWGPYGN
FT                   NVTWLNQAPSGDYYNTGTSAGYSWAANTDINGMSPSNGLLVGYTDNKGANGYDGWTTWG
FT                   CNGNRTTYANATLNPHYMDSKSYAIKKTVWLHELGHALGLNHSGSNAVMYSCAACTGFG
FT                   WPQSDDINGINSLY"
FT   regulatory      complement(200464..200469)
FT                   /locus_tag="MTES_0197"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(200842..201495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0198"
FT                   /product="soluble lytic murein transglycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0198"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73162"
FT                   /db_xref="UniProtKB/TrEMBL:E8N8V3"
FT                   /protein_id="BAJ73162.1"
FT                   /translation="MIPRRPAALSVLILAATALVGCTGIDPGNDAPDEPAPQVVDSGTA
FT                   TEAPDGTDATTVPASGSYPTCDEVKAALGPEVAELVVLPESENGERDGSSGHELACTWM
FT                   TPQTAQQSFDINNYGGISLGIMRDPSYVEKDYDDLGWTIDDPRLAADDAWGLTAGGQYD
FT                   PAAQVNITSVQVVRDGTVEVIAGGGVALQDVPELAALTEGWAVGAGLSVLDLMR"
FT   regulatory      complement(201505..201510)
FT                   /locus_tag="MTES_0198"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(201674..203398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0199"
FT                   /product="thiamine pyrophosphate-requiring enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0199"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73163"
FT                   /db_xref="GOA:E8N8V4"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:E8N8V4"
FT                   /protein_id="BAJ73163.1"
FT                   /translation="MTTVAENIVASLRRQNIERVYGLPGDSLNGFTDAIRRDGVIRWQH
FT                   VRHEEGAAFAAAAEAELTGNLTVCAGSCGPGNLHLINGLYDANRSRVPVLAIAAHIPTA
FT                   EIGTNYFQETHPQELFRECSVYVEYVADPVQMPRLLEIAMREAIEKRGVAVLVIPGDVL
FT                   LAKAKNERVVAIERATPRILPSEEELRRTADVLNAAQKVTILAGAGVAGAHDEVVALAE
FT                   RLQAPVVHALRGKEHIEWENPYDVGMTGLLGFSSGYRAMEDADVVLMLGTDFPYPQFYP
FT                   QQATHIQVDIRGAQLGRRHPVDIGLVGTVHDTVEALLPLLTEGKSSRHADEAREHYRRT
FT                   RAKLDDLAVPTGRGKPLHPQFVARTLDRLAEDDAVFIPDVGSPVVWAARYLTMTRGRRL
FT                   IGSFSHGTMANAVSHAIGAQSAFPDRQVIALAGDGGLAMLLGELITIVQNELPVKVVVF
FT                   DNSSLNFVELEMKAAGFVTFGTDLKNPDFAAVAEAIGLKGFRVDDADDLEGALSAALAH
FT                   EGPALVSVKTARQELSMPPSVTLEQAKGFTLYAIRTVLSGRGDELIDLAATNFRQLF"
FT   regulatory      complement(203405..203410)
FT                   /locus_tag="MTES_0199"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      203494..203499
FT                   /locus_tag="MTES_0200"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        203502..204401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0200"
FT                   /product="Trk-type K+ transport systems, membrane
FT                   components"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0200"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73164"
FT                   /db_xref="GOA:E8N8V5"
FT                   /db_xref="UniProtKB/TrEMBL:E8N8V5"
FT                   /protein_id="BAJ73164.1"
FT                   /translation="MSVALVPYPLPPGWNLRPARPRSRLTTGVLVVSCIVLAAALWGAV
FT                   VAGQTILAMVVALVLLGFIAVVAVGGERAGGERALPEFVNALALTRAETRPVDSWVSFF
FT                   RQRAPTLWSCLWLLGGGSATTAACGILIVRCVVEGGQALLGLVFLVPLTLAAAIVALAG
FT                   ANSLAVRGRARWFARRPRGLVVGRSGVTLYSFDRGDYDRSWSWDVIVDVVPSGLVDARR
FT                   GNTVPELKLHVVGTDGAAEEHHVPVDSLASHAWLVYAVLRFWREHPELRDELDTSTAQE
FT                   RMESWMTGLSKAADAQGA"
FT   CDS_pept        complement(204398..205162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0201"
FT                   /product="AraC-type DNA-binding domain-containing proteins"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0201"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73165"
FT                   /db_xref="GOA:E8N8V6"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:E8N8V6"
FT                   /protein_id="BAJ73165.1"
FT                   /translation="MRAWHPAVPMLREVYHASFAHSYPPHTHDDWAVMLVDRGAVTYAL
FT                   DRAEHQATPTAVTLLPPGIAHDGRPAVDGSGYRKRVLYLRGDWLDPGIAARIADRPTLT
FT                   NAPAQTAAHRVHAALAHPGDEMAAEHWLLTVRDAVLVHAGSTAPARRDAPLARRLRAML
FT                   DDRYTESFTIAEAAALLGAHPDHLVRVFSSAYGIAPHRYLVGRRVDAARRLLGEGCRPA
FT                   DVAARTGFHDQAHLARHFRRVWGVTPGAIRAA"
FT   regulatory      complement(205169..205174)
FT                   /locus_tag="MTES_0201"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      205213..205218
FT                   /locus_tag="MTES_0202"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        205224..205658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0202"
FT                   /product="uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0202"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73166"
FT                   /db_xref="InterPro:IPR018988"
FT                   /db_xref="InterPro:IPR023476"
FT                   /db_xref="UniProtKB/TrEMBL:E8N8V7"
FT                   /protein_id="BAJ73166.1"
FT                   /translation="MTDASPAPLFDTKVVVVLGDDLAPWQELNVTAFLMTGIATSAPDL
FT                   VGEPYRDGDGTTYLPMLRQPVMVMTADAETLARARAKAAARDDVALALYTRELFTTSHD
FT                   AANRAAVAAVAAADLDLVGVALRGPRNAVDRITKGARFHV"
FT   CDS_pept        complement(205694..206359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0203"
FT                   /product="response regulator containing a CheY-like
FT                   receiver domain and an HTH DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0203"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73167"
FT                   /db_xref="GOA:E8N8V8"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:E8N8V8"
FT                   /protein_id="BAJ73167.1"
FT                   /translation="MTTVIVVDDQALIRTAVRDLLDAAEGISVVGEAADGEAGVDLARR
FT                   LRPDVVVSDIRMPRRDGIELTALVCDDPALTETRVLILTTFEEDDYVVAALRAGASGFI
FT                   GKGAEPEDIVRAVLSVHEGGALLSPAATRALIEKYVRTTGAADVPSPVSLDALTDRERE
FT                   VLLHVARGRSNDEIAAHLYISPHTAKTHVKNTMLKLGAHDRAQLVIAAYESGLLAPGR"
FT   CDS_pept        complement(206356..207654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0204"
FT                   /product="signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0204"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73168"
FT                   /db_xref="GOA:E8N8V9"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E8N8V9"
FT                   /protein_id="BAJ73168.1"
FT                   /translation="MRPDETSDAVPRWPWAGRPWLIDVFVVVLVAGPAFAPIPFAEMRP
FT                   SSPLAFVLVLLPALALPLRRRLPRTVLAVCVAAWAMALTLGTLSPGGAVAMVVATYGVA
FT                   HRTPRRSSIIATTAAVLVILTTGVIVSLVTGMDTRVLQVALSLALAGALGDAARSRRAY
FT                   VEAVVERARRAEETRESEASRRVTEERLRIARDLHDAVAHRISVISLNAGVATSMLEAR
FT                   PDRARDALATIRTASRDVLGEIGTMMSVLRAPDDAPVRIQPGLARVPEIVESVRVAGWD
FT                   VVVRDEIGTDAEAAGIPLGVDIVAYRVVQEGLTNALKHGTTRRAHVLLRRDGEDLEVVV
FT                   TNPIERVPEASAEDLPPSGFGLVGLRERVDAVRGTLEAGLAPGGYRLAARLPLTARTAP
FT                   PARTPAHGEIPAMPAAPPAPTAPSSVPSPERAS"
FT   regulatory      complement(206366..206371)
FT                   /locus_tag="MTES_0203"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(207658..207663)
FT                   /locus_tag="MTES_0204"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      207776..207781
FT                   /locus_tag="MTES_0205"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        207787..208494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0205"
FT                   /product="ABC-type antimicrobial peptide transport system,
FT                   ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0205"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73169"
FT                   /db_xref="GOA:E8N8W0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E8N8W0"
FT                   /protein_id="BAJ73169.1"
FT                   /translation="MASDPPPPLLSVTDLHKSYGRGSARFDALRGVDLDIHRGESIAII
FT                   GKSGSGKSTLMHLLALMDAPTQGTVRLDGVDATTLRGRRLNRTRNQTFGFVFQQFFLTP
FT                   SASVFDNVVLPLKIAGVGRAERARRGKAALAELDMADKARNKATALSGGQKQRAVIARA
FT                   LVNDPQVIFADEPTGNLDTATGAVVEDILFRLNREHGITLIVVTHDEDLAARCDRRVQI
FT                   RDGLIVADERSAA"
FT   regulatory      208478..208483
FT                   /locus_tag="MTES_0206"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        208491..209789
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0206"
FT                   /product="ABC-type antimicrobial peptide transport system,
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0206"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73170"
FT                   /db_xref="GOA:E8N8W1"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:E8N8W1"
FT                   /protein_id="BAJ73170.1"
FT                   /translation="MRTVDLVSTAVANTFRSKTRTILTVLAIFVGAFTLTITNGLGTGI
FT                   NAFIDSTVSSMGASDVLTVTKTTAATSTGPQKYDPDAVASAQQTGGRPGGAGEVTALTD
FT                   QDIADISAIAGVEKVVPVTSVSIDYVEAAGGDPYVAQVGSLVAGQTPQIADGAAPDDGS
FT                   DALQVALPSALVTPLGFADAADAVGATVTIAVTDPVRTQHLVEATVSGVTEDAFGGTTS
FT                   LTTNSALEKTLFTLQNTGVPADQLDRYASASATVSSSATPAEIDQVKAALTDAGYTGTT
FT                   VEDQLGTFESVINGIVLVLNAFAIIALLAASFGIVNTLLMSVQERTREIGLMKAMGMGS
FT                   GRVFSLFSLEAIFIGFLGSALGAVIAIGVGTAVSAQLAASLFSDLPGLQLIAFDPVSIL
FT                   VTTLAVMGIAFLAGTLPAARAARADPVESLRYE"
FT   CDS_pept        complement(209860..210213)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0207"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0207"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73171"
FT                   /db_xref="GOA:E8N8W2"
FT                   /db_xref="InterPro:IPR003844"
FT                   /db_xref="UniProtKB/TrEMBL:E8N8W2"
FT                   /protein_id="BAJ73171.1"
FT                   /translation="MTTARIVVLFIVAALAEIGGAWLIWQAVRENRGWWFALLGIVALG
FT                   AYGFFAALQPEANFGRVLAAYGGVFIAGSLAWGIVVDGFRPTTWDYVGSAIALVGAAII
FT                   MFAPGQTTAGEIS"
FT   regulatory      complement(210217..210222)
FT                   /locus_tag="MTES_0207"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(210221..210859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0208"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0208"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73172"
FT                   /db_xref="GOA:E8N8W3"
FT                   /db_xref="UniProtKB/TrEMBL:E8N8W3"
FT                   /protein_id="BAJ73172.1"
FT                   /translation="MVRGYYGLLAAALLAALIGQCILTASEGRSLANTFSFFTIQSNVL
FT                   VLVSSALIAWRPAELTGAWWRILRLAALVGITVTGIVYVLFLARSIHLTGLASVYNQMF
FT                   HHASPFLSLVGFLVIEPKQRFVWRDYAFLAWPVLWLVYTMVRGAYFHPQFTGFTPKPSD
FT                   YPYPFLDVTEVPMTEVVGSIAFVFVLLVVIGGGYILGDRAKPFRLRSPG"
FT   regulatory      complement(210862..210867)
FT                   /locus_tag="MTES_0208"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(210946..211923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0209"
FT                   /product="predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0209"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73173"
FT                   /db_xref="GOA:E8N8W4"
FT                   /db_xref="UniProtKB/TrEMBL:E8N8W4"
FT                   /protein_id="BAJ73173.1"
FT                   /translation="MTRTPAGPLARRVLWHPLPWAIVSFAGALLLFGVAQEFWGFLLSL
FT                   VAGWAFAQTVLHGLALLRPRGVSVAAHVTLAAVAGLALFAVAQPGEWPVPPTVRSALSF
FT                   AALTFSGWIWLSLIGRVTGAVQAGSERRAAELVEPAWERSGSEWTLRLPVVPLRRSSYL
FT                   AIGAVLGVLAAGAMGTFVVVFTDLAQRLGPMAMLLVLGWTVGFPVYLVVRALARARTTA
FT                   VDLCLSAERVRVRTIGGDTLMDAGTDGIRTLFVSSRNPPTRVVVRPVEGPGLVLLVGMA
FT                   RRPKGAAATVPELPRRLQHALEAAGLRAVAGRRARAGERAFERA"
FT   regulatory      complement(211930..211935)
FT                   /locus_tag="MTES_0209"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      212109..212114
FT                   /locus_tag="MTES_0210"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        212123..213148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0210"
FT                   /product="uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0210"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73174"
FT                   /db_xref="InterPro:IPR011201"
FT                   /db_xref="InterPro:IPR031321"
FT                   /db_xref="UniProtKB/TrEMBL:E8N8W5"
FT                   /protein_id="BAJ73174.1"
FT                   /translation="MKSFRCRVCRNALTFENSVCVSCHTPLGFSRDEAEIVPVDENGRY
FT                   VDAEERTWHVCRNLNLSGCTWLAPVEGGQCSACDLTRVRPNDADAKGLSQYPVAERAKR
FT                   WLLVDLDRLGFPVVGKAEDPERGLCFDLLSSVAEDVTIGHADGVITIDLAESDDAYRVR
FT                   VQEQLGEPYRTMLGHFRHESGHYFEWILVEGTDRLAEARALFGDETADYQAEIDRHYSE
FT                   GPPADWPERFISTYATMHPYEDFAETWAHYLHITDTVETATVYGLSRVDDAPASARFRE
FT                   FVTEVWMPLANALNMVNRSMGKDDLYPFLLPDPVLDKLDFVASLRESGSGEPLRGDGET
FT                   P"
FT   CDS_pept        complement(213180..213836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0211"
FT                   /product="response regulator containing a CheY-like
FT                   receiver domain and an HTH DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0211"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73175"
FT                   /db_xref="GOA:E8N8W6"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:E8N8W6"
FT                   /protein_id="BAJ73175.1"
FT                   /translation="MREEPPIRVLVADDQAIVREGLATVLALLPDVEVVGTAADGEEAV
FT                   ALAVQRHPDVVLMDLRMPRLDGVAATARLVVDVPSAAVLVLTTFADDESIVAALTAGAK
FT                   GYLTKDAGRAELAAAVRSVARGQAIFSAEVGATIVDSLTRPRPTTSPGEGLAARFPRLT
FT                   RREIDVLALLVEGCTNAEIAERLFVEVSTVKTHVIALFAKLGVRDRRAAVALARR"
FT   CDS_pept        complement(213833..214984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0212"
FT                   /product="signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0212"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73176"
FT                   /db_xref="GOA:E8N8W7"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E8N8W7"
FT                   /protein_id="BAJ73176.1"
FT                   /translation="MTPRPTALGAALTVFGAALCTWGLFSASRPPWALALALLALAAWV
FT                   VRTALVFVPQPVAARAARVAALCAVGAGALAGTSTGANSLIPATVCAMVLVADQTVSVV
FT                   AAAVTAGGGVALVAVGAVLWPTSVPAFAGMVAAVLVGALAGFSRRQGAQARRREALLAE
FT                   RERALREEAGRNELARDLHDVLAHTLGGLVVQLDAAEALLEAGDASSAHRRVTSARELA
FT                   ASGLGEARRAVTALRQPREPGAEAAHRDPVASVDLDRRLDELVEMHRALGGEIAWERSG
FT                   VPAPLDRAQADALHRALQEALSNVRRHAPGCAVTARLAWRPRAVRLSIENPLPPSRQSA
FT                   PSATEGFGLRGMRERVNALALGGTVTAGPQAGSFVVTVEEVLA"
FT   regulatory      complement(213844..213849)
FT                   /locus_tag="MTES_0211"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(214990..214995)
FT                   /locus_tag="MTES_0212"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(214992..215522)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0213"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0213"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73177"
FT                   /db_xref="GOA:E8N8W8"
FT                   /db_xref="UniProtKB/TrEMBL:E8N8W8"
FT                   /protein_id="BAJ73177.1"
FT                   /translation="MNLETLADIVLIVLLVGWLGYRQTTWRPVSPAKLWRTPLILAALG
FT                   VVNLARGDLSISGLDVAVLVIELVLALGVGAWMGALAHFRPLEQRVTGRGGEGAVVESR
FT                   TGGWGLALWAALLLVRVGLDVAATAMGAHAVTGAGVILLVFAANRAARNLILGARLGDL
FT                   PVGGARPPRITAR"
FT   regulatory      complement(215533..215538)
FT                   /locus_tag="MTES_0213"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(215594..216262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0214"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0214"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73178"
FT                   /db_xref="GOA:E8N8W9"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E8N8W9"
FT                   /protein_id="BAJ73178.1"
FT                   /translation="MPDLRRVPLADQAADVLLERIRAGEWALGAKLPGETTLAPQLGVG
FT                   RSTVREAIRQLAGRGVLDARQGSGVYVTALDAPEDWDRVLRRAHIVTVLEARAAIEVEA
FT                   AALAAARRTPADLRAMKRALAERTAPGQSIEEHVDADMVLHRAIVVAAHNEVLAEMFDG
FT                   FVPRVRRAMVDMLRLRPAADEAADQDAHADVVAAIAERRADVAAAATRAHLDALRAGFA
FT                   "
FT   regulatory      complement(216267..216272)
FT                   /locus_tag="MTES_0214"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      216416..216421
FT                   /locus_tag="MTES_0215"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        216426..218147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0215"
FT                   /product="isopropylmalate/homocitrate/citramalate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0215"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73179"
FT                   /db_xref="GOA:E8N8X0"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR005668"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036230"
FT                   /db_xref="InterPro:IPR039371"
FT                   /db_xref="UniProtKB/TrEMBL:E8N8X0"
FT                   /protein_id="BAJ73179.1"
FT                   /translation="MTTWNRQRPSRMPSHRYTDVYSRVDIPLADTERRWPTRRITEAPL
FT                   WVPVDLRDGNQALSEPMDPDRKRLFFDLMVRMGYTEIEVGYPSASQTDFDFVRLIAERD
FT                   IAPDDVTIVVFTPARRDLIERTVASIDGIRNDVVIHLYTATAPTWRDTVLGKDRDELRE
FT                   LILAGGRDVRELAGHLPNVRFEFSPEVFTLTEPDYVLEVCDAMTELWDATPERPVILNL
FT                   PATVEVATPNVYADQIEYMHTHLARRDAVILSVHPHNDRGTGVACAELAVLAGAQRVEG
FT                   CLFGNGERTGNVDLVTLALNLHAQGVDPMIDFSDIDAIRRTVEHCNRLEVPARHPYVGD
FT                   LVHTAFSGTHQDAIRKGFAEHRARALAEGRDERDIAWRVPYLPIDPADIGRTYDAVIRV
FT                   NSQSGKGGIAYLLETEYGLELPRRLQIDLSHQVQRHTDRTGDEATADDIWAIFTGAYLS
FT                   VPEGAVRVSSLHVGTGADVTVEVDGTAYHGVSETGPVGALVGALALGGIELEILSLHQS
FT                   SLRAGADAEALTLLEYRGPAGPAWAAGRDGSVLSATVDAVVRAANAVAAAREVVGS"
FT   regulatory      218137..218142
FT                   /locus_tag="MTES_0216"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        218147..218494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0216"
FT                   /product="uncharacterized protein conserved in archaea"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0216"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73180"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="UniProtKB/TrEMBL:E8N8X1"
FT                   /protein_id="BAJ73180.1"
FT                   /translation="MTVVHLFHDDPDSLLIGSRLPRRMAEAASPDDPPLEVFVFGAAQR
FT                   RLGRDDTDLDRRFNAQVDDLLAAGIPVGACLTLARADGLEDALTTRGLTLTVARDAFLR
FT                   YAREGATVIGF"
FT   CDS_pept        complement(218523..219362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0217"
FT                   /product="nucleoside-diphosphate-sugar epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0217"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73181"
FT                   /db_xref="GOA:E8N8X2"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E8N8X2"
FT                   /protein_id="BAJ73181.1"
FT                   /translation="MRIFVAGASGVLGRAFLAEASAVGHDVVGMTRTDRGADAIRALGA
FT                   TPVVADAFDAAMLTRAVGEARPDAIVDLLTDLAGGDSASNARLRTIGTRNLVDAARAAG
FT                   VDSVVAESISWVYPSHPDIATEDTPLDIDAAEPRRTTIQAIQTLEETVRQIPRSVVLRF
FT                   GQLYGDGTWFSPAGRFGQAARDGVLPATETVASFIHVCDAARAALLALDGPAGTWNIVD
FT                   DEPATGIEWAPVFARAVGAPAPEARESGDIGRPVSNARARAWGLDLRYPTWRDGFGR"
FT   regulatory      complement(219374..219379)
FT                   /locus_tag="MTES_0217"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(219427..220032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0218"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0218"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73182"
FT                   /db_xref="GOA:E8N8X3"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR039536"
FT                   /db_xref="UniProtKB/TrEMBL:E8N8X3"
FT                   /protein_id="BAJ73182.1"
FT                   /translation="MPDTARKRGRPTEGERAQRRDDILDAAVRLFLDLGFEAVTLDAIA
FT                   AAARVTKRTIYSYIGDRTEVFLAAVERLGETALLDLSPEDGLEERASTIVRTLHADDAV
FT                   GLHRLVIAESRRRPDLAERFYARGPRRYITALAERLPGRDEARAEALFALLLGEAHRRR
FT                   LLGLQAAPDEVESIAHARAALASLHLATHVRATREPST"
FT   regulatory      complement(220041..220046)
FT                   /locus_tag="MTES_0218"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      220120..220125
FT                   /locus_tag="MTES_0219"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        220131..221228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0219"
FT                   /product="pyruvate/2-oxoglutarate dehydrogenase complex,
FT                   dehydrogenase (E1) component, eukaryotic type, alpha
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0219"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73183"
FT                   /db_xref="GOA:E8N8X4"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR017597"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:E8N8X4"
FT                   /protein_id="BAJ73183.1"
FT                   /translation="MPTPRPPRSTARRATKRPTAVELRALYREMLLIRRFEERAARAYS
FT                   EAKIGGYCHLNLGEEATVVGLMAALEPGDYLYANYREHGYALARGISPERAMAELYGRT
FT                   DGVSKGWGGSMHMFDLDARFMGGYGIVGGQVPLATGTALAIHYRGEDDVVMCLMGDGTT
FT                   NIGAFHESLNIAALWNLPIVYVVNNNGLGMGTTVEQSSAEPELHRRASSYRMPSARVDG
FT                   FDPGAVREAARIARDSARAGTPYLLETMTGRMKGHSVVDPARYRTAEEAAAAKAADPVA
FT                   AFAARLRADDVLSADDLDALDREVTAEVTAAAAFADASPHPDVSTLFDYTYATPVPNDA
FT                   RRLPGEALFPAAPRPARSLPEEVSA"
FT   regulatory      221212..221217
FT                   /locus_tag="MTES_0220"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        221225..222217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0220"
FT                   /product="pyruvate/2-oxoglutarate dehydrogenase complex,
FT                   dehydrogenase (E1) component, eukaryotic type, beta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0220"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73184"
FT                   /db_xref="GOA:E8N8X5"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR027110"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:E8N8X5"
FT                   /protein_id="BAJ73184.1"
FT                   /translation="MSVISYRQALHDALRSEMQRDADVFLLGEEIGLFEGSYKITAGLL
FT                   AEFGPTRVRDTPIAEEGFTGAAIGAAMVGLRPVVEIMTINFSLLALDQIVNHAAKIYGM
FT                   FGGQARVPLVIRTPGGGGQQLGATHSQNIELYYAFVPGMKVVAPATPADAKALMLAAIR
FT                   DDDPVLVLENLALYNTTGEVPDDIAPAEIGRAAVTRQGTDITVVAYSRMAVVALEAADR
FT                   LAAEGIDVEVVDLRSLRPLDRDTIIASVKKTTCAVTLEDDWLTYGIGAEIAATISDGAF
FT                   DWLDAPVRRVAMAEVPMPYAKTLETAALPSVDDAVTAIRETLDAVARRR"
FT   regulatory      222225..222230
FT                   /locus_tag="MTES_0221"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        222239..223429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0221"
FT                   /product="pyruvate/2-oxoglutarate dehydrogenase complex,
FT                   dihydrolipoamide acyltransferase (E2) component"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0221"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73185"
FT                   /db_xref="GOA:E8N8X6"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:E8N8X6"
FT                   /protein_id="BAJ73185.1"
FT                   /translation="MIDILMPRLSDTMTEGAIAVWRKKPGDPVAPGDVLLEIETDKALM
FT                   EQEAYDAGTLVEILVPEGENVAIGTPIARLDDGKEPAPLASSERADLPAPAAPRAPEPD
FT                   ATPPAPPHGRATPLVRRLAKEQGIDLSSLTGSGPGGRIVRADLDAAAEAPASPVPSGEG
FT                   AESPADITRIPFDGIRRAIATRLSDSAATIPVFHATAAADVTDLLALRTQLNAVGDTRI
FT                   SVNDLVVKAVALALRDHPGINAAYSPDDGGQTVIHHGIHVGVAVAAPSGLVVPVVRDAD
FT                   RSSISTIARRTRELADRAAARTLTVDEMNGGTFTVSNLGMFGVEHFTAIINPPQGAILA
FT                   VGGITDELALVDEGVVARRRLRVTLTCDHRIIDGAAAGRFLAGLTAVLEAPLRVLT"
FT   regulatory      223570..223575
FT                   /locus_tag="MTES_0222"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        223579..226251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0222"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0222"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73186"
FT                   /db_xref="GOA:E8N8X7"
FT                   /db_xref="UniProtKB/TrEMBL:E8N8X7"
FT                   /protein_id="BAJ73186.1"
FT                   /translation="MVPAVAVALAALSAGLGQVAQAHILAQPDKPITFVVDGDLPFGIT
FT                   QETMDAAARGRALSYEPFTVLVVERDLTWDEYENGELPRGADVMVSVGIDPEDPDLVLP
FT                   DASRASVAKRLKGDGWNPNYSAAVDIREAFLNNVTQGQGPGAVVGAALTAASRAFDGGP
FT                   RSPVLWVSLAALPLLVGLFMMVLWARYLARERNRRRTFSRARLELARVVLELDLLEAHV
FT                   DIAGAELDRGARGRARDAAKDVKGKLQKDWAAIRKESLKLAHEEQVLARELLDPSTRVH
FT                   ERGAPEKPLDLATFAKRTAALRRRADALVAASSLRVGHAAGGTILGRIALTSTLAVDDV
FT                   LARPDLLSPAETETLSRQRGDLLALVREADTTFGADNGPEVVVRHVDLMTRWREAERRL
FT                   AVTLTRIEHRLEKKLPRGTTSHIAAGALDRRLQDRARIATGGAAESLDELRSSLDLTPR
FT                   KGLPPAPHAERILLIADALVAAKRGATPPRRAGSGIPVDRLAPDFIPLAVAGIPLVAAL
FT                   IAGFLATSAMERGDATYGRELTGDVPLASLEIVGDPALLPAFTNAEDAERDGPNIDTLT
FT                   LDFVRDAMERTAQRSDDDALLPERIDLVVPLLAIDDYVTVRPNPEVEDGVKLDYFEVLG
FT                   AYARIKAEVEAEVPGTLDPATGDVRAGHAILPLWIQKDGSYGVGLALTGTLSTGTESRL
FT                   GAYDFLATEPRFTNEPGEDWANPAGWVVASEMIKLGRQLEYNDLRVSSLSPAALFWVVA
FT                   LATWTGVQTLAMIVWSLAQLLLRGAGSRRTRAQLRELRDKLNALAMGLDLSRLDAVAVL
FT                   GTADGHRGQAAEADQQLSETVLFTAWREVQALEALPRREQRGPEWRQRVERMGTVIDAL
FT                   AVREAGVAERALVLVRSYS"
FT   CDS_pept        complement(226269..226754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0223"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0223"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73187"
FT                   /db_xref="GOA:E8N8X8"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E8N8X8"
FT                   /protein_id="BAJ73187.1"
FT                   /translation="MDYSFSMGYEHNPARESLPSAASEALVSAWYRMQVQNAHLLQRLA
FT                   VEHELNPIDLRALKFLGVDESPRTPKELATFLQVGSSLVSAVIERLESRQFIHRAPNPQ
FT                   DRRSTLLHLELRGVQVVEQLRSLYGRALSGLFGHPDQDAIVTATNQIEEGLRDAASF"
FT   regulatory      complement(226766..226771)
FT                   /locus_tag="MTES_0223"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      226927..226932
FT                   /locus_tag="MTES_0224"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        226941..227555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0224"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0224"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73188"
FT                   /db_xref="UniProtKB/TrEMBL:E8N8X9"
FT                   /protein_id="BAJ73188.1"
FT                   /translation="MRKAPATPSRRLGKIATIAVIPLSLIAAGALVSTASYSAFSATTS
FT                   NPSNNWSAGSVGLSNSSPNSAAFDATNLKPGSTGTTCVAVTSTGTLPSAVKLYATDASQ
FT                   SQGIGDWLNLTVTQGTGGGNGSCNGFSPIASGASVYDNTLTAFVNDATDYRSGVGSWAP
FT                   AGGDSPETRTFQITYSVSSNAPSSIMGATANVNFTWEAQNQ"
FT   regulatory      227635..227640
FT                   /locus_tag="MTES_0225"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        227644..228609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0225"
FT                   /product="signal peptidase I"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0225"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73189"
FT                   /db_xref="GOA:E8N8Y0"
FT                   /db_xref="InterPro:IPR001733"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:E8N8Y0"
FT                   /protein_id="BAJ73189.1"
FT                   /translation="MITARAALAVVFGMTFWAVAPLVIGWQTTTVMTGSMEPAIQPGDL
FT                   VVSRPIDPAELRPGQVILVTDPDHPGRLRLHRLHAVDGDELITKGDANPEADSSPVLRS
FT                   DVLGVGALRVPWIGIPIQQARDGDAVGLTSTVLGLVAIIGIALAPAIASGAGDPPEPDP
FT                   ELPERTPSRDAETRRVRSRTAAFVVAVTVAAVVAASPAHAAAFSARTQTSGSLQAATPV
FT                   APSDLTCANNFDGSVTIGWAYDAERPYNFEILVDGRGSIATLGPDARSIQLRANTPFSF
FT                   GRTSVVRVRTNLTQTWGATSSDSRSVTTVTILWVGVARCA"
FT   CDS_pept        complement(228637..229698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0226"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0226"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73190"
FT                   /db_xref="UniProtKB/TrEMBL:E8N8Y1"
FT                   /protein_id="BAJ73190.1"
FT                   /translation="MRILLDHPRVDVSSSMATITTDEEADGYDLSAPWADETNGLCGAG
FT                   VPGMLELITGTHTGYVPFRIELHESAPAVDPAWEEVVEVSFQSESDEAFLTGLMGEEFP
FT                   FDLPRGDYRVRYCASGFDEAMVSDDGTDSYLLQFWPAPPAPGRILVQTSERAEAWHRAR
FT                   RTIVPEEMDEQEILDAAERRDRARARWGDRVPNDRLMELVDAGSPLDVLTELDVDLEFA
FT                   IADADEITQRQIAAWAALRCLEASGLSGESLLEPAVDALRRGESAPPPFDELRYGWDVL
FT                   EWSRVRRTSVPAPPDGASRDSPEEWAIRALQYSTGRDSLISALQSVVCLAYVHGRDGYR
FT                   QAFADLRAEFRGV"
FT   regulatory      complement(229706..229711)
FT                   /locus_tag="MTES_0226"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(230117..230956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0227"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0227"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73191"
FT                   /db_xref="InterPro:IPR012654"
FT                   /db_xref="UniProtKB/TrEMBL:E8N8Y2"
FT                   /protein_id="BAJ73191.1"
FT                   /translation="MATSLSGPKRVEPFPMDFIKGVADILAQTEYPGLSNSEIDALLPM
FT                   AGILQREAGRNKRESLYITLNNKQYKQGLGNSVVVFINMAMSPARYMRDPNRFAQLSDQ
FT                   LSEFLVHYGYRINDRGQLARGTRASTLSEAAELAGTLHAELRRRGTHDELFRYCAEEFV
FT                   TRSLFHAISEASKSIPTRVRQITGLAGDGDALYNGVFGTRQDEPLLYMNRYENDSDISE
FT                   HRGFKNLLLGIHGHYRNPRAHSNRVDNTELLPDFYDAFSLFSYVHRRLDTASRQPIR"
FT   regulatory      complement(230968..230973)
FT                   /locus_tag="MTES_0227"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(231301..232302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0228"
FT                   /product="ribulose-5-phosphate 4-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0228"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73192"
FT                   /db_xref="UniProtKB/TrEMBL:E8N8Y3"
FT                   /protein_id="BAJ73192.1"
FT                   /translation="MRIIDSLETGTLNAARRMKAFGRNGYEQEDIGSVARDVAALWERS
FT                   LKAADLSWTGKHLFAITQLIQAAGWQGAASLDVIRQAANNDKHDASPNHEYDQLLSALD
FT                   VLGSSLDTLAVVTPALLNELPATLRVRRLVCAVYEVYHAGETVYSFLAADETDSWLTAD
FT                   GIDEFQVENRHTSEIEARLAALPSYTLNPAGLDDLKKSLLESDSELWQIMYMDASYQQI
FT                   HEILAPYQHKLPLLAGLHREDEEGNVVASIAQALITGVAPVVGPRSIVNIASISTALLA
FT                   VFAQVPSRLKPLRVDRCTPQEYRGLARNCVTFDDALGVMVTDRGVVLVRTGR"
FT   regulatory      complement(232308..232313)
FT                   /locus_tag="MTES_0228"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      232591..232596
FT                   /locus_tag="MTES_0229"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        232608..233057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0229"
FT                   /product="integrase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0229"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73193"
FT                   /db_xref="GOA:E8N8Y4"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:E8N8Y4"
FT                   /protein_id="BAJ73193.1"
FT                   /translation="MSADALSRSQCGWRVHDDLELDGRQSAAAELASVVGQLEYVTRVF
FT                   ETLRGTANTGIAVANVERIERGEQPLLPEMTLHGLRHMHASLLLASGADIALASKRLGR
FT                   SSISITSDLCTHLIGDAARRAAEGSSARSASECTTRAQRACPGRA"
FT   CDS_pept        complement(233286..233858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0230"
FT                   /product="retron-type reverse transcriptase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0230"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73194"
FT                   /db_xref="GOA:E8N8Y5"
FT                   /db_xref="UniProtKB/TrEMBL:E8N8Y5"
FT                   /protein_id="BAJ73194.1"
FT                   /translation="MLVWEIVRSNLDAATVSSLPFAPTILGVAPAATLVAAMTTLLLAR
FT                   TQYARVSRPYISGHSKGWIRVRRRRAWTLILQNVGAGVARVRSVRYGIVPAAVEGWLWW
FT                   PVPEARDNLAMLGLRPGVDFDLHEISPGFAMKPSMGIADGLEMFTLSERGSNALQVFAI
FT                   QLEFEDQVGDVYIWERDFASVLRLGRA"
FT   regulatory      complement(233865..233870)
FT                   /locus_tag="MTES_0230"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(233960..235000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0231"
FT                   /product="arylsulfatase regulator"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0231"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73195"
FT                   /db_xref="GOA:E8N8Y6"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:E8N8Y6"
FT                   /protein_id="BAJ73195.1"
FT                   /translation="MYTGPDQSWRDLPVFMSVETARAVLQDIAQYADEVGLGSVSIVFH
FT                   GGEPMLFPASAYRELLKLIDSELTSVGVTANLSIQTNATILRKETLSALLDAQVGFGVS
FT                   ADLSDASHDSHRVDKMGRGSMARVRLGISAIRDASANSEPQGGLFVIDPSVEPKAALER
FT                   IESLGFPFVDVLLPDENWDSADEAELAATYGPWLLELFDLYVSTPRTFQIRWFQTVFKL
FT                   ALGGVWGSDSLGLRSAGTLIVETDGRYVLHDVLRTASYEVNSTNRVAGQREISEIAELP
FT                   GMRAMMDKGSFLHSRCAGCDNLSLCGGGHIAHRYSTDHGLDNPSVYCSALMPLYERVRD
FT                   LTRTGA"
FT   regulatory      complement(235007..235012)
FT                   /locus_tag="MTES_0231"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(235095..235334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0232"
FT                   /product="uncharacterized N-terminal domain of the
FT                   transcription elongation factor GreA"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0232"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73196"
FT                   /db_xref="GOA:E8N8Y7"
FT                   /db_xref="UniProtKB/TrEMBL:E8N8Y7"
FT                   /protein_id="BAJ73196.1"
FT                   /translation="MGPLLPSAIVLALSSRTREHSFIVQERTGGVQMSDKLKSDLEEAA
FT                   SRAVAEASAAESGMTIQTQWSSWTRSGVMPATSE"
FT   regulatory      complement(235338..235343)
FT                   /locus_tag="MTES_0232"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(235368..236708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0233"
FT                   /product="reverse gyrase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0233"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73197"
FT                   /db_xref="UniProtKB/TrEMBL:E8N8Y8"
FT                   /protein_id="BAJ73197.1"
FT                   /translation="MPNELLTGTRRTGDFFDNDPDTPTTRVALERSDEGISIEVGWSTR
FT                   ESPYARWFVGKTGLELPPAQPPEPKDAPKRVLFHDSHGSVLLVGCYPRGFHANIWGPGT
FT                   GRLWARAAIMGVEEIVAFDEPHGLQSEISGLREWLGISSWARTQDIDLRESRVQVSIDS
FT                   VENPMITVGTVHGLTLQFRPGRGIKIEQGEDRVVLNDLVRCTTESASAQQWDAHLQVHK
FT                   GVRDLLVLSRWWEESCVPVRATRNDDPMRTLDGRTHGIQWREVVVPNDERKKPPRTYRQ
FT                   HLIPYSELGESGVASWLALRDDFARALDPVISSIDLPGATPFTRLAHTGPGLEALGYLL
FT                   AVRDGMTERKAGQQPLNERLNRILDNVGECLPFDGPTWADDTVRVYNGVKHANRAAPDI
FT                   VDILNVWRQAVLVVRAWVALELGADQTELTRRLAEDRQAIPYEKRTS"
FT   CDS_pept        complement(236668..237069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0234"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0234"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73198"
FT                   /db_xref="UniProtKB/TrEMBL:E8N8Y9"
FT                   /protein_id="BAJ73198.1"
FT                   /translation="MTPQGGRKGDQNHGFDAFQGVKSASAQLRDRGKSTFSSHPVRLAD
FT                   KGDIKWTSIGTREYVPREALVGFIKETPIAATVAATHAERPKARLCPRSARLGLEAPGE
FT                   RYRETPASAGSIEGIVDAERTPHWYPADG"
FT   regulatory      complement(236715..236720)
FT                   /locus_tag="MTES_0233"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(237080..237085)
FT                   /locus_tag="MTES_0234"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      237302..237307
FT                   /locus_tag="MTES_0235"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        237316..238932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0235"
FT                   /product="DNA-directed RNA polymerase, sigma subunit
FT                   (sigma70/sigma32)"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0235"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73199"
FT                   /db_xref="GOA:E8N8Z0"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:E8N8Z0"
FT                   /protein_id="BAJ73199.1"
FT                   /translation="MNRDDYRSDRTDAPASVSGNVGPPRDTLPMDLSPEKPAVERSAVV
FT                   LLSRLGERWSQAEYAQLAEELRLGLTVSEIAEAHGRPAGAISAACNRLLPAEEQPRSRR
FT                   HAPAALTRYLAEHPDERLVIQRTASGRSRRGSDDAILLVRPSAGLLPVTEALLEPGDAA
FT                   ALLSEALAGLEGKPREQKILRMRVGFEGAPRTLAEIAREFDLSRERIRQIESRARNILV
FT                   HQARTPGSPGSVLASLLHLPSADLVDEAFAGRIATIAMSEFEAPSRVTIPLLLSAAGVT
FT                   SPIARQLAVLARATEDRFQELERERRRVEAAERRLAAVVQRADSAVARWNEHASWPVTL
FT                   NPPPVRGTLRALRLGGSGEAAGSFHFDKLRREVFYESSLELTALSFLENSTDIAWYQEQ
FT                   PLAIPYTWRGRPHVYYPDVLAATRTGQCLIIEVKPLVNMPIALNLAKAAAARVYAHRHG
FT                   WGWVTVDGALTSRDLDTYVIPTHKVRAINARLETHGHLDWGDILELRVKHQVRSRDIAA
FT                   FVAQTGARLTLESYYRITGSR"
FT   CDS_pept        complement(239204..239488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0236"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0236"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73200"
FT                   /db_xref="InterPro:IPR024997"
FT                   /db_xref="UniProtKB/TrEMBL:E8N8Z1"
FT                   /protein_id="BAJ73200.1"
FT                   /translation="MSVQIIDVRMAASGSGHEAISHYQWKDLENGSSNWADKASMVDWV
FT                   RRNPNQAWVGGPVKSAWVEVVENPGGAPYLRTRADGVLSDNLLSLPGAR"
FT   regulatory      complement(239499..239504)
FT                   /locus_tag="MTES_0236"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      239818..239823
FT                   /locus_tag="MTES_0237"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        239832..240866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0237"
FT                   /product="predicted transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0237"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73201"
FT                   /db_xref="InterPro:IPR025159"
FT                   /db_xref="UniProtKB/TrEMBL:E8N8Z2"
FT                   /protein_id="BAJ73201.1"
FT                   /translation="MGVASVAARVSELAARQWGLLTTSQAEAEGITRLQLARLADAGVI
FT                   ERLDRGIYAASAAVDERTPLRAAWLSLEPSKLAEERLADPASSGVLSHTSAATLHRVGD
FT                   LLDDVPEITMPDRKQSRRGIRLHRSALEAGDVTIVEGLPATTPARTVADLLRDGHDPSH
FT                   VAEIAGDALRRDLASRQDMAAALDPLARRNGQPHGAALLEHLLDLVGLSSAALVTQLTA
FT                   SDLGKALVNAGHLAAIRSIIEAVSKIDVPENLLGSKDSEAMAAFTKNVVLPHLPAGVLP
FT                   KIDMSAIVKAVSPSIPIDTTAFREALRAGIPTWLPEVIRTLPADSWPPSALTTISATRE
FT                   GASE"
FT   regulatory      240850..240855
FT                   /locus_tag="MTES_0238"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        240863..241777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0238"
FT                   /product="histidinol-phosphate/aromatic aminotransferase
FT                   and cobyric acid decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0238"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73202"
FT                   /db_xref="GOA:E8N8Z3"
FT                   /db_xref="InterPro:IPR014942"
FT                   /db_xref="UniProtKB/TrEMBL:E8N8Z3"
FT                   /protein_id="BAJ73202.1"
FT                   /translation="MTDEIPYKDGTALWAAVKTRAKTEAAVSGLPAGALLRRFVVDRFL
FT                   ARVFALPGNKWVLKGGNAVLTRVHDARTTKDIDLLAELADLDAAVERLREAIQIDLGDH
FT                   FRFAITDTRAASGGTMQPDVDGYKVSIDAYCGVTPRHRFSVDIVTGSLMTTEPDTQTRP
FT                   GLVPAIPATSVRLYPVVDHIADKLCATQSTYGTAGDQPSSRVRDLVDLVVFARTQRIDG
FT                   TELADAIAAECAHRGLPGVPVFSPPEAWRRLYPTQARAVPACGDVLTFDGAVDLTRALL
FT                   DPALDRTATGRQWSPDALTWARA"
FT   regulatory      241981..241986
FT                   /locus_tag="MTES_0239"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        241991..242749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0239"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0239"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73203"
FT                   /db_xref="GOA:E8N8Z4"
FT                   /db_xref="InterPro:IPR041304"
FT                   /db_xref="UniProtKB/TrEMBL:E8N8Z4"
FT                   /protein_id="BAJ73203.1"
FT                   /translation="MAQIERDLLDEKPLDTLLRKLILLGGNAGSPELRDWASLELRGYE
FT                   RDAELPPYRTVPAPLQIDGAVRDGIVRHETIGAMDIPDFARDEISEQVPLRMGVSEIHS
FT                   MVDQHRNDRMVQLQPPGAADLVTYMNGTRQMNGHITALYWSVSTIALAGVLDQIRTRLA
FT                   ELIAELRSATPPGQNLPTRTQAANAVSLVINGRGNRVSIAQAADGSTIAAAPEEAKPRF
FT                   WTVAKIVGAAVVGLATIAGTVIAALQLPTW"
FT   regulatory      242758..242763
FT                   /locus_tag="MTES_0240"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        242768..243157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0240"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73204"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="UniProtKB/TrEMBL:E8N8Z5"
FT                   /protein_id="BAJ73204.1"
FT                   /translation="MTTHAPRTVTSVLSEVGIDSVSVTWGLGEPVHANDVEFFGYGVYY
FT                   YDPTGNGGKRLGVRFGDATTAWVFDNASATQANYAASAVTATNEAVTAHFHDASLGLEA
FT                   VGTIEAYAHVNGHDTQVDLPVTLLR"
FT   regulatory      243140..243145
FT                   /locus_tag="MTES_0241"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        243159..243941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0241"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0241"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73205"
FT                   /db_xref="UniProtKB/TrEMBL:E8N8Z6"
FT                   /protein_id="BAJ73205.1"
FT                   /translation="MSDLQPAVGEGTFGEHLVENLFATWIDRDLKQRASGLTRAHVYRA
FT                   VVELPPSGEAGIVRINDEVSLQARAVASAPIKKGEPVTAENISSLEAFWPVDVDPNSGW
FT                   LAYIVVGESAHVAFDLRYNKQRNAELLSLADDYLDTVEAVQDFALRPAIDNLLSAAELT
FT                   VQAQMLAQTQTTKLHNVRDRWLRENERLGNAPEGFLATLQRLRRERAAARYGDGVLRVT
FT                   ADEMPALIAAVRSMVQHAADQIGLVAADSTRDEDGAEG"
FT   regulatory      244126..244131
FT                   /locus_tag="MTES_0242"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        244140..244295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0242"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0242"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73206"
FT                   /db_xref="UniProtKB/TrEMBL:E8N9F9"
FT                   /protein_id="BAJ73206.1"
FT                   /translation="MDLTLNDTQLAVLRWVAAGADLENPPTPTFKTSAVALRSRGLIEL
FT                   DKRKGR"
FT   regulatory      244771..244776
FT                   /locus_tag="MTES_0243"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        244783..245382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0243"
FT                   /product="topoisomerase IA"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0243"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73207"
FT                   /db_xref="GOA:E8N9G0"
FT                   /db_xref="UniProtKB/TrEMBL:E8N9G0"
FT                   /protein_id="BAJ73207.1"
FT                   /translation="MATRIEDKLERAFARIQSMTDAAIARAEAQRQHAIAEAERRRRAE
FT                   ALRPRAVHYGNWVAALDELHAAFTKHREVSALIESLRGLAPDTEDAERRTQFDRYVQWA
FT                   AQHLKESDPFLAFTLPDGDTPDLSFPQWQRWRAQNQHPFTIGRFGWVPWVASLAPRSKS
FT                   LMRSGGGSIHQRQSDKASRTSATRVRFLFFSMYSEY"
FT   CDS_pept        complement(245307..247454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0244"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0244"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73208"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E8N9G1"
FT                   /protein_id="BAJ73208.1"
FT                   /translation="MSDNAVEVSSAEEGAPDETYEMKISMSVLEALGINLYSNAAAVVS
FT                   ELVANAWDADANLVEINWNAGGDDAFVEISDDGRGMTREELKRKFLTVGYSKRTTEGGL
FT                   SDGYKRPFMGRKGIGKLSVFSIADTVEVHSARNGERNAFRIEVDELKKRIEDDKAYHPE
FT                   PIDVLPALGAHGTIIRLTNLRRRRIDVALNALRKRVARRFDVLTLVAPKAADGETPLDA
FT                   VKSQISDLRRMIEADPADTTASNALAGLFYVTLNGAPISFDDRIELKKLEYLWEFGAER
FT                   IPAESLAADAVRTVLPASVPGDSTWLVSGWFGTTARPDQLVEDDEAGSLKNIMVLSRGR
FT                   PIQESILERLDFSRLFVSYTTGQIRADFLDTDDQDDIATSDRQRLMEDDPRVVALRDFL
FT                   RAALLRASDQWSEWRPKRKAKEVLANNKPIKDWIESLPKYQQDPATKLMGTIESLSIPE
FT                   STDAAKDRRRLFQSGIIAFERIGLREDVERLNQLSTMQTDDILTVLATLDSYESAMYLD
FT                   LIRARIETIQSFKDDVAENVLEKVLQEKLHANLWLLDPAWDRISQDVSMEERVFELAET
FT                   FGAERPEEDALKRIDLRYCNVQNRHVIIELKRPGVKPDIDVLYDQGLTYIRALTQILEE
FT                   TGRSDEPYEVIFVVGQKPGAKKSPPSKNPDDYSRERVAELNGRVFRYQELIHKARAQYS
FT                   EYIEKNKNLTRVAEVLDALSD"
FT   regulatory      complement(247460..247465)
FT                   /locus_tag="MTES_0244"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(247497..248579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0245"
FT                   /product="site-specific DNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0245"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73209"
FT                   /db_xref="GOA:E8N9G2"
FT                   /db_xref="InterPro:IPR001525"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E8N9G2"
FT                   /protein_id="BAJ73209.1"
FT                   /translation="MSSPSPTIAAIDLFCGAGGLSLGLKQAGIDVVAGIDLDPACQYPY
FT                   EQNLKAQFILKDVGDVKGVDLQALWPEGKLRLLAGCAPCQPFSSHRRGADTRDEENWDL
FT                   LSHFARLVEESLPEFVTMENVTRLGKMPVFENFVAKLEELDYEVDFGTLYGPEFGLPQE
FT                   RRRLVLMASRKGNVSLPKGNKDKSKFKTVKQTISRLPKLEHGESDPKDLLHTARRLTPL
FT                   NLRRMKASAPGGTWRDWPVELLAPCHTRSSGASFQAFYGRMTWDAPSPTITTQSFNFGT
FT                   GRFGHPEQDRSLTLREAAMLQGFPRSYRFVKGKEKPSMQAVGRLIGNAVPPAFGRAVGE
FT                   TFLKMLEAQQATDEASRAHQ"
FT   regulatory      complement(248589..248594)
FT                   /locus_tag="MTES_0245"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(248675..249118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0246"
FT                   /product="DNA G:T-mismatch repair endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0246"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73210"
FT                   /db_xref="GOA:E8N9G3"
FT                   /db_xref="InterPro:IPR004603"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:E8N9G3"
FT                   /protein_id="BAJ73210.1"
FT                   /translation="MYTPWASSDAARKTMQGNRGRDTKAELAVRRLVHAAGLRYRVNAR
FT                   PEKDLRRTADMLFTRVRIAVFIDGCYWHGCPQHFSMPATNLDYWSAKIERNRVRDVETT
FT                   THLEARGWLVLRFWEHETPSHAADQIIQAVNASRIQPNDRAAP"
FT   CDS_pept        complement(249128..249697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0247"
FT                   /product="helicase subunit of the DNA excision repair
FT                   complex"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0247"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73211"
FT                   /db_xref="GOA:E8N9G4"
FT                   /db_xref="UniProtKB/TrEMBL:E8N9G4"
FT                   /protein_id="BAJ73211.1"
FT                   /translation="MVDDAYAKRLHDKIQPDNVVAALVRAGALLTGYELVKTAIVDEVK
FT                   GFFLQGSSEDGLIYSEHYEQSVLTLGRNVFDASVNWLIQIDALTQKQVDALEAIRSHRH
FT                   EIAHELARFIVDPDADVSVDRLAELQEIMRSLDRFWGGVNVDTNPDFDGVDLDRDHIVS
FT                   GSGALLTYLLQIAGVEASPDVSTREP"
FT   regulatory      complement(249129..249134)
FT                   /locus_tag="MTES_0246"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(249706..249711)
FT                   /locus_tag="MTES_0247"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(249711..250751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0248"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0248"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73212"
FT                   /db_xref="InterPro:IPR026001"
FT                   /db_xref="InterPro:IPR040508"
FT                   /db_xref="UniProtKB/TrEMBL:E8N9G5"
FT                   /protein_id="BAJ73212.1"
FT                   /translation="MASQWRQDAPANLVELAIGKCLIAEMDDSRWTEIGLLTGTKEQIY
FT                   KHPRLLRSLRFNDEDYDGHVYDMVPTLLGAEETWGARAPSQELQTRFPRLGMVADFIDL
FT                   PAWLALNEPDLYSRLFVDDNVEATLPDGTVLSEAEFAAVRLNVAEMRRQVERIRRDYAT
FT                   DPEAAIGQAKELIESTCKTILGITGDSDEKHDLPALVKQTLLHLGLDPSQVGAGPDERA
FT                   AKRLLGGVASILNGAGELRNARGTGHGRSGSDLVDPSLARMAVGVVLPTVVYLIESWEA
FT                   QAGAPSISPQELGVRRPAVADVGGTLRHETFGEGQILELATTRHGTVVTVDFGPRIGRR
FT                   RILLHG"
FT   regulatory      complement(250759..250764)
FT                   /locus_tag="MTES_0248"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(250799..251140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0249"
FT                   /product="sulfate permease"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0249"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73213"
FT                   /db_xref="GOA:E8N9G6"
FT                   /db_xref="UniProtKB/TrEMBL:E8N9G6"
FT                   /protein_id="BAJ73213.1"
FT                   /translation="MLRMLWVMSVHTRYLMRRYMPTNILLDLIRTRRGLKWGIPAMFLA
FT                   VPYLLAASVCVGLIAGNGLGWLNLLVLLFCWNALKFLVVGPVSLILLIRVASGRPPLRD
FT                   ATPQRELTG"
FT   regulatory      complement(251149..251154)
FT                   /locus_tag="MTES_0249"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(251331..251939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0250"
FT                   /product="signal recognition particle GTPase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0250"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73214"
FT                   /db_xref="UniProtKB/TrEMBL:E8N9G7"
FT                   /protein_id="BAJ73214.1"
FT                   /translation="MTDPGGATFPRFIYVPWVSDQPHSARADETVELATELAAQIRRPV
FT                   IGIASTKDQLPDDWGKRPYRTRKSSAAATSGPAVEVHFWPSLDDLAAMNPGRAAHAFIL
FT                   EFGSDDLSGWARHHHAVHFDTKDELTPALSAEAISLYESIDRIGNNSWHDDYGKRDALR
FT                   DLRRLRDIGELDPGDLAGYMIGRHSHTAIRKLLELAKKA"
FT   CDS_pept        complement(251970..252989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0251"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0251"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73215"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E8N9G8"
FT                   /protein_id="BAJ73215.1"
FT                   /translation="MAEHLELGYAVTSHRAQGVTVDASHVLAGTSTIRENFYVAMTRGS
FT                   HANHAYIATDRPDAAHDDIPSSATGRSIIAEILQHTGAQLSAHETIIAEQGNWTGVAQL
FT                   AAEYETLAAAAQRDRWERLIQASGLTPEEADDAIASPAFGPLTAELRRAEADNHNVQSL
FT                   LPALVRARAFGDADDIAAVLHHRVARATSRPSGAGRTRNTPRLIAGLIPEATGVIDREM
FT                   ADALTERQALIESRAHALLDAALADGQSWTAHLSRPPEHPQTRKAWRRCLLTVAAYRDR
FT                   YAITGQLPLGSPAQSDTQRIDAGRASAALGRAQKLADPVRVPADPPIRPAPSRAQPRL"
FT   CDS_pept        253719..254030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0252"
FT                   /product="integrase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0252"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73216"
FT                   /db_xref="GOA:E8N9G9"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:E8N9G9"
FT                   /protein_id="BAJ73216.1"
FT                   /translation="MTTSFTFSVHTAAVNCNVSAPLYNFSLVQSGLRHTGATWMADAGV
FT                   PLHVLQEILGHASMETTRGYLHPDDRHLASAAEQASAFLSPAGQRHRAQSSTPPTRSV"
FT   tRNA            complement(254305..254378)
FT                   /locus_tag="MTES_t001"
FT                   /product="tRNA-Pro"
FT   regulatory      254498..254503
FT                   /locus_tag="MTES_0253"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        254512..255090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0253"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0253"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73217"
FT                   /db_xref="GOA:E8N9H0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:E8N9H0"
FT                   /protein_id="BAJ73217.1"
FT                   /translation="MSIEILPATGDRFDDAEVALDSGDGPECQCQWWLLPNGPWKEASI
FT                   DERTELFRTELDGARPPGLIAYIDGEPAGWVRVGPRTTQPRLARTRDVTASTTEPLDAD
FT                   DVWAVSCFVVRKEHRGKGLTARLLDAAVSTARDGGARVVEGYPLDPTAAKRSSNQLFRG
FT                   TVSVFEAAGFDIVDRPKPDRALVSLTLRD"
FT   regulatory      255122..255127
FT                   /locus_tag="MTES_0254"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        255133..255516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0254"
FT                   /product="ribosome-associated heat shock protein implicated
FT                   in the recycling of the 50S subunit"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0254"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73218"
FT                   /db_xref="GOA:E8N9H1"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR025708"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:E8N9H1"
FT                   /protein_id="BAJ73218.1"
FT                   /translation="MTDATTTARVDAWLWAVRVYKTRSAATTACRAGHVRVNGERAKAA
FT                   QPVRPGDELRVRIQGFDRILVVRKTIAKRVGAALVAEALDDRTPPPPPRESMPFVPVRD
FT                   RGAGRPTKRDRRDIEKLRGRDLD"
FT   CDS_pept        complement(255759..256661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0255"
FT                   /product="NTP pyrophosphohydrolase including oxidative
FT                   damage repair enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0255"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73219"
FT                   /db_xref="GOA:E8N9H2"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:E8N9H2"
FT                   /protein_id="BAJ73219.1"
FT                   /translation="MTIEPPAPGEPRRPHGPRDPGDAWVVAPTGEKYWGRFGAAGLLAL
FT                   DAERGVLLQHRVSWSHFGDTWALPGGARHENESARDGALRESGEEAGVPEDAVQARFES
FT                   VLDLGIWTYTTLVADVTSPFEPVISDPESVALEWVPVDEVDTRPLHPGFAASWPALRAA
FT                   LSARPAVVVDVANVVGSVPDGWWKDRAGAAGRLLTRLSALTSSGMDAEALGLSATRWFP
FT                   LVAAVLEGEARATEVAHDGVSVHRASGSGDDEIVRVASELVGSFDPVIVVTSDRGLAAR
FT                   VEALGASVRGTRWLLEQLS"
FT   regulatory      complement(256666..256671)
FT                   /locus_tag="MTES_0255"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(257026..257469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0256"
FT                   /product="predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0256"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73220"
FT                   /db_xref="GOA:E8N9H3"
FT                   /db_xref="InterPro:IPR008523"
FT                   /db_xref="UniProtKB/TrEMBL:E8N9H3"
FT                   /protein_id="BAJ73220.1"
FT                   /translation="MTNLHAEPALDQPYYGAPFGAAVRRIFKKYATFTGRASRSEYWWW
FT                   ILANGLVVLVLNVLALVTGGVSTGPYGEIQLAGGIGVIFVVLSVIWGLATIIPHIAVLV
FT                   RRLHDTNRSGFWAFIYFVPFVGPIILLVFTLLDSKPEGARFDR"
FT   regulatory      complement(257475..257480)
FT                   /locus_tag="MTES_0256"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(257645..259168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="engA"
FT                   /locus_tag="MTES_0257"
FT                   /product="predicted GTPase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0257"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73221"
FT                   /db_xref="GOA:E8N9H4"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR016484"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031166"
FT                   /db_xref="InterPro:IPR032859"
FT                   /db_xref="UniProtKB/TrEMBL:E8N9H4"
FT                   /protein_id="BAJ73221.1"
FT                   /translation="MGVEDEYEGGPDQLAEKMAELDEVLAEQRAEALRAGLEDFDLDED
FT                   DAALLAGLASGEGAIEFLPALPVVAIVGRPNVGKSALVNRILGRREAVVEDTPGVTRDR
FT                   VTYKAEWLDRRFSLVDTGGWEPDAKGIDRSVAAQAEVAIDLADVVLFVVDATVGATSTD
FT                   EHVVKLLRKSKKPVFLIANKVDDARQEPEATALWNLGLGEPHPVSAIHGRGVADLLDEL
FT                   MKVLPEVSAVAKYEIGGPRRVAILGRPNVGKSSLLNKAAGEERVVVNELAGTTRDPVDE
FT                   VVELGGKLWTLVDTAGIRRRVHLSQGADFYASLRTSTALEKSEVAVVVLDVSQPISVQD
FT                   LNIIDLVLESGRALVLAFNKWDRLNDDDMENQDRRRYLEREIEQDLAHVAWAPRVNISA
FT                   RTGRHLDKLVPALETALESWDTRIPTGKFNAFLSELVAEHPHPLRGGKQPRILFGTQAA
FT                   TRPPTFVLFTTGFLDPGYRRFIQRRLREIYGFEGTPIVLNMRIREKRQR"
FT   CDS_pept        complement(259158..259931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cmk"
FT                   /locus_tag="MTES_0258"
FT                   /product="cytidylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0258"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73222"
FT                   /db_xref="GOA:E8N9H5"
FT                   /db_xref="InterPro:IPR003136"
FT                   /db_xref="InterPro:IPR011994"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E8N9H5"
FT                   /protein_id="BAJ73222.1"
FT                   /translation="MTEFTPALFRPGLAATGLATPGFAPPAEGSASAPVVVAIDGPAGS
FT                   GKSSVSKAAATRLGYGFLDTGAAYRALAWHALEHGIDTSDATAVLEIFGDFDYAISLDT
FT                   TDRWVRVGSVDVTDAIREPRVTDAVSGVARVAPVRHAVNELFRRLVASAALPGVVVEGR
FT                   DITTVVFPDAPVRILLTAAPEVRAARRSAELTSQDAAAVAAALHKRDAADSTVVDFLTA
FT                   APGVEVVDSTPLDFEQTVDAVLSVVDSTMGARDGR"
FT   regulatory      complement(259176..259181)
FT                   /gene="engA"
FT                   /locus_tag="MTES_0257"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(259924..261057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tyrA"
FT                   /locus_tag="MTES_0259"
FT                   /product="prephenate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0259"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73223"
FT                   /db_xref="GOA:E8N9H6"
FT                   /db_xref="InterPro:IPR003099"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E8N9H6"
FT                   /protein_id="BAJ73223.1"
FT                   /translation="MSEPNGTSARAAGPLATRTSGTVRVVGSGLLGASIGHALTARGVD
FT                   VVLVDASPSQLRLAIDYGAGRAEQPDDKPSLIVVATPPDVIADVVQRELEAFPDAVVTD
FT                   VASVKLEPLRTLRERGVDLTHYIGSHPMAGRERGGAISARADIFIGRPWVVCRDAETSA
FT                   HDLSLVEGLALDLGATLIEMTPEEHDESVALMSHVPQLVASLLAGRFVEAPDGSLRLAG
FT                   QGVRDTTRIAASAPELWVQILGANAAPVVDVLDRLAADLSDVADALRDPDVPGARRTVA
FT                   DTIRRGNEGVERLPGKHGQNRRFDSFVVMVDDTSGQLGRLFGELGDLDVNVEDLRLEHS
FT                   PGAPFGLAEISVVPDAVRRAVDGLQQRGWRIASTTHD"
FT   regulatory      complement(259943..259948)
FT                   /gene="cmk"
FT                   /locus_tag="MTES_0258"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(261062..261067)
FT                   /gene="tyrA"
FT                   /locus_tag="MTES_0259"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(261110..261847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsuA"
FT                   /locus_tag="MTES_0260"
FT                   /product="16S rRNA uridine-516 pseudouridylate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0260"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73224"
FT                   /db_xref="GOA:E8N9H7"
FT                   /db_xref="InterPro:IPR000748"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR018496"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="InterPro:IPR042092"
FT                   /db_xref="UniProtKB/TrEMBL:E8N9H7"
FT                   /protein_id="BAJ73224.1"
FT                   /translation="MRLQKVLANAGVASRRVSEEMIVAGRVRVNGVVVTELGSRIHPET
FT                   DLVDVDGTAIQLDTSKRYVILNKPTGVVSSMSDDRGRPDLRQYTKDWDERLFNVGRLDA
FT                   DTSGLLVLTNDGDLAHVLAHPSFGVTKVYIAKVEGQVLPQTIQHLLKGVDLEDGRIAAD
FT                   KARLLDSSRGESLVELTLHSGKNRIVRRLMAEVGHPVIELVRRQFGPLHLGTLPVGKAR
FT                   ELTTVERGALLTLSRRDGDTPAE"
FT   regulatory      complement(261854..261859)
FT                   /gene="rsuA"
FT                   /locus_tag="MTES_0260"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(261883..262488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0261"
FT                   /product="predicted transcriptional regulator containing
FT                   the HTH domain"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0261"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73225"
FT                   /db_xref="GOA:E8N9H8"
FT                   /db_xref="InterPro:IPR005234"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E8N9H8"
FT                   /protein_id="BAJ73225.1"
FT                   /translation="MTADPQAPIPAPRPSDPASVARRLEAILLVVDEPQSLVSLAAAVA
FT                   APVPAVRQAVEALVADYDGETGGPVRGFELREVGGGWRLYVREEYDDVVGDFVNTQAPS
FT                   RLSQAALETLAVIAYKQPVTRGQVASIRAVNVDSVVRTLLARGLITEVFTDPDTGAIHY
FT                   GTTDQLLVNLGINSLDELPHISPLLDDGADGFDGEVLK"
FT   CDS_pept        complement(262478..263515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0262"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0262"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73226"
FT                   /db_xref="GOA:E8N9H9"
FT                   /db_xref="InterPro:IPR003768"
FT                   /db_xref="UniProtKB/TrEMBL:E8N9H9"
FT                   /protein_id="BAJ73226.1"
FT                   /translation="MAPSPDDTPIADAPAPGGFDELSHLAVEARELAGEVPEPVEGTAA
FT                   DASGGFDELSHLAEAAREPGVEVPEPATQVPEPVEGTGTDAAGFRVTLPVFDGPFDLLL
FT                   TLISRAELDITEVALSRVTDEFIAYLRDLGPESDLDEASEFLVVAATLLDMKIAGLLPQ
FT                   GELVDAESVALLEARDLLFARLLQYRAFKEVSAWFARCLQREDRRHTRDVRLDEKYRAA
FT                   VPELVWTLSLDDFAALAVVAMAPKQIPTVGLDHLHAPLVSIREQAAIVVTLLRSAGTLN
FT                   FRDLVAGVTETGVIVARFLSILELYRHAALSFEQLEPLGELTLRWTAERWSEENLAALG
FT                   ADYDR"
FT   regulatory      complement(262495..262500)
FT                   /locus_tag="MTES_0261"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(263499..264401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="parA"
FT                   /locus_tag="MTES_0263"
FT                   /product="ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0263"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73227"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E8N9I0"
FT                   /protein_id="BAJ73227.1"
FT                   /translation="MTKAGDSVSASTKGNKTGADEVILGPTGRPYQGFPTPPALDSHGP
FT                   ARIIALCNQKGGVGKTTTTINLAASLAGYGRRVLAIDFDPQGALSAGLGIQTHDVPTIY
FT                   DLLLDTKRDPREVIVSTRVEGLDILPANIDLSAAEVHLVNEVARETILARVLRKVAADY
FT                   DVILIDCQPSLGLLTVNALTAAHGVLIPLECEFFALRGVALLVETIDKVRDRLNPAIQL
FT                   DGVLATMYDPRTLHSREVLERVVEAFGDDVLETVIGRTVKFPDASVSGMPITEFAPEHT
FT                   AAQAYLRLARELVARGAVA"
FT   regulatory      complement(263524..263529)
FT                   /locus_tag="MTES_0262"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(264409..264414)
FT                   /gene="parA"
FT                   /locus_tag="MTES_0263"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(264557..265336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0264"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0264"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73228"
FT                   /db_xref="GOA:E8N9I1"
FT                   /db_xref="InterPro:IPR025238"
FT                   /db_xref="UniProtKB/TrEMBL:E8N9I1"
FT                   /protein_id="BAJ73228.1"
FT                   /translation="MPFTVSHAVVALPFVRTPLIPAAIAIGAMTPDLPLFLRGVVPPYA
FT                   MTHDLAWLPVTVVMALVLLLVWRCVLRPATRELLPRRIAERLPEGWDAGAPAAARETVS
FT                   GGVVGILWLLLSLALGVVTHVAWDFFTHEGRAGDALFPALEEPWGPLAGVKWLQYGSGL
FT                   FGLAGLAIFGLWWLSKRAAVPVRRVLPDAVRVAWWLSLPVALVGASLAALAVEGGFGAE
FT                   YTPTHLIYGVLVKVAAAWGAATLALAVVVQVRRRVRA"
FT   CDS_pept        complement(265338..266651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tyrS"
FT                   /locus_tag="MTES_0265"
FT                   /product="tyrosyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0265"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73229"
FT                   /db_xref="GOA:E8N9I2"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002307"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024088"
FT                   /db_xref="InterPro:IPR024107"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:E8N9I2"
FT                   /protein_id="BAJ73229.1"
FT                   /translation="MSAPIDAAPVSALQPANDPTFDNVWDELVYRGLIHVSTDETELRD
FT                   LLGAGPIVFYCGFDPTAPSLHLGNLVQLLTMRRLQLAGHRPLGLVGGSTGLVGDPRPTA
FT                   ERTLNTRETVAEWVARLRAQVERFLSFEGDSAARMVNNLDWTAPLSAIDFLREIGKHFR
FT                   VGTMLKKDAVSARLNSEAGISYTEFSYQILQGLDYLELYRQYGCVLQTGGSDQWGNLTS
FT                   GTDLVRKVEGASVHAIGTPLITNSDGTKFGKSEGNAIWLDADMCSPWAMYQFWLNTDDR
FT                   DVIERLKVFTFLTRAEIEEYAKLVETEPFRRAAQKRLAREVVTTVHGAEATEAVIAATE
FT                   ALFGQGDVKALDAAVLRTALEELPHATLAAGSTVLDALTATGLSGSLSDARRAIAQGGV
FT                   TLDGEKVTSDDAIVEGTLPGGVSVLRRGKKTLAGLFLH"
FT   regulatory      complement(266660..266665)
FT                   /gene="tyrS"
FT                   /locus_tag="MTES_0265"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(266746..267594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0266"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0266"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73230"
FT                   /db_xref="GOA:E8N9I3"
FT                   /db_xref="UniProtKB/TrEMBL:E8N9I3"
FT                   /protein_id="BAJ73230.1"
FT                   /translation="MVHTRRWLAYTVSAVALIVVSAGLDAVIAGLLAVAVAAIWTWVMP
FT                   ERGPTRAGLWPVALLGLTAAACVVIARGRPRPGPLGELWAAYRPTDAVSVDVILLVIGC
FT                   LVFLLESGNAVVRIALRSEMGESETGESAPSAEADVDTAESAGPVAPDAERRAVAAPTD
FT                   PAVRAAAPADPAARAAAHADPAAPSDPAPDESAPTPAPVLKGGRLIGPLERILVFVLTL
FT                   AGAYTLIAAVFAAKGIVRFPEISADGKSGNRAEYFLIGSLVSWVTALAAAFLVWWGVHA
FT                   G"
FT   CDS_pept        complement(267648..268295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0267"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0267"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73231"
FT                   /db_xref="InterPro:IPR032580"
FT                   /db_xref="UniProtKB/TrEMBL:E8N9I4"
FT                   /protein_id="BAJ73231.1"
FT                   /translation="MTIAVIADIVASRHLADRAAAQQRISETVERVQRDHSVAAEPLAA
FT                   VVGDELQGEFATLTEALSWLLLFRLALPDDVDCRFGLGVGEVRPIALDDRTIPEGPAWW
FT                   AARAAIEHVERLQQRAAPLARTWIERGEGEDASMADALALANAYALSRDQLVSAMSERA
FT                   RRLTYGRCLGHSQRRLAEAEGITQSAVSQTLAAAGSAAIVEGFSVLTAGARA"
FT   regulatory      complement(268304..268309)
FT                   /locus_tag="MTES_0267"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(268346..269953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argH"
FT                   /locus_tag="MTES_0268"
FT                   /product="argininosuccinate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0268"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73232"
FT                   /db_xref="GOA:E8N9I5"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR009049"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="InterPro:IPR029419"
FT                   /db_xref="UniProtKB/TrEMBL:E8N9I5"
FT                   /protein_id="BAJ73232.1"
FT                   /translation="MWGFGRFFGSEGAGIGDCSGARHAQWAGSGHSAAARRRAPSRSAT
FT                   RVTAASAALGRLEGMSSETGQATNEGALWGARFSGGPSPELAALSRSTHFDWDLALYDI
FT                   AGSHAHAAALEAAGYLDAEEAAAMHAGLDELAERVKDGSLVAAPGDEDVHGALERVLIE
FT                   TVGPALGGKLRAGRSRNDQIATLVRLYLLDHARTLTREVLRLIDALVAQADAHAGAIMP
FT                   GRTHLQHAQPVLLAHHLQAYGWAFTRGIERLRDWSVRASVSPYGGGALAGATLGLDPQL
FT                   VADRLGLARPAENSLDGTASRDVVAEFAFITAMIGVDLSRLAEDVILWNTREFGFVTLD
FT                   DAYSTGSSIMPQKKNPDIAELARGKAGRLIGNLSGLLATLKGLPLAYNRDLQEDKEPVF
FT                   DSVRTLELVLPAFSGMIATLRFHTERMAELAPQGFSLATDVAEWLVRQGVAFRDAHEIS
FT                   GALVRACEEREIGLEDADDALLASVSPSLTPAVREVLTIEGSVSSRTGVGGTAPERVHE
FT                   QREELVARAQAAARTLLD"
FT   CDS_pept        complement(270054..271175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0269"
FT                   /product="predicted acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0269"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73233"
FT                   /db_xref="GOA:E8N9I6"
FT                   /db_xref="InterPro:IPR007349"
FT                   /db_xref="InterPro:IPR012429"
FT                   /db_xref="UniProtKB/TrEMBL:E8N9I6"
FT                   /protein_id="BAJ73233.1"
FT                   /translation="MASAPELTSRPRRLWARFDGPGRLAGVDLARGLAVLGMLAAHLLD
FT                   IEDFVPRDPSSWLDVVNGRSSILFAVLAGVSISLVTGGTRPIEGSRRARASARLALRGG
FT                   LLWAIGILLVLTGVPVYVILPAYALLFALSLPFLGMRPRSLFLTAGALALVMPWIQPVL
FT                   DAAPIWSGRGGDELASALGWHYPFTVWIAFLLAGMGLGRLDLRLLPEQALIVLAGSALA
FT                   LAGYGLALATVPLTTRNPYLAAVLTAEAHSSGLGEVIGSGGFAIAVIGLCLLLCRTPLR
FT                   WLAVPLRAVGSMPLTAYVVQLLVWAVVALAVLGDTSDLWGIRALDLFGPLTLGLVVGCT
FT                   VWVLTVGRGPLETAIDAVVRVVVGRDAGTSPVR"
FT   CDS_pept        complement(271154..272077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argF"
FT                   /locus_tag="MTES_0270"
FT                   /product="ornithine carbamoyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0270"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73234"
FT                   /db_xref="GOA:E8N9I7"
FT                   /db_xref="InterPro:IPR002292"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR024904"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/TrEMBL:E8N9I7"
FT                   /protein_id="BAJ73234.1"
FT                   /translation="MTRHLLRDDDLSPAEQAEILDLAIELKKDRWAQKPLAGPQTVAVI
FT                   FDKSSTRTRVSFAVGIADLGGSPLIISTANSQLGGKETPSDTARVLERQVAAIVWRTYA
FT                   QAGLEEMARGTRVPVVNALSDDFHPCQLLADLLTIREHKGELKGLTLSFFGDGQSNMAH
FT                   SYVLAGVTAGMHVRVAAPADYAPRADVIADAERIAAETGGSITLSADPEAAASGADVIV
FT                   TDTWVSMGKEEEKLARIRDLGGFKVTSELMTRADDDAIFIHCLPADRGYEVDAEVIDGP
FT                   QSVVWDEAENRLHAQKALLVWLLRQN"
FT   regulatory      complement(271184..271189)
FT                   /locus_tag="MTES_0269"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(272074..273294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argD"
FT                   /locus_tag="MTES_0271"
FT                   /product="ornithine/acetylornithine aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0271"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73235"
FT                   /db_xref="GOA:E8N9I8"
FT                   /db_xref="InterPro:IPR004636"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:E8N9I8"
FT                   /protein_id="BAJ73235.1"
FT                   /translation="MTADTKWQEDAGRDLVRSFGDRMALFVRGEGAYVWDADGTKYLDF
FT                   LAGIAVNALGHAHPTFVEAITAQASTLAHVSNYFATPPQLALAARLKRLAGTGESGRVY
FT                   FGNSGAEANEAAFKLARLHGRGTDRTRILTLKGGFHGRTMGSLALTGKPALQADFLPMV
FT                   PGVEHIDATIEALEAAVDDRVAALLVEPIQGEAGVVELPEGYLQAAREITARHGALLII
FT                   DEIQTGAGRTGAWFGFQHAGIVPDAITVAKGIGGGFPIGALITFGAASDLFFPGTHGST
FT                   FGGNALGTAVGGAVLQEIEASGLVENAARRETELRDGIAALGSPLVAGVRGRGLLLGIG
FT                   LTSPVAKAVVAAAQQHGLIVNAANDDTIRIAPPLTIGDAEISAFLDLFGAALATVSDAL
FT                   ILEGAPA"
FT   regulatory      complement(272085..272090)
FT                   /gene="argF"
FT                   /locus_tag="MTES_0270"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(273291..274193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argB"
FT                   /locus_tag="MTES_0272"
FT                   /product="acetylglutamate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0272"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73236"
FT                   /db_xref="GOA:E8N9I9"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR037528"
FT                   /db_xref="InterPro:IPR041727"
FT                   /db_xref="UniProtKB/TrEMBL:E8N9I9"
FT                   /protein_id="BAJ73236.1"
FT                   /translation="MTHVDLQDTDPAEASERAVTLVESLPWVRKYRDQVVVVKYGGNAM
FT                   VSDELQDAFAADIAYLRYVGVKPVVVHGGGPQISSMLDRLDIPSEFRGGYRVTSTEAIS
FT                   VVRMVLTGQINPQLVAKVNAHGPLATGLSGEDAGLFGGRRRGVVVDGVEHDLGRVGDVV
FT                   TVDPQPVLDHLAAGRVPIVSSIAPDLDHPGNSLNVNADAAAAALAVALNAKKLVVLTDV
FT                   PGLYADWPNRDSLVSHLTSTELRAMVPTLESGMIPKMQACLDAVDGGVPTAAIIDGRVP
FT                   HSVLVELFTNKGIGTEVVA"
FT   regulatory      complement(273304..273309)
FT                   /gene="argD"
FT                   /locus_tag="MTES_0271"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(274190..275347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argJ"
FT                   /locus_tag="MTES_0273"
FT                   /product="N-acetylglutamate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0273"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73237"
FT                   /db_xref="GOA:E8N9J0"
FT                   /db_xref="InterPro:IPR002813"
FT                   /db_xref="InterPro:IPR016117"
FT                   /db_xref="InterPro:IPR042195"
FT                   /db_xref="UniProtKB/TrEMBL:E8N9J0"
FT                   /protein_id="BAJ73237.1"
FT                   /translation="MSVTAPAGFEAAGVAVGLKSTGARDVAVVVNRGPLKVGAAVFTSN
FT                   RAKANPILWSEQVVKDGVVEAIVLNSGGANCFTGSFGFQTTHQTAERAAELLGVGAGDV
FT                   LVCSTGLIGTGDEVFRAKVLAGVDQGIATLSSEGGEDASLAIMTTDSKPKRAVHVGDGW
FT                   SIGAMAKGAGMLAPGLATMLVVVTTDVVLDSAEADAALRAATRVSFDRLDSDGCMSTND
FT                   QVTLMVSGASGIRVPADEFTAALTAVCDDLAAQLQGDAEGSSHDITIEVVNAASEEDAV
FT                   EVGRSIARNNLFKAAIFGNDPNWGRVLAAIGTTDAAFDPYDVDVWMNGVRVCTAGGPDR
FT                   PREDVDLTPRATDLIVDLRVGDATATIRTNDLTHDYVHENSAYSS"
FT   regulatory      complement(274205..274210)
FT                   /gene="argB"
FT                   /locus_tag="MTES_0272"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(275344..276393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argC"
FT                   /locus_tag="MTES_0274"
FT                   /product="acetylglutamate semialdehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0274"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73238"
FT                   /db_xref="GOA:E8N9J1"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR000706"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E8N9J1"
FT                   /protein_id="BAJ73238.1"
FT                   /translation="MTLSVAVSGASGYAGGEILRLLADHPDVEIRTVTAHSSAGQPLLA
FT                   HQPHLRSLAHLELQATTPEILAGHDVVFLALPHGQSAQYTDALADTPLVIDAGADHRLT
FT                   SSDDWAAFYGGAHAEPWAYGVPELPVAGGKQRENLRGVTRIAAPGCNASTVSLSLAPGV
FT                   AAGVIDPGDIVSVLAVGPSGAGKSAKTNLLASEILGTANPYAVGGTHRHIPEIRQALAA
FT                   AGASADGIRISFTPVLVPMARGILATSSAPIRDGATDAEIRAAWEDAYADEPFVHLLPE
FT                   GVFPRTADVLGANIASIGLAIDRAANRVVAVAAVDNLVKGTAGAAVQSMNIALGLAETT
FT                   ALPVNGVAP"
FT   regulatory      complement(275356..275361)
FT                   /gene="argJ"
FT                   /locus_tag="MTES_0273"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        276286..276630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0275"
FT                   /product="leucine-rich repeat (LRR) protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0275"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73239"
FT                   /db_xref="UniProtKB/TrEMBL:E8N9J2"
FT                   /protein_id="BAJ73239.1"
FT                   /translation="MRGDGADLDIGMIGEEAEDLAARIAGSAGDGDREGHVSTLGVGAG
FT                   AEIQRVPGRRHPHARQPADYEVAETRRATRRRRSAAVLTESSELNAAIDDIWRGYPPAR
FT                   VGGKSPFAGP"
FT   regulatory      complement(276400..276405)
FT                   /gene="argC"
FT                   /locus_tag="MTES_0274"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(276913..279423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheT"
FT                   /locus_tag="MTES_0276"
FT                   /product="phenylalanyl-tRNA synthetase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0276"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73240"
FT                   /db_xref="GOA:E8N9J3"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004532"
FT                   /db_xref="InterPro:IPR005121"
FT                   /db_xref="InterPro:IPR005146"
FT                   /db_xref="InterPro:IPR005147"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR020825"
FT                   /db_xref="InterPro:IPR033714"
FT                   /db_xref="InterPro:IPR036690"
FT                   /db_xref="InterPro:IPR041616"
FT                   /db_xref="UniProtKB/TrEMBL:E8N9J3"
FT                   /protein_id="BAJ73240.1"
FT                   /translation="MRVPLSWLREYVDVPADATPDDVLAALVSVGFEEEDVHRFELSGP
FT                   IVVGQVTEFTPEPQSNGKTIRWCQVDVGDEHGGVRGIVCGAGNFFEGDKVVVTLPGSVL
FT                   PGPFPIAARKTYGHVSDGMIASAKELGLGSEHSGILRLVDLGIDAPVGTDAIALLGLDD
FT                   IAVEINVTPDRGYALSLRGVAREYSHATGAAFRDPGTGHEDAVARTPRGFPLAVDDRAP
FT                   IRGRQGASEFVARIVRDVDPSRPTPPWMITRLSLAGIRSLGVLIDITNYVMLELGQPIH
FT                   GYDLDRLQGGITVRRAEEGEKLETLDGQVRTLSAEDLLITDESGPIGLAGVMGGGPTEM
FT                   SDATRNVLIEAATFDQVSIARTARRHKLPSEASRRFERGVDPLVPYVAAERVASLMVEL
FT                   AGGTLDAELGGSLGSTYRREAITLPAGFVSGLIGVEYTDDEIVSSLRLIGCTVEERDGG
FT                   WSVIAPSWRHDLSDKWTLAEEVARIEGYDRIPSVLPTPPSGRGLTGAQQGRRRVANALA
FT                   AAGFVETPSFPFTTEEQNALHGSPSGDTLPSVKLANPLDGLAPFLRRSLIPAMLQVAHR
FT                   NVSRGIVDLALFEVGTVFLPKPGVQYGTSSVPPLAVRPDAATLTALDASIPPQRRHVAV
FT                   LLTGHTVPKQPGQAAIAADLADAVDAVRVLTAAAGLDIELVQAQRAALHPGRTARVLAG
FT                   GQDIGYVGELLPTVSADADLPGRVLVAELDLDAMLELAQARPVAASLSGFPAATQDVSL
FT                   VVPLEVAAGAVRAALLEGGAPLLEGARLVDDYRGSGLPEGTKSLTFALRFRAEDRTLTA
FT                   AEATDAKLAGVAVAAGRFGAAIRD"
FT   CDS_pept        complement(279423..280463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheS"
FT                   /locus_tag="MTES_0277"
FT                   /product="phenylalanyl-tRNA synthetase alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0277"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73241"
FT                   /db_xref="GOA:E8N9J4"
FT                   /db_xref="InterPro:IPR002319"
FT                   /db_xref="InterPro:IPR004188"
FT                   /db_xref="InterPro:IPR004529"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR022911"
FT                   /db_xref="UniProtKB/TrEMBL:E8N9J4"
FT                   /protein_id="BAJ73241.1"
FT                   /translation="MSDAPEITPEAVASAVDAALAAIAAAATTADLKAARAAHTGEQSA
FT                   LARLNAQMRHVAPDHKAAFGKLVGQARGQVNQALAARETELAEAETAAQLEAERIDVTA
FT                   LPQRARVGARHPISLLQEQVSDIFVGMGWEIAEGPELEHEWFNFDALNFDVDHPARQMQ
FT                   DTFFVDPVARHLVMRTHTSPVQVRSMLERDLPIYVLCPGRVYRTDEFDATHLPVFTQFE
FT                   GLVIDKGITMAHLKGTLDHAARVLFGPEAKTRFRANFFPFTEPSAELDLWHPTFKGGAR
FT                   WIEWGGCGMVNPNVLRAAGIDPEEYSGFAFGMGIERTLMFRSDVQDMRDMAEGDVRFSE
FT                   QFGMVV"
FT   regulatory      complement(279430..279435)
FT                   /gene="pheT"
FT                   /locus_tag="MTES_0276"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(280474..280479)
FT                   /gene="pheS"
FT                   /locus_tag="MTES_0277"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(280513..281412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0278"
FT                   /product="ABC-type amino acid transport system, permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0278"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73242"
FT                   /db_xref="GOA:E8N9J5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E8N9J5"
FT                   /protein_id="BAJ73242.1"
FT                   /translation="MSSVLYDVPGPKAIVRNRILGVLTILVVLAVVGFFVWRLADTGQF
FT                   TAQKWSAFTYTNVWIEILKATGATLAAFAAAAVGALALGFLLAIGRLSDHRWVRWPFTA
FT                   VIEVFRAIPVLVFMFLLYYGFPVIGIRMEPYWAVVIALVCYNGSVLAEVIRAGVESLPR
FT                   GQAEAGYAIGLRKAGVMRLVLLPQAVRAMMPVIIAQLVVTLKDTALGFVITYPELLFYA
FT                   KYIGAQPVVGSPIVPATIVVGIIYIALCLILSFVANLVEKRLRRSPRATQVAAAVQAPQ
FT                   QGGTDTELIVAQRGGSGI"
FT   CDS_pept        complement(281409..282065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0279"
FT                   /product="ABC-type amino acid transport system, permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0279"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73243"
FT                   /db_xref="GOA:E8N9J6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E8N9J6"
FT                   /protein_id="BAJ73243.1"
FT                   /translation="MGVITDNLDIWSEALVGTLVLFFAGGALALVLGIIVGAMRVSPVP
FT                   IARGVGTFYVSAIRNTPLTLVFFAFVFALPPLLGLRLTGDVSLTLGICALGIYTATYVA
FT                   EAIRSGVNTVPVGQAEAARALGLTFGQVMSLIVLPQAFRSVIPPMVSVFIALLKNTTVA
FT                   AGFSIVNIGSVRNYLSERGENAFIVILWIMVVFVALVLLLSWLQRTLENRWRVAR"
FT   regulatory      complement(281422..281427)
FT                   /locus_tag="MTES_0278"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(282071..282076)
FT                   /locus_tag="MTES_0279"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(282133..283035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0280"
FT                   /product="ABC-type amino acid transport/signal transduction
FT                   systems, periplasmic component/domain"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0280"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73244"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:E8N9J7"
FT                   /protein_id="BAJ73244.1"
FT                   /translation="MRKTRTLAGLGVLAAGLLALTACNSGTPGAPDAGSSGGSDSTQLW
FT                   EVASDVSLDGSPTYDRMVAADKVVVGVKEDQPGLGFKDPISGERGGFDVEISQWIAASL
FT                   GFDADKIEYKTIPSANREQELVNGNIDYYVGTYSITDKRKAQIDFAGPYLITGQGLLVA
FT                   ADNEDIKGPNDLAGKIVCSVTGSTPLQRIRDEYSPGDTVEYDTYTQCLEQLRAGSVDAV
FT                   TTDQAILAGYVAQEPEAFKIAGDTFSEERYGVGLPKGDTVLKDHINTLFNDGGEVWTAL
FT                   FEKNLAPAGIKGEQPTADE"
FT   regulatory      complement(283043..283048)
FT                   /locus_tag="MTES_0280"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(283157..283918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gluA"
FT                   /locus_tag="MTES_0281"
FT                   /product="ABC-type polar amino acid transport system,
FT                   ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0281"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73245"
FT                   /db_xref="GOA:E8N9J8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:E8N9J8"
FT                   /protein_id="BAJ73245.1"
FT                   /translation="MASVPPAGSEPLVVVSDVQKHYGQFQALKDINLTVDRGEVVVVIG
FT                   PSGSGKSTLCRTINRLETITSGSITIDGTPLPAEGKGLAKLRADVGMVFQSFNLFAHLT
FT                   ILENVTLGPMKVRKLKKADAEKEARALLERVGVGHQADKLPAQLSGGQQQRVAIARALA
FT                   MKPKVMLFDEPTSALDPEMINEVLDVMVGLAKDGMTMIVVTHEMGFARKAANRVVFMAD
FT                   GQIVEQASPEQFFTHPESDRAKDFLSKLITH"
FT   regulatory      complement(283925..283930)
FT                   /gene="gluA"
FT                   /locus_tag="MTES_0281"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(283993..284790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0282"
FT                   /product="rRNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0282"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73246"
FT                   /db_xref="GOA:E8N9J9"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:E8N9J9"
FT                   /protein_id="BAJ73246.1"
FT                   /translation="MLENPRSPRVRAVAKLSKRAARQETGLFLLEGPQAAREALAWAPE
FT                   TVLELYATPTALEKHTDVRDAAEKAGVDLQYTTEAVLDAMADTVTPQGIVAVARQSPTA
FT                   LKDVLAGSPRLIAICEEVRDPGNLGTIIRAADAAGADAVVLTGRTVDPYNPKVVRSTTG
FT                   SLFHLPVAVDLELAHVVERVHEAGLRVVAADVDGGDFLASRDLLSEPTAWLFGNEARGL
FT                   DEAALAHADLSLRLPIFGRAESLNLATAASVCLYETAFAQRAR"
FT   regulatory      complement(284794..284799)
FT                   /locus_tag="MTES_0282"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(284893..285276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplT"
FT                   /locus_tag="MTES_0283"
FT                   /product="ribosomal protein L20"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0283"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73247"
FT                   /db_xref="GOA:E8N9K0"
FT                   /db_xref="InterPro:IPR005813"
FT                   /db_xref="InterPro:IPR035566"
FT                   /db_xref="UniProtKB/TrEMBL:E8N9K0"
FT                   /protein_id="BAJ73247.1"
FT                   /translation="MARVKRAVNAHKKRRVILERASGYRGQRSRLYRKAKEQVTHSLVY
FT                   AYRDRRKRKGDFRRLWIQRINAASRQNGLTYNRFIQGLGLAGVQVDRRMLAELAVNEPA
FT                   VFASLVQTAKAALPSDVNAPKTA"
FT   regulatory      complement(285287..285292)
FT                   /gene="rplT"
FT                   /locus_tag="MTES_0283"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(285306..285500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmI"
FT                   /locus_tag="MTES_0284"
FT                   /product="ribosomal protein L35"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0284"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73248"
FT                   /db_xref="GOA:E8N9K1"
FT                   /db_xref="InterPro:IPR001706"
FT                   /db_xref="InterPro:IPR018265"
FT                   /db_xref="InterPro:IPR021137"
FT                   /db_xref="InterPro:IPR037229"
FT                   /db_xref="UniProtKB/TrEMBL:E8N9K1"
FT                   /protein_id="BAJ73248.1"
FT                   /translation="MPKQKTHSGAKKRFKLTGSGKLMKQQAGMRHNLEGKASKRTRRLN
FT                   QEQVLAKGDSKVAKKLLGL"
FT   regulatory      complement(285506..285511)
FT                   /gene="rpmI"
FT                   /locus_tag="MTES_0284"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(285548..286258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infC"
FT                   /locus_tag="MTES_0285"
FT                   /product="translation initiation factor 3 (IF-3)"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0285"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73249"
FT                   /db_xref="GOA:E8N9K2"
FT                   /db_xref="InterPro:IPR001288"
FT                   /db_xref="InterPro:IPR019813"
FT                   /db_xref="InterPro:IPR019814"
FT                   /db_xref="InterPro:IPR019815"
FT                   /db_xref="InterPro:IPR036787"
FT                   /db_xref="InterPro:IPR036788"
FT                   /db_xref="UniProtKB/TrEMBL:E8N9K2"
FT                   /protein_id="BAJ73249.1"
FT                   /translation="MPGGVCTPLRPRFHRIAAATTRTQEEFRISDPRTNERIRVPEVRL
FT                   VGPNGEQVGIVRIEAALRLAQEADLDLVEVAPSSKPPVVKIMDYGKFKYEAAQKAKETR
FT                   RNQANTVLKEVRFRLKIEAHDYITKLKRAEGFLQAGDKVKAMILFRGREQSRPEQGVRL
FT                   LRKFAEDVAEFGTVESNPTIDGRNMVMVVAPHKNKSEVKTEQNAQRAANREAARSAARG
FT                   DSDSEETPTSAPAE"
FT   regulatory      complement(286263..286268)
FT                   /gene="infC"
FT                   /locus_tag="MTES_0285"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      286409..286414
FT                   /locus_tag="MTES_0286"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        286421..286846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0286"
FT                   /product="predicted ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0286"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73250"
FT                   /db_xref="UniProtKB/TrEMBL:E8N9K3"
FT                   /protein_id="BAJ73250.1"
FT                   /translation="MDTIPSDQPADDHTAHRHGAEDERLARWEEQERAASSATRDIADV
FT                   PAVEVITTAAVHLMSAAAVKTGLADDPAQQLDLDEARKLINALAGLITAGAPEISDMHA
FT                   RSLRDGLRSLQLAFREASTIQDPIGKGPGEKWTGPVT"
FT   CDS_pept        complement(287099..287932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0287"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0287"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73251"
FT                   /db_xref="InterPro:IPR009839"
FT                   /db_xref="UniProtKB/TrEMBL:E8N9K4"
FT                   /protein_id="BAJ73251.1"
FT                   /translation="MSPDTDDPRDHSAHEHGSHEHGPHGHGADSAGVPWEGRSFQANPH
FT                   SGDDGSADPALLAALLAFRAGEGDARAVVDAYRDARLLIPLVAEKGDHGIGAHGLEVDK
FT                   TQELSIVTVAAPDGRKVLPVFTSVTALQTWDATARPVPADGRRTALAAASEDTELIVID
FT                   PASETEFVLRRPAVWAIAQGETWEPAHTSPTIFTGLQESISGELAVLDLAVESGDPSGR
FT                   LRGPELVVHLQLMSGLEQEELDAVLARLARRWSADDRIAVLVDSLTVKLHRSTDT"
FT   CDS_pept        complement(287916..288662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="priA"
FT                   /locus_tag="MTES_0288"
FT                   /product="phosphoribosylformimino-5-aminoimidazole
FT                   carboxamide ribonucleotide (ProFAR) isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0288"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73252"
FT                   /db_xref="GOA:E8N9K5"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR010188"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023016"
FT                   /db_xref="UniProtKB/TrEMBL:E8N9K5"
FT                   /protein_id="BAJ73252.1"
FT                   /translation="MNDFASTPELVLLPAVDVADGKAVRLTQGEAGTETSYGDPVDAAA
FT                   DFARQGAQWIHLVDLDAAFGRGSNANVMRKVIKQVKGVQVELSGGIRDDRSLEAALESG
FT                   ASRINLGTAALENPEWAADVINRYGEAIAVGLDVRGTTLAARGWTRDGGDLWTVLERLE
FT                   DAGCSRYVVTDVTKDGTLRGPNIELLREMTQRTPKPIVASGGVSSLDDIAALRELVPLG
FT                   VEGAIVGKALYAGQFTLAEALDVAGH"
FT   regulatory      complement(287937..287942)
FT                   /locus_tag="MTES_0287"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(288665..288670)
FT                   /gene="priA"
FT                   /locus_tag="MTES_0288"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(288709..289359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisH"
FT                   /locus_tag="MTES_0289"
FT                   /product="glutamine amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0289"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73253"
FT                   /db_xref="GOA:E8N9K6"
FT                   /db_xref="InterPro:IPR010139"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:E8N9K6"
FT                   /protein_id="BAJ73253.1"
FT                   /translation="MTRKPVVAVLDYGSGNVHSAVKALIEAGADARLTSDRSLLLDADG
FT                   LLVPGVGAYSAVMGALNDSRGGEIIDRRLAGGRPVLGICVGMQVMFERGIERGADTEGL
FT                   GEWPGTVAELEAPVLPHMGWNTVASGTGSRLFDGIENERFYFVHSYAAQEWSLEVTPPF
FT                   PEPVLTWCTYGAPFLAAVENGPLSATQFHPEKSGEAGIRLLANWIDGLRPTTV"
FT   CDS_pept        complement(289356..289970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisB"
FT                   /locus_tag="MTES_0290"
FT                   /product="imidazoleglycerol-phosphate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0290"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73254"
FT                   /db_xref="GOA:E8N9K7"
FT                   /db_xref="InterPro:IPR000807"
FT                   /db_xref="InterPro:IPR020565"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR038494"
FT                   /db_xref="UniProtKB/TrEMBL:E8N9K7"
FT                   /protein_id="BAJ73254.1"
FT                   /translation="MTGPATPRTASITRETSESRIELELDLDGRGASDIQTTVPFFDHM
FT                   LTAFAKHSLTDLRVRATGDTHIDAHHTVEDTSIVLGQAIRQALGDKSGIARYGDALVPL
FT                   DEALAQAVVDISGRPYLVHTGEPAGFEHHLIGGHFTGSLVRHSFEAIAIHAGLTVHVRV
FT                   LGGRDPHHIAEAEYKALARAFRQAKALDPLVDGIPSTKGAL"
FT   regulatory      complement(289365..289370)
FT                   /gene="hisH"
FT                   /locus_tag="MTES_0289"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(289967..291004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisC1"
FT                   /locus_tag="MTES_0291"
FT                   /product="histidinol-phosphate/aromatic aminotransferase
FT                   and cobyric acid decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0291"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73255"
FT                   /db_xref="GOA:E8N9K8"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR005861"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:E8N9K8"
FT                   /protein_id="BAJ73255.1"
FT                   /translation="MTPYGAPQAALPVALNVNENTHPVPSEVADDILDAVARALRDVNR
FT                   YPDREFTGLREAFAGYLGHGLSPEQIWAANGSNEVLQHILQAFGGPGRTAMGFAPTYSM
FT                   YPILTRSTGARWIAGEREHDFTLSPEFAAAQVREHRPDIVFLCAPNNPTGTPLRLDVVE
FT                   AVYEATDGIVIVDEAYQEFAPRDEPSAVTLLTDRPRLVISRTMSKAFAFAGARVGYLAA
FT                   DPALVDALRLVRLPYHLSALTQAAATAALSHADTMLSMVDEIVAQRDRISATVSALGYS
FT                   AHESWTNFVLFGGVEDPAATWKALYDRGVLIRDVGIAHHLRVTAGTADETTAFLDALAS
FT                   VGSRS"
FT   regulatory      complement(289978..289983)
FT                   /gene="hisB"
FT                   /locus_tag="MTES_0290"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      290929..290934
FT                   /locus_tag="MTES_0292"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        290939..291151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0292"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0292"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73256"
FT                   /db_xref="UniProtKB/TrEMBL:E8N9K9"
FT                   /protein_id="BAJ73256.1"
FT                   /translation="MRVLVHVESHRESRLRGTVGCHPAEIVAERQVIEAHSHPTHGRRP
FT                   GNRRVAEASAQDGNTAGRRTDRSRA"
FT   regulatory      complement(291013..291018)
FT                   /gene="hisC1"
FT                   /locus_tag="MTES_0291"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(291159..291512)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0293"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0293"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73257"
FT                   /db_xref="GOA:E8N9L0"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:E8N9L0"
FT                   /protein_id="BAJ73257.1"
FT                   /translation="MSSLSVTPAPVTRLRLTARGRRVIAFLVALPVVVALGLAIVGGGA
FT                   ALASGEGGAPSGSFAEITVMSGETLWSIAEDVAPQADPRDVVAEISRLNALDGGVVAAG
FT                   QRIAIPSEYLAAP"
FT   regulatory      complement(291519..291524)
FT                   /locus_tag="MTES_0293"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      291759..291764
FT                   /gene="lexA"
FT                   /locus_tag="MTES_0294"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        291771..292460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lexA"
FT                   /locus_tag="MTES_0294"
FT                   /product="SOS-response transcriptional repressors"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0294"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73258"
FT                   /db_xref="GOA:E8N9L1"
FT                   /db_xref="InterPro:IPR006197"
FT                   /db_xref="InterPro:IPR006199"
FT                   /db_xref="InterPro:IPR006200"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR039418"
FT                   /db_xref="UniProtKB/TrEMBL:E8N9L1"
FT                   /protein_id="BAJ73258.1"
FT                   /translation="MTDATTAAGRERPQTRRRKNLSDKQLAILEVIQRSIARHGYPPSM
FT                   REIGDAVGLKSLSSVTHQLNQLELSGYLRRDPGKTRAMEVLIDLPGAAAENPADTAPAL
FT                   GDAALVPLVGRIAAGVPITADQQVEEIFPLPRQLVGKGELFMLKVSGDSMIDAAICDGD
FT                   WVVVRSQATAENGEIVAAMLDGEATVKTFRRRDGHTWLLPRNSAFEPILGDEAVVLGRV
FT                   VAVLRAV"
FT   regulatory      292569..292574
FT                   /locus_tag="MTES_0295"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        292580..294472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0295"
FT                   /product="dipeptidyl
FT                   aminopeptidase/acylaminoacyl-peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0295"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73259"
FT                   /db_xref="GOA:E8N9L2"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E8N9L2"
FT                   /protein_id="BAJ73259.1"
FT                   /translation="MADTLPYGSWPSPLTPESVAQSSPRVDGARLVGDEVWWGESVPAE
FT                   AGRVAVKRRRADGSVDTVLPAPGNARSAVHEYGGGAWTASDDGELFYVEKTDQRVYALR
FT                   PGAAARALTPADEAVRHGGLRFEHGVLLAVRETHGGGRVPARAIVRIRTDVEAAGEILA
FT                   EGSDFLAQPALSPDGRHLAWVAWNHPDMPWDATTIRVADLESGVVHDVAGGENRAPLQP
FT                   VWIGDDELLYADDPDGRWNLFRHPLDAEAQAVAPADADTGGGLWVLGTRWFAATDDGRI
FT                   VAVRTHGGDEVVEIAPSGIRPLEVPPVSGAAVDDARGSRVLISGADGGGRSGLWLVDLD
FT                   SGVVDLVTGGAGPWGDDWMPTALALETEGPHGPVHAFAYPPTNPDVSAPADERPPYVVL
FT                   VHGGPTSQVGPAPSAKTAFFTSRGIGVLDVNYGGSTGYGREYRDRLKGQWGVVDVDDVA
FT                   AAASALADAGLADPERLAIAGGSAGGWTVLAAVTNTDVFSAGISRYGVGDARALAEDTH
FT                   DFEARYLDGLIGPLPEAEAVYVERSPLSHPERFRVPLLILQGSEDRVVPPSQAEAIRDA
FT                   LAAHGVPHAYVLYEGEGHGFRRAETVVDSLRRELGFLGAVFGFETPGVPPLELE"
FT   CDS_pept        complement(294529..295515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0296"
FT                   /product="predicted ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0296"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73260"
FT                   /db_xref="GOA:E8N9L3"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005654"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E8N9L3"
FT                   /protein_id="BAJ73260.1"
FT                   /translation="MPDPLFAAVEARARREGFGLDPDQQAALERMTWAASRALTGDAVR
FT                   GVYLFGPAGRGKSWLADALFAALPGGSATRVHFHGFFDDLHRRIQTHRREPDATTRALD
FT                   DICGGRRLVFFDELHVHDPGDARLLTRLIERLVKRGCTLVATSNYAPRELLPDPVWHHL
FT                   FVPGIALLEAHLDVFRLDGVVDYRTRAQAHTSGFRAGVWSTVVPTAVRPAPRELSVRDR
FT                   LFNVTFADESSLIATFAQLCDSPVAPAEYRHWSRVYRHWTITDVPPLDEVGPSAQQRFV
FT                   NLIDVLVDADVHLDVHSSVDLEVFLERAATRPDAFRMASRLRLLRRG"
FT   regulatory      complement(295520..295525)
FT                   /locus_tag="MTES_0296"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(295626..297143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hflX"
FT                   /locus_tag="MTES_0297"
FT                   /product="GTPase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0297"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73261"
FT                   /db_xref="GOA:E8N9L4"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR016496"
FT                   /db_xref="InterPro:IPR025121"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030394"
FT                   /db_xref="InterPro:IPR032305"
FT                   /db_xref="InterPro:IPR042108"
FT                   /db_xref="UniProtKB/TrEMBL:E8N9L4"
FT                   /protein_id="BAJ73261.1"
FT                   /translation="MTEQTTPPNTDAAPVDPVDRVLSRAEAHRGVRVFGAAQALQDAAT
FT                   AYGGSTDGDQWDREERAALRRVPGLSTELEDVTEVEYRQLRLENVVLVGVHPQGYQSDA
FT                   ENSLRELAALAETAGAVVLDGVLQRRPHPDPATYVGRGKAEELRDIVAAVGADTVIADT
FT                   ELAPSQRRALEDVVKVKVIDRTTVILDIFSQHAKSREGKAQVELAQLEYLLPRLRGWGD
FT                   SMSRQAGGQVGAGGAGMGSRGPGETKIELDRRRIRTKMALLRKQLRDFAPARAAKRAER
FT                   KRHTIPSVAIAGYTNAGKSSLLNRLTSAGVLVENALFATLDATVRRSETTDGRVYTLTD
FT                   TVGFVRNLPHQLVEAFRSTLEEVGDADVILHVVDASHPDPAAQLATVRDVMGDVEADFG
FT                   HEIVVFNKADLVSDDDRLVLRGLAPHAHFVSSRTGEGIDELRAAIEEALPRPAVEVQAV
FT                   VPYDRGDLVSAVHESGLILAQEHRETGTFLHAHVGARLAAELEPYAA"
FT   regulatory      complement(297148..297153)
FT                   /gene="hflX"
FT                   /locus_tag="MTES_0297"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      297238..297243
FT                   /locus_tag="MTES_0298"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        297252..297896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0298"
FT                   /product="16S RNA G1207 methylase RsmC"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0298"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73262"
FT                   /db_xref="GOA:E8N9L5"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E8N9L5"
FT                   /protein_id="BAJ73262.1"
FT                   /translation="MGSDHYFSASPSSPEQLRRIRVTLAGRDLEVVTAGGVFSPDHVDA
FT                   GTSVLLANTPPPPAGGHFLDLGCGWGPISLSLALSSPHATVWAVDVNERALDLVRRNAE
FT                   SLGLTNVNAVRPEDVPDDIAFRTIRSNPPIRVGKSELHGMLEHWIPRLSERSDGWFVVQ
FT                   RNLGSDSLQRWLAASFTPGYSVHRAATGRGFRVLRVRRHGSPPSEPIDIVS"
FT   CDS_pept        complement(298047..298901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapF"
FT                   /locus_tag="MTES_0299"
FT                   /product="diaminopimelate epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0299"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73263"
FT                   /db_xref="GOA:E8N9L6"
FT                   /db_xref="InterPro:IPR001653"
FT                   /db_xref="InterPro:IPR018510"
FT                   /db_xref="UniProtKB/TrEMBL:E8N9L6"
FT                   /protein_id="BAJ73263.1"
FT                   /translation="MATHAFTKGHGTGNDFVVLADPDGELDLSDAQIAVLCDRHFGIGA
FT                   DGLLRVVRSAAIDEGAEAAASGAEWFMDYRNADGSKAEMCGNGTRVFARYLSDTGLASL
FT                   DGGLRIGTRAGVKTLTRSERGYEVDLGAFAIEATDTLVRAKGLPVARPGVGIDVGNPHV
FT                   VVAVASDAELEALDLTYQPVLDPAPRHGANVEFVVPADPLVQEGVGAIRLRVFERGVGE
FT                   TLSCGTGVAAAALAVRHWAGSAAPDVWTVDTPGGTLGVRVADGHVFLSGPASLVFTGEV
FT                   TLA"
FT   regulatory      complement(298905..298910)
FT                   /gene="dapF"
FT                   /locus_tag="MTES_0299"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(298975..299424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0300"
FT                   /product="acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0300"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73264"
FT                   /db_xref="GOA:E8N9L7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:E8N9L7"
FT                   /protein_id="BAJ73264.1"
FT                   /translation="MSTLIRAFTLDDEDAVVALWEEAGLTRPWNDPRADIRRKLTVQPE
FT                   LFLVATDGDAVVGSVMAGYDGHRGWLYYLATAGTHRGKGIGAALVAEAERLLEAIGCPK
FT                   VQLMVRPDNTGARGFYDALGYEPFETWATGRRLIVDGPGGPPPAR"
FT   CDS_pept        complement(299421..300350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="miaA"
FT                   /locus_tag="MTES_0301"
FT                   /product="tRNA delta(2)-isopentenylpyrophosphate
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0301"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73265"
FT                   /db_xref="GOA:E8N9L8"
FT                   /db_xref="InterPro:IPR018022"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039657"
FT                   /db_xref="UniProtKB/TrEMBL:E8N9L8"
FT                   /protein_id="BAJ73265.1"
FT                   /translation="MTAPTLWAVVGATGTGKTGLSLELAEALAARGRPAEIVNADAMQL
FT                   YRGMDIGTAKLPEAERRGIPHHLFDALAVTDEAAVAWYQDAARAAIRGIHARGADAILV
FT                   GGSGLYVSAVLWDFRFPPRDEALRAELEDELERHGSGVLFARLREADPAAAERIDPRNG
FT                   RRVVRALEVLAQGGETHGGALPEAPELWHPDTRILATAIDRETLVPLLDARVEGMWSAG
FT                   LVDEVEALRAEGLERGATAGRAIGYAQALAELRGDLTRDEAIAETQALTRRYARRQVSW
FT                   FRRYRDARWVDARTADAATLTSDREERP"
FT   regulatory      complement(299431..299436)
FT                   /locus_tag="MTES_0300"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(300347..301894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0302"
FT                   /product="2-methylthioadenine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0302"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73266"
FT                   /db_xref="GOA:E8N9L9"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR006463"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="UniProtKB/TrEMBL:E8N9L9"
FT                   /protein_id="BAJ73266.1"
FT                   /translation="MTTPVSTPTLIAPSPAAHGASGPRTYEVRTFGCQMNVHDSERLSG
FT                   SLESAGYVRADAGAEADVIVINTCAVRDNAAGKLYGTLGHLKSRKDAHAGMQIAVGGCL
FT                   AQMDKDAVQQKAPWVDVVFGTHNMGSLPGMLERARHNGEAELEILESLEIFPSTLPTKR
FT                   DSVHSGWVSISVGCNNTCTFCIVPSLRGKEKDRRPGDILNEIRLLVDDGAIEVTLLGQN
FT                   VNSYGVEFGDRLAFGKLLRAAGEIEGLERIRFTSPHPAAFTDDVIAAMAETPAVMPQLH
FT                   MPLQSGSDRILKAMRRSYRSEKFLGILDRVRERIPHAAITTDIIVGFPGETEEDFQETL
FT                   RVVEAARFSSAFTFQYSIREGTPAATMADQVPKAVVQERYERLIALQDRIAAEENQKQL
FT                   GRSLEVLVSAGEGKKDAETHRLTGRAEDNRLVHFELPKGSPVPRPGDVVSVTVTHAAPF
FT                   HLLADAPDGAPLRIRRTRAGDAWDRSQAESCGVPAPAGDAGAPRAVSLGLPTLRVGV"
FT   regulatory      complement(301903..301908)
FT                   /locus_tag="MTES_0302"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      302084..302089
FT                   /locus_tag="MTES_0303"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        302096..304681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0303"
FT                   /product="DNA-binding HTH domain-containing proteins"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0303"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73267"
FT                   /db_xref="GOA:E8N9M0"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:E8N9M0"
FT                   /protein_id="BAJ73267.1"
FT                   /translation="MRDGRSWTSWSEPLIGADRDAAALAGSLLAGTSVIVAGARGSGRS
FT                   HLLRAVVRELAGHGVAPVVIRPSTVLSEVPFGALDAAGDPRMIDLRRGRVPDGDVIVLV
FT                   DDVHALDVDSARFLARCVADGRVTLLATLLIPRARARRVDLDTRGVGQTILSLWLDGLA
FT                   ERLDLSELTPADSEKLLAVLPGASTLDATICGAILWRADGSRTLLRELVAEAVAAVAAG
FT                   RDPFAAIRDTPPHSRLSVSLTLHTGDLAEADQECLAFLNRLPHVEFSVATRFTSHARLE
FT                   ALITAGLVHSDDSPARRLTANEAIAREAERQLGTARIDALITAAGTRMLEADGEWWCTP
FT                   LAVSIAERWHRGDDATDAPISSALRSRVALDAAREANDRGDAAHAAAHAARGLRARESP
FT                   ELRLEAAYALAQLGTGSDTMTIDEIDPRDMDDEGRGRLARLRAVIADRGLAVPLYAATR
FT                   GDADAEIERHLDESARAGASFAWTRAVEAAERALALSTERSATHLRARLSAGMAESFRG
FT                   RWTRARAHFDEVERLLDARQRPVDVGATQRLSALLVMLASYQLAGADGGALYARLSGER
FT                   TTAAREHDVVALTIAGVAASIADTNLGRPGDALLEWEAVRAKSAGFLSGPDADLAELGL
FT                   AEALAASGRVGDARAMLSRIETGDELHVRHARTSVETTVLMAEGRTGEARVAARDAAAL
FT                   SAGHEVPPIRARDLFRLVVLRNSDEAENEELRELLRTTDLPLAAELRERLEAWEAGDVH
FT                   DPGERLRLHPLWSVDDGVDAARLGRLSRFPSPTPSAEMPALNELTRREKEIALLVEQGH
FT                   TNREIAERLYLSVRTVESHVYQARAKIGVSSRGELGRLVAQWENQQSRA"
FT   CDS_pept        complement(304810..305763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0304"
FT                   /product="uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0304"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73268"
FT                   /db_xref="GOA:E8N9M1"
FT                   /db_xref="InterPro:IPR003783"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:E8N9M1"
FT                   /protein_id="BAJ73268.1"
FT                   /translation="MTDGQRPGRHRGLSSVDGGPGVAGDDALAPVIPLFGGARSRSTAG
FT                   RDAGESTPFGILDAGERFGRREADDSARFGHPSMLRTRDRDHGGAWSDDAWSASTGAGT
FT                   AGSDGAGFDSAGPDGAGPDSAGFDDPRFATPGHDAETAQDDVRERAEALLLRKLRSRSL
FT                   SISEARSALREVPGADDVVITELIDRFVDLGYLNDAVFTEQLVLSAVERRGEGRRAVAN
FT                   TLLKRGIPRDIADAAIAEMPDDDAERALEYARSKARGVGGKDDDAALRRLAGQLARRGY
FT                   PSSVALTAARQALREVGVGRSRPARPTSGVRFTPDE"
FT   CDS_pept        complement(305763..306815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recA"
FT                   /locus_tag="MTES_0305"
FT                   /product="RecA/RadA recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0305"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73269"
FT                   /db_xref="GOA:E8N9M2"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013765"
FT                   /db_xref="InterPro:IPR020584"
FT                   /db_xref="InterPro:IPR020587"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR023400"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E8N9M2"
FT                   /protein_id="BAJ73269.1"
FT                   /translation="MPSPAEREKALESALAQIDRQFGKGSVMRLGSDDRAPIETIPTGS
FT                   VALDVALGIGGLPRGRIIEIYGPESSGKTTLTLHAIANAQRAGGIAAFIDAEHALDPEY
FT                   AKKLGVDIDALLVSQPDTGEQALEIADMLIRSGAIDLVVIDSVAALVPEAEIKGEMGDS
FT                   HVGLQARLMSQALRKLTGGLNTTKTTAIFINQLREKIGVFFGSPETTAGGKALKFYASV
FT                   RLDIRRIETLKDGTEAVGNRTRVKVVKNKMAPPFKQAEFDILYGVGISREGSLIDFGVE
FT                   HGIVKKSGAWYTYEGEQLGQGKENARNFLIKNADVAAEIESKIKNKLGIGAPAAPAEPA
FT                   ADELAARRPA"
FT   regulatory      complement(306821..306826)
FT                   /gene="recA"
FT                   /locus_tag="MTES_0305"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(307095..307319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0306"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0306"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73270"
FT                   /db_xref="InterPro:IPR021408"
FT                   /db_xref="UniProtKB/TrEMBL:E8N9M3"
FT                   /protein_id="BAJ73270.1"
FT                   /translation="MRRSEFDRAVAEEFGARGGSLLTDLVLSAVGGRTPAEALSAGVEP
FT                   RDVWLALCAETDVPLERRYGVGRLEPRPR"
FT   CDS_pept        complement(307338..307646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0307"
FT                   /product="predicted transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0307"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73271"
FT                   /db_xref="GOA:E8N9M4"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:E8N9M4"
FT                   /protein_id="BAJ73271.1"
FT                   /translation="MILVRQEIGEVLRDLRQQKGRTLRQVASRASVALGYLSEVERGQK
FT                   EASSEILASVAEALDVPISSIMREVGDRLSVLEGLQTFPDVVPDDLVAEVEPELSLR"
FT   regulatory      complement(307654..307659)
FT                   /locus_tag="MTES_0307"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(307818..308345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0308"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0308"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73272"
FT                   /db_xref="InterPro:IPR008136"
FT                   /db_xref="InterPro:IPR036653"
FT                   /db_xref="UniProtKB/TrEMBL:E8N9M5"
FT                   /protein_id="BAJ73272.1"
FT                   /translation="MSHGIPDDFDETLIIDPRESAAMLLDRLAELGWTVAVAESLTGGL
FT                   LVSSLVDVPGASRVVRGGVVAYATDVKQSVLGVDAALLEAHGAVHPRVARQMARGVRDV
FT                   LGRDGVPADVGVATTGVAGPDTQDGHVVGTVHIGVSTPLGTSVDSLVIAGDRERIRREA
FT                   ARIAVRRTLAAL"
FT   CDS_pept        complement(308342..308929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0309"
FT                   /product="phosphatidylglycerophosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0309"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73273"
FT                   /db_xref="GOA:E8N9M6"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR004570"
FT                   /db_xref="UniProtKB/TrEMBL:E8N9M6"
FT                   /protein_id="BAJ73273.1"
FT                   /translation="MTVHPQLPNAITIARILCAPVFLWMLLADGGTGGALRWAAGIVFI
FT                   VAIATDGIDGYIARKYEIVSDLGKLLDPIADKVLTGVAFVGLSILGELDWWVTIVVLVR
FT                   EVGITVYRFMVVSDHVLAAAWMGKLKTVAQAVALSIALLPFAGLSEAPGWQSSVWWAGV
FT                   VTMTIAVVLTIASGLDYVVTEVRAARTARRSR"
FT   regulatory      complement(308352..308357)
FT                   /locus_tag="MTES_0308"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(308929..311709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsK"
FT                   /locus_tag="MTES_0310"
FT                   /product="DNA segregation ATPase FtsK/SpoIIIE"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0310"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73274"
FT                   /db_xref="GOA:E8N9M7"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR018541"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041027"
FT                   /db_xref="UniProtKB/TrEMBL:E8N9M7"
FT                   /protein_id="BAJ73274.1"
FT                   /translation="MKPASVRTNVGGPAYRGTMARTSSPSGGRAPAKGTPRPKAAAPAP
FT                   KRSAPAPKRYVDEPEKPSIAVRAWMAVAHGVGGMFRAFGLESLERDQRRDGFPFFLVVL
FT                   AVVGAVVEWFFIGNDVAAVISAYSFGALVGRVAFVLPVLLLLLAGWLFRHPASVHDNGR
FT                   VGIGWALFIITVAGFCHVAGDRPVPSNGGLPVLSLSGGLAGWIVGEPLALLLTNVGAYI
FT                   ALSLLAVLSILILTKTPPNRIGRRLGDLYAWMFGVERIEPSDTTTKVLPAAEDDDEPAE
FT                   KSLPWWRRNKSGREEDVDGSLGSDDLTELLTPGTPQGGFESPVVAPEQITAPVRPLSPP
FT                   PPAPDALTEVFDAATLAKAASGRGLHDDSPVDDVPDDDMPGISGLGGDNAGAPPSANYR
FT                   LPAVTALATGTPPKARSAANDAVVKAIESVMEQFKVDARVTGFSRGPTVTQYEIEVGPG
FT                   VKVERITALTNNIAYAVASNEVRILAPIPGKSAIGVEIPNADREIVTLGDILRSDAATS
FT                   STHPMTIGVGKDVGGGFVVANLAKMPHLLVAGSTGSGKSSFVNSMITSLLMRAKPSDVR
FT                   MVLIDPKRVELTSYAGVPHLITPIITNPKKAAEALQWVVKEMDMRYDDLASFGFRHIDD
FT                   FNKAVVAGEIKLPPGSERVLKPYPYLLVVVDELADLMMVAPRDVEDSIVRITQLARASG
FT                   IHLVLATQRPSVDVVTGLIKANVPSRLAFAVTSVTDSRVILDQPGADRLIGQGDGLFLP
FT                   MGASKAVRVQGAWVSEQEIEKVVAHVTQQARPEYRSDVQAAAEKKEIDADIGDDLELLL
FT                   AAAELVVSTQFGSTSMLQRKLRVGFAKAGRLMDLLESREIVGPSEGSKARDVLVTNEQL
FT                   PTVLAKLRGDDVPAAAAADDDRYGADPIEAQFEGVPVVDDDDEGSEDAWQLTGRD"
FT   regulatory      complement(308938..308943)
FT                   /locus_tag="MTES_0309"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(311706..312197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0311"
FT                   /product="histone acetyltransferase HPA2"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0311"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73275"
FT                   /db_xref="GOA:E8N9M8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:E8N9M8"
FT                   /protein_id="BAJ73275.1"
FT                   /translation="MPGLPIRAALPSDGAFLADMMVEAATWRAGAVRPRHEILSSEEYR
FT                   RYLAGWLRPGDAGFVAESPGGEPVGAAWYRMLPRDEPGFGWVGTGVPELIIGVRPVWRA
FT                   HGVGRALLQRLADHARAQGFARISLSVDRENHAVSLYRSEGFAVVRRGIGRDVMVKRLR
FT                   "
FT   regulatory      complement(311715..311720)
FT                   /gene="ftsK"
FT                   /locus_tag="MTES_0310"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(312206..312211)
FT                   /locus_tag="MTES_0311"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(312276..313952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0312"
FT                   /product="predicted hydrolase of the metallo-beta-lactamase
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0312"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73276"
FT                   /db_xref="GOA:E8N9M9"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR004613"
FT                   /db_xref="InterPro:IPR011108"
FT                   /db_xref="InterPro:IPR030854"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR041636"
FT                   /db_xref="InterPro:IPR042173"
FT                   /db_xref="UniProtKB/TrEMBL:E8N9M9"
FT                   /protein_id="BAJ73276.1"
FT                   /translation="MPTTVYDPPELAPGTLRVFPLGGLGEVGRNMTVFEYEGKLLVVDC
FT                   GVLFPEEHQPGVDLILPDFEPIKHRLDDIVGVVLTHGHEDHIGAVPYLLKLKGDIPLIG
FT                   SGLTLALIEAKLKEHRIRPYTLTVKEGQREQVGPFDLEFVAVNHSIPDALAVAIRTPAG
FT                   MVLATGDFKMDQLPLDGRITDLRAFARLGEEGVDLFLVDSTNADVPGFTPTERGIGPVL
FT                   DQVIAKAPRRVVVASFSSHVHRVQQVLDAAHANGRRVALLGRSMVRNMGIAADLGYLNV
FT                   PDGVLIDYKKARDLPDDKIVYMSTGSQGEPMAVLSRMANLDHAIEPGEGDTIILASSQI
FT                   PGNENAIYRVIDGLTKLGATVVHKGNAKVHVSGHAAAGELLYCYNILKPKNVLPVHGEY
FT                   RHLMANAKLAQETGIPEQNTILGENGTVVDLRDGVASVVGQLDIGFVYVDGSSVGAITD
FT                   ADLKDRRILGEEGFISVIVVVDSATGRIVSGPDIHARGVAENDSVFESVKPKIAAALTE
FT                   AAQSGVRDNHALSQVVRRTIGRWVNQSLRRRPMIVPLIIEA"
FT   regulatory      complement(313958..313963)
FT                   /locus_tag="MTES_0312"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(314060..315037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0313"
FT                   /product="dihydrodipicolinate synthase/N-acetylneuraminate
FT                   lyase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0313"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73277"
FT                   /db_xref="GOA:E8N9N0"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR005263"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020625"
FT                   /db_xref="UniProtKB/TrEMBL:E8N9N0"
FT                   /protein_id="BAJ73277.1"
FT                   /translation="MTHSGNPFGQVLVALITPMTADGEVDWPATEKHIDDVITAGADGI
FT                   VVTGTTGETSTLTDPEKLRLVEVGKSVSAGRAKIITGGGSNETAHAIELYKASEKAGAD
FT                   GIMIVTPYYNKPTQAGILTHFRLVADATDLPVILYDIPGRTGVPIKYETILRLAKHPNI
FT                   LAIKDAKGDFSEVSRVLNQTDLMYFSGDDANVLPHLSIGASGLIGVTANITATPYRTIV
FT                   DAVNAGDLASATAAHQSLEPLVRAVMTHVPGTVAAKYILHGLGRIGSPRVRLPLVGPEE
FT                   WEAAVIEDELALVKNVAGADFSNFRPDRNAAAGGALPKVHGTTR"
FT   regulatory      complement(315046..315051)
FT                   /locus_tag="MTES_0313"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      315109..315114
FT                   /locus_tag="MTES_0314"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        315121..315657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0314"
FT                   /product="NTP pyrophosphohydrolase including oxidative
FT                   damage repair enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0314"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73278"
FT                   /db_xref="GOA:E8N9N1"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:E8N9N1"
FT                   /protein_id="BAJ73278.1"
FT                   /translation="MTWTTRATRTVYENPWIHVREDQVTGPHGEGIYGVVRMQHPAVFV
FT                   IALDDEERVCLVELERYTTGRSIEVPAGGSDGEDPLLAAQRELLEETGVTASEWQHLGR
FT                   MNALNGIADAPEHVYLARGLSTTDATASQHEEGIAAVRWVPFAEALTLVADGGITDGET
FT                   IAALAFAGIRLGRFR"
FT   CDS_pept        complement(315713..316465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0315"
FT                   /product="short-chain dehydrogenase of various substrate
FT                   specificities"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0315"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73279"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E8N9N2"
FT                   /protein_id="BAJ73279.1"
FT                   /translation="MPTALITGASSGLGSEFARQLAARGADLVIVARDRTALEALADEI
FT                   SGRRGVRVEVLVADLLDEEALAAVETRLAEGVDVLVNNAGFGLDLAFENNPVDDEVRHL
FT                   RLHVEAALRLTRAALPRMLERGRGRIVNVASVAGFVPRGTYGAAKGWLISFSRWANVVY
FT                   RPRGVSVTAVCPGFVHTNFHERLGLPPGQEGVAPGLWLDAETVVREGLRDAARDRAVSV
FT                   PSWRYKTLVAVSRLLPDRIVVRAAARGR"
FT   CDS_pept        complement(316467..316967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0316"
FT                   /product="dihydrofolate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0316"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73280"
FT                   /db_xref="GOA:E8N9N3"
FT                   /db_xref="InterPro:IPR001796"
FT                   /db_xref="InterPro:IPR012259"
FT                   /db_xref="InterPro:IPR017925"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:E8N9N3"
FT                   /protein_id="BAJ73280.1"
FT                   /translation="MTEIGLVWAEARGGVIGSDGGMPWHVPEDLAHFRAVTGSSDVVMG
FT                   RRTWESLPPRFRPLPGRRNIVVTGTDTWSAEGAERATSFDDALSRAESDTVWVIGGGRL
FT                   YADAIHRADVVELTRLDVAVEGDTFAPSIEGWRRDAVDPAEEWHTSRTGIRYRFETYRR
FT                   RED"
FT   regulatory      complement(316471..316476)
FT                   /locus_tag="MTES_0315"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(316964..317773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thyA"
FT                   /locus_tag="MTES_0317"
FT                   /product="thymidylate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0317"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73281"
FT                   /db_xref="GOA:E8N9N4"
FT                   /db_xref="InterPro:IPR000398"
FT                   /db_xref="InterPro:IPR020940"
FT                   /db_xref="InterPro:IPR023451"
FT                   /db_xref="InterPro:IPR036926"
FT                   /db_xref="UniProtKB/TrEMBL:E8N9N4"
FT                   /protein_id="BAJ73281.1"
FT                   /translation="MTADIPTPYEDLLRDVLETGVHKSDRTGTGTTSVFGRQIRFDLAE
FT                   GFPLITTKRVHLKSIVYELLWFLRGESNVGWLKDNGVTIWDEWADGEGELGPVYGVQWR
FT                   SWPTADGGTIDQISQVIEQIRRDPDSRRLIVSAWNPADIPDMALAPCHALFQFYVAEGK
FT                   LSCQLYQRSADMFLGVPFNIASYALLTLMVAQQTGLEPGDFVWTGGDCHVYDNHREQVQ
FT                   EQLTREPYPYPTLRFARTPESIFDYTYDDILVEDYQHHPAIRGAVAV"
FT   regulatory      complement(316978..316983)
FT                   /locus_tag="MTES_0316"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(317782..317787)
FT                   /gene="thyA"
FT                   /locus_tag="MTES_0317"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      317901..317906
FT                   /locus_tag="MTES_0318"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        317920..318366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0318"
FT                   /product="thiol-disulfide isomerase and thioredoxins"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0318"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73282"
FT                   /db_xref="GOA:E8N9N5"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E8N9N5"
FT                   /protein_id="BAJ73282.1"
FT                   /translation="MSTVDLALALVIVAALLAATVVLGLVWRRGQGRARTVDSGETVDP
FT                   RVLESGPFGETATLVQFSTEMCTRCPGVHRMLSAVADDRAGVRHIDVDLTHRPDLAKRF
FT                   RVLQTPTTLLLDGTGLTVRRFGGPPTRADVEHELDRLTKETAHG"
FT   regulatory      318346..318351
FT                   /locus_tag="MTES_0319"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        318359..318919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0319"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0319"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73283"
FT                   /db_xref="GOA:E8N9N6"
FT                   /db_xref="InterPro:IPR016942"
FT                   /db_xref="InterPro:IPR025508"
FT                   /db_xref="UniProtKB/TrEMBL:E8N9N6"
FT                   /protein_id="BAJ73283.1"
FT                   /translation="MADPARIDARGPRFAASITAVLLLVATLLSLLGVSTSREASYQPL
FT                   SGETLAPGGWVLPQISVVARATDPGFLLVLVVALLFVWGVSSPRTAPWGVLYRRVVQPR
FT                   LAPPTEFEDPRPPRFAQGVGLFVTAVGLLLHLAGVPWALPIAAAMAFVAAFLNAAFGLC
FT                   LGCQLYLVLQRAGLVGRRGPASA"
FT   regulatory      319042..319047
FT                   /locus_tag="MTES_0320"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        319054..319479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0320"
FT                   /product="predicted redox protein, regulator of disulfide
FT                   bond formation"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0320"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73284"
FT                   /db_xref="GOA:E8N9N7"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR019904"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:E8N9N7"
FT                   /protein_id="BAJ73284.1"
FT                   /translation="MAVTSEAATAWKGSLFEGSGEVTFTSSGIGTFDVNWKARSEGSTS
FT                   VTTPEELLAGAHSACFSMALSNALAENGTPPESVDATASVTFKPGTGITGSHLNVNAVV
FT                   PGLDAATFERIANDAKANCPVSQALAGIDITLEATLA"
FT   regulatory      319463..319468
FT                   /locus_tag="MTES_0321"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        319472..320392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0321"
FT                   /product="predicted nucleoside-diphosphate sugar epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0321"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73285"
FT                   /db_xref="GOA:E8N9N8"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR010099"
FT                   /db_xref="InterPro:IPR013549"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E8N9N8"
FT                   /protein_id="BAJ73285.1"
FT                   /translation="MPETPARRVVLAGASGLIGSALAESLRGDGVEVTSLVRHEPRGPH
FT                   EVQWLQDAAPLDPDVLAGADAVVCLNGASIGRFPWTPSYKSTLLWSRITPTRTLATAIR
FT                   ALGTDAPALVNASATGYYGSQPGAVLTEASGRGKGFLVDVCVDWEAAARTAGDHARVAL
FT                   LRTAPIVHEKGVLKPLLLLTKLGASGPIGRGTQVWPWITLDDEVRAIRHVIDSDVDGPV
FT                   NLTGPTRATANDLGFALARRMNRPYVLRAPVWGMKLALGKDATDALLISDADVRPRVLE
FT                   ESGFTFTHRTVEEAVASAVPVAGKR"
FT   CDS_pept        complement(320636..321088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0322"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0322"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73286"
FT                   /db_xref="GOA:E8N9N9"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:E8N9N9"
FT                   /protein_id="BAJ73286.1"
FT                   /translation="MRVRLAVALMTVLLLLYVFLAGQRAIVLLGSGEAVGVVMGVALIV
FT                   LPLLALWAIGRELWFGVRAQRVGERLDAEGGLPDEDLPVRPSGRIEREDGDALFPRYRA
FT                   DVEAHPDDWRARYRLGLAYDAAGDRRRAREAIRTAIRLESAERRAD"
FT   CDS_pept        complement(321085..321897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0323"
FT                   /product="dihydrodipicolinate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0323"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73287"
FT                   /db_xref="GOA:E8N9P0"
FT                   /db_xref="InterPro:IPR000846"
FT                   /db_xref="InterPro:IPR022663"
FT                   /db_xref="InterPro:IPR022664"
FT                   /db_xref="InterPro:IPR023940"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E8N9P0"
FT                   /protein_id="BAJ73287.1"
FT                   /translation="MTTRVAIVGGTGKLGGVIREVVEAEEGYEVAAVLTSKSGMSELDG
FT                   ADLVIDASTPAVSIDIVRAAIERGINVLVGTSGWSNERIALVRPLVDASGTGAVFIPNF
FT                   SLGSVIGSALAAAAAPFFPSIEIIEAHRETKVDSPSGTAVRTAELIAAARAEVGPVESP
FT                   HVDQRARGQRVASVPIHSLRRPGVVARQETVLSGPGESLTIVHDTIDPATAYAPGIRIA
FT                   LAAAREATGVVIGLDSFIDIGVRTRPVAAEAPVADGDVSGQVAGATSA"
FT   regulatory      complement(321091..321096)
FT                   /locus_tag="MTES_0322"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(321904..321909)
FT                   /locus_tag="MTES_0323"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      322006..322011
FT                   /locus_tag="MTES_0324"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        322016..322642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0324"
FT                   /product="SAM-dependent methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0324"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73288"
FT                   /db_xref="GOA:E8N9P1"
FT                   /db_xref="UniProtKB/TrEMBL:E8N9P1"
FT                   /protein_id="BAJ73288.1"
FT                   /translation="MTRYRAFFPLALIAVVFSTTGCVQWGEYAMGGECAGLSQRVSDVV
FT                   DDAYGTTVTIDDLWAGESDVWCRFDVVTGENLPEGDPQRRDVADRVLAMVNDFSVEGVE
FT                   VALRYTSGSDTIVAAPTECVAAARDAQARVAAHYGLASAPAIQWGQPGTLACRFSLTID
FT                   RDLPYDAEERAGARDLVRATLTPDVEVSLVYPDSRDTIVIDSRGN"
FT   regulatory      322671..322676
FT                   /locus_tag="MTES_0325"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        322683..323384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0325"
FT                   /product="SAM-dependent methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0325"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73289"
FT                   /db_xref="GOA:E8N9P2"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:E8N9P2"
FT                   /protein_id="BAJ73289.1"
FT                   /translation="MRGPSGALDARTTKRGVSDDGGVSETDATRRFYDTIAAAYAAALP
FT                   ETRAEASLDLGTIAQFVADLPDGDGPIVDAGCGTGRLLTHLAALGVSPLTGVDLSPAMV
FT                   AHARTAHPEVPIEVAELTALPFPDATVRGILCWYAIIHSDADDVAAICREARRVLRPGG
FT                   VILLGFQAGSGNRRIERAYGHDIAMNAVLHEPAAIARTLEAEAFDVTAIAERAARGRER
FT                   HAQGFVLARRR"
FT   CDS_pept        complement(323394..323996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0326"
FT                   /product="fructose-2,6-bisphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0326"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73290"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:E8N9P3"
FT                   /protein_id="BAJ73290.1"
FT                   /translation="MTHYIYLVRHGEHQDAEHGLADGPLSPRGQRQAALIADRLSGLPL
FT                   DAVWHSPLERAAQTANAVAERLPSVSPEPSALLFDCVPTGMTPETPAAYEPFFGSVTEA
FT                   EIDAGRAQMADATAEFLARKTGEVHELLITHNFVISWFVREVLQAPDWRWMTINQAYCG
FT                   LTVIAQKKGRPWTLLSHNDLAHLPVELRTGLVDPLPV"
FT   regulatory      complement(324006..324011)
FT                   /locus_tag="MTES_0326"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(324078..325103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0327"
FT                   /product="predicted oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0327"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73291"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:E8NA57"
FT                   /protein_id="BAJ73291.1"
FT                   /translation="MSGSGVENVPSARLRRDRPPHPSAPVTLQGPGLGSHVRVPLGETG
FT                   FDVFPLFLGGGEFGWNVDAKSSHDILDAYAELGGNALHTADSYAAGRSEFIIGEWMRTR
FT                   RVRDDVVLTVRVGRHPDNPGLDSVNLVRAVEASLQRLGTDRIDVLSLDAARGDAAILED
FT                   TLATSEWLVESGKVRAIGAHGYTAAQLVEARILSSAGYPRITVLDVPYNVLRRDEFDGD
FT                   LRLIAAAQGIAVTPSHPLAHGFLAGETRTRDQQSRSVRGSQLAMHLNRRGSKVLRALDA
FT                   VGTELGIPDAAVAVAWLLAQKIVAAPIVNAFAPRHVVECMRAVGVRLSRAQLSDIARAA
FT                   E"
FT   regulatory      complement(325116..325121)
FT                   /locus_tag="MTES_0327"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(325309..327606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pnp"
FT                   /locus_tag="MTES_0328"
FT                   /product="polyribonucleotide nucleotidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0328"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73292"
FT                   /db_xref="GOA:E8NA58"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR012162"
FT                   /db_xref="InterPro:IPR014069"
FT                   /db_xref="InterPro:IPR015848"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="InterPro:IPR036456"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/TrEMBL:E8NA58"
FT                   /protein_id="BAJ73292.1"
FT                   /translation="MEGPEITAAEAVLDNGRFGTRTIRFETGRLAQQAQGAVAAYLDEE
FT                   TMLLSATSAGKHPREGFDFFPLTVDVEERSYAAGKIPGSFFRREGRPSTEAILVCRLID
FT                   RPLRPSFVDGLRNEVQIVVTVLSIAPGEFYDALAINAASMSTQISGLPFSGPIAGVRLA
FT                   LIPGHGEHADQWVAFPKAEQLEDAVFDLIVAGRVLDDGDVAIMMVEAEATEGSWNLIKG
FT                   GATKPNEQVVAEGLEAAKPFLRQLVDAQNEVARTASKEIQSFPVFPAYSQETYDFVAGR
FT                   AYDRLVPVYQIADKQERQNADDEVKTSVKEQLLAAVESGELPAVATLEFNAAYKSVTKT
FT                   IVRGRILAEGVRMDGRGLADIRPLDAEVQVIPRVHGSAIFQRGETQILGVTTLNMLKME
FT                   QQIDSLSPITSKRYLHHYNFPPYSTGETGRVGSPKRREIGHGFLAERALVPVLPSREEF
FT                   PYAIRQVSEALGSNGSTSMGSVCASTLSLLNAGVPLRAPVAGIAMGLVTDEVDGQTRYA
FT                   ALTDILGAEDALGDMDFKVAGTAEFITAIQLDTKLDGIPSSVLAAALTQAKEARLTILN
FT                   VLNAAIDAPDEMAPTAPRVISVQIPVDKIGELIGPKGKTINSIQDETGAQISIEDDGTV
FT                   YIGATDGPSAEAARAQVNAIANPTNPEVGEQFLGTVVKIATFGAFVSLLPGKDGLLHVS
FT                   EVRKLAGGKRVENVEDVLSVGRKILVRITKIDDRGKLSLEPVLDEDAATPEAADTQSSA
FT                   AASEGPEAPAEG"
FT   regulatory      complement(327614..327619)
FT                   /gene="pnp"
FT                   /locus_tag="MTES_0328"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      327843..327848
FT                   /locus_tag="MTES_0329"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        327861..329198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0329"
FT                   /product="Na+/alanine symporter"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0329"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73293"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:E8NA59"
FT                   /protein_id="BAJ73293.1"
FT                   /translation="MMIRVVPTRRDEYSGLMGLIRRTSHTLLACALIGAAVAPAPAWAS
FT                   TSSSVVLTAAADENDPAVIEVKKELDAAEASAAAASRRALDASAEAERTRVLAESTAAR
FT                   AEALSAQSSAADAALASAHARAGASAARLYRTTGNGPLVAQLLTSADPDSLLERLGILD
FT                   RVATLTTRDAGEARSAADVATSLRAQADAARTEAARLATESAATAATAQTEADTESQAV
FT                   QSAQAQLDALFARLAALRETTAQQEREARLREQTQREAQEPGGNGGGSNNNSGGGGNGN
FT                   GGGGNTNNGGSNDNGGSGNNGGGNNGGGSDNGGGGNNGGGNNGGGNNGGGTTPPPTAPA
FT                   GPIMSPGEARDYARGAIRGYGWGDDQFSCLVSLWNRESGWRADALNPWSGAYGIPQALP
FT                   GEKMASAGPDWRTNAATQIAWGLSYISSRYGAPCGAWGHSEQTGWY"
FT   CDS_pept        complement(329340..331370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0330"
FT                   /product="glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0330"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73294"
FT                   /db_xref="GOA:E8NA60"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:E8NA60"
FT                   /protein_id="BAJ73294.1"
FT                   /translation="MNIANVGTCEPPRRADAPHPGLVRVALLAESFLPHMNGVTGSVLH
FT                   VLRHLAEAGHETLVIAPKSGDVTADLHGARTELLRSVPLPSYPEVRVVFARAARLGALL
FT                   RDFDPDVVHLASPFVLGWQGLAAADALRIPTVAVYQTDVVAYAQKYGLPHATALVEGHV
FT                   ARLHRRATLTLAPSSASMRQLESLGVDRLRRWGRGVDAVRFAPAHRDDAWRAEVAPNGE
FT                   RIIGYVGRLAPEKQVDDLRALAGVPNTRLVIVGDGPSRAGLQTAIPDAVFTGHLSGDTL
FT                   ARAMAGFDVFVHPGESETFGQTIQEALASGVPVVATGVGGPLDLVRSSVDGWLYRPGDL
FT                   DDLRARVSDLVGDESKRQAFSRAARDAVAGRTWSALTDDLVGHYREARALRAIDDSLLV
FT                   RGARRPAAPVASRARGRWTRFVALGDSLTEGLCDQSRMPSGAYRGWADRLAELLAGTSE
FT                   DGPFRYANLAVRSRRVRHLIDEQVPAALEMKPDLVSILIGANDLVGPHPVIPAIVAEVE
FT                   SAVRAVRRTGADVLLVTTFLPHRAAARLFARRFSAYNVELRRIAAEQGAILLDLEAVAE
FT                   LGELPLWADDLVHLRSAGHRLVAYRAAEALGVPDAAALLGLDEALHADDEPARGGWITR
FT                   DALPWVWRRVRGRTAGDGVSAKHSAYVELPTRGDRERARTS"
FT   regulatory      complement(331378..331383)
FT                   /locus_tag="MTES_0330"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      331426..331431
FT                   /locus_tag="MTES_0331"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        331438..332067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0331"
FT                   /product="uncharacterized membrane-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0331"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73295"
FT                   /db_xref="GOA:E8NA61"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/TrEMBL:E8NA61"
FT                   /protein_id="BAJ73295.1"
FT                   /translation="MDGIDAWLQTIAASPWALLGMAVLVFADAFLVVIPGEAAVTAFGA
FT                   LAVSHGTPPLAGVIVVAGAAAFAGDAGCYLVGRTVGVERWAWMRGPRVRAALDWARARL
FT                   ERNAAVVLFTARFVPFARLAVNLAAGAARVNPVRYLGVAALAALAWAAYQAVIGAVVAA
FT                   VVPGGPVVAVIVSIVVAVGIGVGIDFVLARRAKRRAKRRADLHGGR"
FT   CDS_pept        complement(332259..333020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0332"
FT                   /product="fructosamine-3-kinase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0332"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73296"
FT                   /db_xref="GOA:E8NA62"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR016477"
FT                   /db_xref="UniProtKB/TrEMBL:E8NA62"
FT                   /protein_id="BAJ73296.1"
FT                   /translation="MDAHVKTRADAPAGFFAAEAAGLRWLAAAEGARIARVIDVADDRI
FT                   AIERVAGARPAERAADAFGAALAATHSAGAAAFGSPPPGWEGDIFIGRRSQPARPTATW
FT                   GAFYARQRVEPFVPLAVEAGNLSASGAEIVRRVCGLIAEGAFDDEEPPARLHGDLWTGN
FT                   VLWSPEGVVLIDPAAHGGHRETDLAMLALFGCPFLERILAAYDRSRPLRAGWRERVPLH
FT                   QLHPLAVHAAGPGPSYGRALVEAAEQTLALV"
FT   CDS_pept        332920..333849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0333"
FT                   /product="DNA/RNA endonuclease G, NUC1"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0333"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73297"
FT                   /db_xref="GOA:E8NA63"
FT                   /db_xref="InterPro:IPR001604"
FT                   /db_xref="InterPro:IPR020821"
FT                   /db_xref="InterPro:IPR040255"
FT                   /db_xref="UniProtKB/TrEMBL:E8NA63"
FT                   /protein_id="BAJ73297.1"
FT                   /translation="MRAPSAAASHRSPAASAAKKPAGASARVFTCASIAPVCRDVGGPG
FT                   HDGGMSDGYDPDFLGIPLPLPAPAVSATRLDYPRFSVLLDEQRRFAAVTGVVIDGAGLR
FT                   EQPRTGEWRLDPRVAADAQAGPEIYSRNDLDRGHLVRRRDPGWGSPEEARDATEATFFY
FT                   TNAAPQAAGFNQSKELWLGLEDHVLAYAETTDQRLAVFTAPVLGDEDPPYRGIRVPLRF
FT                   WKIAAWRDGDALAAAGFLLDQTELVDTRQGLTVPPLGAFRTFQVPVADIAAEAGIDVGP
FT                   LAAADTFVRRGIRPVAARELQSLDDIVL"
FT   regulatory      complement(333024..333029)
FT                   /locus_tag="MTES_0332"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(334289..334891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0334"
FT                   /product="SAM-dependent methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0334"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73298"
FT                   /db_xref="GOA:E8NA64"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E8NA64"
FT                   /protein_id="BAJ73298.1"
FT                   /translation="MDAAQWDERYRASAGGVWAAEPPAAVREILARLTPGTAIDVATGD
FT                   GRTAVWLADRGWVCTGIDFSVEGLALAAARAGGDAVTWAHADVHEWEPVASVDLVVSCY
FT                   LHLADSAVAVARMAEWVKPGGALVVIGHDLENIAASGHGPADPAILYTPELLRGALDER
FT                   FRIERCERLTRTSADAELRGGHAAAAIDTLLHAVRVR"
FT   regulatory      complement(334896..334901)
FT                   /locus_tag="MTES_0334"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(335095..335739)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0335"
FT                   /product="predicted flavoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0335"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73299"
FT                   /db_xref="GOA:E8NA65"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR023932"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:E8NA65"
FT                   /protein_id="BAJ73299.1"
FT                   /translation="MTARRIAVVTAGLSTPSSTRMLGDRLAHAALAELRERGIEATADV
FT                   FELRDYAHDLTDNLLTGFAPAPLEQMINTVVSADGLIAVTPIFSTSYSGLFKSFIDVLD
FT                   PQALTGTPVLIGANAGTARHSLAIDYAIRPLFTYLHANPVPTGVFAASSDWGSNADEVA
FT                   PLGSRVDRGARELADAIAAREPVRDADPFDPSSYLGEGRSFGHLLGGLSGE"
FT   CDS_pept        complement(335741..337048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0336"
FT                   /product="coenzyme F420-dependent N5,N10-methylene
FT                   tetrahydromethanopterin reductase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0336"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73300"
FT                   /db_xref="GOA:E8NA66"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR023934"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:E8NA66"
FT                   /protein_id="BAJ73300.1"
FT                   /translation="MGYDGIKIGVLRSDMYIQMHTNRRRIMSETSNWPGMQFGVMTVSD
FT                   ITQDPTTGKTPSEAQRIKDTLTIAKHTEEVGLDVFALGEHHNPPFWSSSPTTTLAYIAA
FT                   QTERLILTTSTTLITTNDPVKIAEDFAMLQHVSGGRADLMLGRGNTGPVYPWFGKDIRQ
FT                   GLPLTIENYDLLHKLWREDVVDWEGTFRTPLQGFTSTPRPLDGVPPFVWHGSIRTPEIA
FT                   EQAAYYGNGFFANNIFWPKEHYQRLITLYRERFAHYGHGTPQQAIVGLGGQVFMRANSQ
FT                   DAVREFRPYFDNAPVYGHGPSLEDFSEMTPLTVGSPQQVIDRYAAMRETFGDYQRQLFL
FT                   IDHAGLPTKTVLEQLDILGSEVVPVLRKELQKDRPAEVPDAPTHANQVEKIYAGAAPRQ
FT                   AVPGANRGDNMVSGSPYQDAAKPGSAFGAAAAKVGA"
FT   regulatory      complement(335751..335756)
FT                   /locus_tag="MTES_0335"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(337052..337057)
FT                   /locus_tag="MTES_0336"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      337111..337116
FT                   /locus_tag="MTES_0337"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        337120..338181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0337"
FT                   /product="fucose 4-O-acetylase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0337"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73301"
FT                   /db_xref="GOA:E8NA67"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:E8NA67"
FT                   /protein_id="BAJ73301.1"
FT                   /translation="MTSPPTTTRTPFWDNARFAAIILVVFGHAIQRLTYDSDAAEALYL
FT                   LVYAFHMPLFALVAGYFSSSAEPTRRRMARLFTDLVAPYVIFETLWTITQFLVTGRTNL
FT                   DPAQPSWTLWFLLALALFRLVLPYLALLRAPVVWALVISVVAGYLPSIDSTFSLSRFLG
FT                   LLPFFTLGWWLREHDVVARAGLLAARPLWLRASAASVLIGAGVLAFVFVETWRDVRLGT
FT                   WFFFVDAYADLDAPQWWAGGVRLAIIALALALMAAFLLLIPRRGTSWTHLGQYTMYVYL
FT                   LHTFVLYPFRQSGVLRGLEPMWLWIPVVAVASVAIAVALSSRPIRRLTRPLVEPRMPWL
FT                   FRDRELGAGRGAR"
FT   CDS_pept        complement(338438..339772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0338"
FT                   /product="predicted iron-dependent peroxidase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0338"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73302"
FT                   /db_xref="GOA:E8NA68"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006313"
FT                   /db_xref="InterPro:IPR006314"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:E8NA68"
FT                   /protein_id="BAJ73302.1"
FT                   /translation="MSDEEQTPAAAGPSGSAAAARPDAAEAAAGVSRRDLIGLAIGASA
FT                   TSLVVGAGAGLVGGAAYGQDQARRVMDAAAPASGIHQPGITTPVQEHLHFAAYDMMART
FT                   TRDDLAELLSDWTYAATRMMQGLDVSATGALGGSPDAPPDDTGEAVGLPASNLTITFGF
FT                   GPSLFDARFGLEGQRPPGLERLPAFLNDDLDPLRSDGDLCIQACADDPQVAVHAIRNLS
FT                   RIAFGRATIRWSQLGFGRTSKTTAAQTTPRNLFGFKDGTANILADDTAALEENVWVSAS
FT                   EGPAWLAGGSYLVARRIAMLIETWDRTRLAEQDRVIGRDKGAGAPLSGGDEFTAPDFGA
FT                   TDAGGKPRIDPRSHVSRAHPDNNGGIRILRRGYNFVDGTTDLGRLNAGLFFLSFQKSPD
FT                   RFITLQKALSTDAMGEYIRHVGSGLWAVPPAPASGTSVGAGLLGS"
FT   CDS_pept        complement(339775..341004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0339"
FT                   /product="predicted periplasmic lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0339"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73303"
FT                   /db_xref="InterPro:IPR018976"
FT                   /db_xref="InterPro:IPR028096"
FT                   /db_xref="InterPro:IPR034981"
FT                   /db_xref="InterPro:IPR038352"
FT                   /db_xref="UniProtKB/TrEMBL:E8NA69"
FT                   /protein_id="BAJ73303.1"
FT                   /translation="MTPTRLLAATAVAGAAALVLAGCVAKTDASASGALTVTSTDDGCA
FT                   VSSASVPSGTVAFDVSNKSDQVTEFYLLASDGLRIVGEVENIAPGASRNLTVVAQPGDY
FT                   FTLCKPGMVGDGVGKASFSVTGDAVAVEGPDAEQKQQAVDLYAAFVKDQVGQLLPAVKT
FT                   FTAAYESGDDAAAKEQFPRVRAYYERIEPIAEALGDLDPRIDYREVDAVAEGLDWTGFH
FT                   RIEKDLWVPAQDALNADGETPAWKDWTPSTPEERKTHGDKLVSDVQELYDYVHGDEFTQ
FT                   ALDTQGVAGISNGAIALLDEVASGKISGEEDWWSGTDLYDFAANVEGSKMAFSLVRDFA
FT                   ESKGDKGAELVTRIDKGYADLEAALAAHGSADAGFVPYSQLTEADKRQFTDLINALAEP
FT                   LSQLTVTVLE"
FT   regulatory      complement(339777..339782)
FT                   /locus_tag="MTES_0338"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(341001..342011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0340"
FT                   /product="high-affinity Fe2+/Pb2+ permease"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0340"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73304"
FT                   /db_xref="GOA:E8NA70"
FT                   /db_xref="InterPro:IPR004923"
FT                   /db_xref="UniProtKB/TrEMBL:E8NA70"
FT                   /protein_id="BAJ73304.1"
FT                   /translation="MLASFFATFLIGLREGLEAALVVGILVAYLTRLGRRDALPRLWIG
FT                   VGLAVVLALTVGAIFTFGAYMLTFEAQELLGGGMSLLAVAMVTWMIFWMQRAGRTLKAG
FT                   LEGGIDKALQGGVWALVAIGFVSVAREGVETTLLLWSMVQGFGDSPVALLGALLGLVTA
FT                   VVLGWLIARGMLRLNLGRFFTWTGGFLVVVAAGVLAYAFHDLQEAGALPGPFGAGATLD
FT                   PVTGGVATGWAGFPFGWAFDVSDTIAPGGPLAALLQATVGFMPAMTWLQVVAWTVYIAV
FT                   VVPLFVRGVRANRRPKAPAPTPAADDPAANAAPDSPDAARVPDAAASVTHPNGAS"
FT   regulatory      complement(341010..341015)
FT                   /locus_tag="MTES_0339"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(342025..342030)
FT                   /locus_tag="MTES_0340"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      342248..342253
FT                   /locus_tag="MTES_0341"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        342264..343280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0341"
FT                   /product="isopenicillin N synthase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0341"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73305"
FT                   /db_xref="GOA:E8NA71"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR026992"
FT                   /db_xref="InterPro:IPR027443"
FT                   /db_xref="UniProtKB/TrEMBL:E8NA71"
FT                   /protein_id="BAJ73305.1"
FT                   /translation="MSDLNLPVLDLSLLDQGPDAAARFRDELRAATHDVGFFYLTGTGV
FT                   SPELEANLLRAAKDFFALPEADKLAIENVTSPHFRGYTRVGGERTQGRVDWREQIDIGP
FT                   ERAAIDDPDGPGYNRLVGPNLWPAAQPELKEVVTEWHDHLTGVARKLLRAWALALGAEE
FT                   QYFDRHFGDPQTLIKIVRYPGKDDPTPQQGVGAHKDSGVLTLLWVEPGKGGLQVERDGE
FT                   WVDAPPVPGAFVVNIGELLEYATQGYLTATNHRVISPKYPDERISVPFFFNPALDARLP
FT                   IIELPEELASEVRGVTDDPTNPIHATYGENALKSRLRAHPDVAERWHADLLAARAAS"
FT   CDS_pept        complement(343514..343783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsO"
FT                   /locus_tag="MTES_0342"
FT                   /product="ribosomal protein S15P/S13E"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0342"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73306"
FT                   /db_xref="GOA:E8NA72"
FT                   /db_xref="InterPro:IPR000589"
FT                   /db_xref="InterPro:IPR005290"
FT                   /db_xref="InterPro:IPR009068"
FT                   /db_xref="UniProtKB/TrEMBL:E8NA72"
FT                   /protein_id="BAJ73306.1"
FT                   /translation="MALEADVKKAIIEEYATHPGDTGSPEVQVAMMTQRIKDLTEHLKI
FT                   HKHDHHSRRGLFLLVGQRRRLLGYLQDVDINRYRSLIERLGLRR"
FT   regulatory      complement(343797..343802)
FT                   /gene="rpsO"
FT                   /locus_tag="MTES_0342"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      343957..343962
FT                   /locus_tag="MTES_0343"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        343973..344194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0343"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0343"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73307"
FT                   /db_xref="InterPro:IPR003746"
FT                   /db_xref="InterPro:IPR036591"
FT                   /db_xref="UniProtKB/TrEMBL:E8NA73"
FT                   /protein_id="BAJ73307.1"
FT                   /translation="MQLTVRVKPGSRRGPLVEDTAEGLVVHVRERAVDGAANSGVVKAL
FT                   AAHFGVPARDVEILRGHAARVKRVEVDA"
FT   regulatory      344180..344185
FT                   /locus_tag="MTES_0344"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        344191..345495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0344"
FT                   /product="permease of the major facilitator superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0344"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73308"
FT                   /db_xref="GOA:E8NA74"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E8NA74"
FT                   /protein_id="BAJ73308.1"
FT                   /translation="MSARKSAFIDLRPLTTSPAFARLWIGSTLAGLGGQLTVVAVMLHV
FT                   FELTQSTFAVSMIAVAGLLPMVLAGLYGGMLADAFDRRTVALLAAVVTFVSTALLAALA
FT                   WTGLETVGWLFVLSVVNSAANSIVMATKSAITPRLIPRELLPAAAALQGVTVGIMVMAG
FT                   PALAGVLVAVAGYAWTYSLDVLLMTSLFLGLWSLPRLRPEGEVVRPGLESLRDGARFLR
FT                   RAPNIRLQYLLDITAMTFGQPVTLFPAIGAVLLGGGAITTGVLTAAVAAGAFLSSLFSG
FT                   PIGRVRRQGLGIERAIQVYGLSIGLFGLVLVAASLGWLRPDLVDETHAAVALIVLAAVT
FT                   LAISGAADNVSAIYRSTMMQAAVPDAMRGRLQGIFIVVVAGGPRIGALYAGTLATLTAL
FT                   WVPPLFGGILILAIVGTLVRFSPRFRAYDALDPQP"
FT   regulatory      345562..345567
FT                   /locus_tag="MTES_0345"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        345575..347887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0345"
FT                   /product="anaerobic dehydrogenase, typically
FT                   selenocysteine-containing"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0345"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73309"
FT                   /db_xref="GOA:E8NA75"
FT                   /db_xref="InterPro:IPR006655"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR041460"
FT                   /db_xref="UniProtKB/TrEMBL:E8NA75"
FT                   /protein_id="BAJ73309.1"
FT                   /translation="MTRTTQSSAHWGTFQVDVSDDGRTVLGTRPYADDPDASPAIAGVA
FT                   EAQHHPLRVTRPAVRRRWLENGPGPDDRRGAPDEEYVEVEWDEALDLLAAELDRVRTAH
FT                   GNRAIFGGSYGWGSAGRLHHAQGQLHRFLNAIGGYTSSINDYSRGASLVLLPHLIGRNG
FT                   MEELRKRPPSWPHIAAHTDLLLCFGGVRLSNTSVIPGGHNRQVVGGLSREAAQSTRIVS
FT                   VSAQRDDIAADLDAEWVGIRPGTDTALLLALTHTLVEEGLADDAFLSACTVGADQVRAY
FT                   LRGEPDGVAKTAEWAAGITGIAARSIRDLARRAAAGRTLVNVTYSLQRAEHGEQAVFAA
FT                   LTFAAFLGQIGLPGGGFSHGYGSMGDHGIGVEQVRLPTFPQGRNAVDDFIPCARISDLL
FT                   LRPDETIPYDGRTLPLPDIRLVYWAGGNPFHHHQDIRRLRRGFARIDTLVVHEFHWTPT
FT                   ARHADIVLPAATPLERDDIAAGPGDSRLRAMPRAVAPVGEAREEFWIYDRLAERLGADY
FT                   SEGLDSRAWLERIYEQWRGQNPEAPSFAEFWREGGTALPQRPYRDGAFAAFRADPGSHP
FT                   LDTPSGLIELFSSTLHGFALPDTAGHALWIEPEADPGSPYDLQLLCNQPSHRLHSQLDM
FT                   AAPSRSTKVAGREPIRLNRTDAAARGIRDGDVAIVRSAQGSLLAGVIVTDALLPGVAQM
FT                   HTGSWFDPSAPHIADCINGNVNVLTKDVGTSTLTQASSGARVAVSVAHYDGPIPPVRAH
FT                   EPPPLTARRDRGGDARG"
FT   regulatory      347954..347959
FT                   /locus_tag="MTES_0346"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        347967..348884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0346"
FT                   /product="permease of the drug/metabolite transporter (DMT)
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0346"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73310"
FT                   /db_xref="GOA:E8NA76"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:E8NA76"
FT                   /protein_id="BAJ73310.1"
FT                   /translation="MASASSPSPVSIAVQFVLTGIVWGSSFLFIAVALTGMTPAQVAGG
FT                   RLLFGALALAAIVAIRREHLPRSVRVWGHLCVLSATFCIVPFLLFAWAEQHVSSGLASI
FT                   FNATTPIMTAIMAWAVFRVESLKLGQLVGIAIGIVGVVVIIAPGAIADVGGSTIAQLAL
FT                   LGATACYGFSLAYMRRFLGDTGLSGIAFAFGYIGPAAAFMVLLSPLILAEPMHLTLPVV
FT                   GSIIALGVLGTGIAYVWNQNTLRAWGPTRASTVTYITPVVGVALGILILGERISWNEPV
FT                   GAAVVFLGILLVQQRLRLPRPARV"
FT   CDS_pept        complement(348952..349512)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0347"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0347"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73311"
FT                   /db_xref="InterPro:IPR007372"
FT                   /db_xref="InterPro:IPR036761"
FT                   /db_xref="UniProtKB/TrEMBL:E8NA77"
FT                   /protein_id="BAJ73311.1"
FT                   /translation="MTDTTTLEIPGYKAGTWVLDPSHSEVTFTVRHMMISKVRGTFGMK
FT                   SATLVAPENPLEATVEASVDVTSVDTKDEGRDQHLRSAEFFDVETYPTMDFRSTGVRVE
FT                   DGDYLVDGELTIRGVSKPATFSIDFGGFGTDPWGNYKVGATAKTVINREDFGLTWNAAL
FT                   ETGGVLVGKDVTIELDLQFAHQA"
FT   regulatory      complement(349517..349522)
FT                   /locus_tag="MTES_0347"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(349654..350019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0348"
FT                   /product="FKBP-type peptidyl-prolyl cis-trans isomerase 1"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0348"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73312"
FT                   /db_xref="GOA:E8NA78"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR023566"
FT                   /db_xref="UniProtKB/TrEMBL:E8NA78"
FT                   /protein_id="BAJ73312.1"
FT                   /translation="MTDRTKPEFDAPSGPAPSDLVIRDIIVGDGDEAKPGDTVTVHYAG
FT                   VEYESGEEFDSSWGRGESIQFPLRGLIQGWQDGIPGMKVGGRRELVIPPHLAYGPAGGH
FT                   FLGGKTLIFIIDLLKVG"
FT   regulatory      complement(350026..350031)
FT                   /locus_tag="MTES_0348"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(350192..351352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0349"
FT                   /product="predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0349"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73313"
FT                   /db_xref="GOA:E8NA79"
FT                   /db_xref="InterPro:IPR026898"
FT                   /db_xref="UniProtKB/TrEMBL:E8NA79"
FT                   /protein_id="BAJ73313.1"
FT                   /translation="MSYPSPLSQPSPGQPARISTTPPVAVSAAPPRVRGGGVALWIVAA
FT                   LLVPVLALLVLYFTRFLGPAASFIGLVLAVIPFVVVWFVVRYIDRWEPEPRRLLIFAAA
FT                   WGAVAAVAIALGVDLLVTLVTGGLPDAVSSVVQAPIVEEVAKGLGILLLYAFARRFFDG
FT                   PVDGIVYGALIGAGFALTENVQYFAIGYLEGGPGEVATTFFLRAVLSPFAHVMFTSITG
FT                   FAFGLAARRSLRTGAALGYAVPGLIGAIVLHAVWNGSATFFNFFEVYATLQVPLFVAFI
FT                   VGILFLRREESRLTRARLGEYADAGWFTPQEVDMLATAPGRRSALAWSRTLRGDRSSIM
FT                   KSFIRDATALAAARQRALSGRDPYAVATERQLLERTTAARAALLAP"
FT   regulatory      complement(351358..351363)
FT                   /locus_tag="MTES_0349"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      351421..351426
FT                   /locus_tag="MTES_0350"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        351435..352301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0350"
FT                   /product="2-keto-4-pentenoate
FT                   hydratase/2-oxohepta-3-ene-1,7-dioic acid hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0350"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73314"
FT                   /db_xref="GOA:E8NA80"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:E8NA80"
FT                   /protein_id="BAJ73314.1"
FT                   /translation="MRFAHVRSPEGAESPRLVSVHAEEFSFVDEFFAGAPRTLEQLIAG
FT                   GDALLDQVRDAATSAPRHPLAGVVFASAVLAPPSILAVGLNYAAHSGELGLKTDAGPTV
FT                   FVLWPNSLTAHESTTSWPRALSEAVDYEAELGVIIGRPGRDVPEAEALNHVWGYTVVND
FT                   ITARNIQFSEAQWSRCKSFDGFTPTGPFVVTADEIPDPQDLHIWTVVDGHTVQDASTGQ
FT                   MVRSVATLIHKLSESATLLPGTLISTGSPGGAGYSRDPQIFLRDRSTVTVGIDGIGELT
FT                   THCRILD"
FT   CDS_pept        complement(352358..353821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aspA"
FT                   /locus_tag="MTES_0351"
FT                   /product="aspartate ammonia-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0351"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73315"
FT                   /db_xref="GOA:E8NA81"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR018951"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:E8NA81"
FT                   /protein_id="BAJ73315.1"
FT                   /translation="MTLDATTRTRTETDSLGTLEIPADAYWGIHTARALENFPIAKRPI
FT                   SVYPDLVRALAMVKQASARANREIGVLDPAKADLIDRAAQRVIDGEFHDEFAVGVIQGG
FT                   AGTSTNMNANEVITNIALEMAGREKGDYAFLSPIDDTNRSQSTNDVYPTAIKIGLALTL
FT                   KSLLEELALLRQSFLAKADEFHDVLKVGRTQLQDAVPMTLGQEFHGFATTLGEDYSRLT
FT                   ENAYLLYEINMGATAIGTGITAHAGYGKAVLRHLREITALDLETATDLVESTSDTGAFM
FT                   SFSSSLKRNAIKLSKICNDLRLLSSGPQAGLGEINLPPRQAGSSIMPGKVNPVIPEVVN
FT                   QVAFSVVGADMTVTMAVEGGQLQLNAFEPVIAHSIYQSITWMRQAMWTLRVNCVDGITA
FT                   NRERLGAMVGSSVGVVTALTPFIGYAAAAALAKTALLTHRNVADLVVEAGLMSRDEVTK
FT                   QLSPARLSGLHPITQAIPVQRAADSVVEE"
FT   regulatory      complement(353827..353832)
FT                   /gene="aspA"
FT                   /locus_tag="MTES_0351"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(353966..354865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0352"
FT                   /product="predicted phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0352"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73316"
FT                   /db_xref="GOA:E8NA82"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR026575"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:E8NA82"
FT                   /protein_id="BAJ73316.1"
FT                   /translation="MASVQFGQHAPARRVILHLSDTHLLGGDRLLGERYDTAANLRRTL
FT                   DAAESTGIRPDAIVFTGDLTDLGEPEAYRALREAVEPWAERLGAPVVWVAGNHDERPAL
FT                   HAELLDVEASLEPVTGVWDLDGLRIIALDSTVPGWHHGDLDAAQLQWLRDELATPAPLG
FT                   TILALHHPPLPTHIPFFDILELRDQPGLAAAIAGSDVRAILAGHLHYSTSGTFAGVPVS
FT                   VAAASCYTMDLARPADEVNGMDAGQSFHLVHVWDDTITHAVVPVVDADTSGYFTPAWVE
FT                   EMAALTPEGRLEAFSRKR"
FT   regulatory      complement(354871..354876)
FT                   /locus_tag="MTES_0352"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(354914..355243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0353"
FT                   /product="membrane protease subunits, stomatin/prohibitin
FT                   homologs"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0353"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73317"
FT                   /db_xref="GOA:E8NA83"
FT                   /db_xref="UniProtKB/TrEMBL:E8NA83"
FT                   /protein_id="BAJ73317.1"
FT                   /translation="MTIDWEAFLHVFIAAIIGAAIVVTFYALGLRLLVRGGRPPLVAPA
FT                   EFTDAITVLTDKQRRRAEKAAAKAAARNPLSDGQKRLALVGAYVCFGVCAAAVLGALLL
FT                   ILFNH"
FT   CDS_pept        complement(355240..356454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0354"
FT                   /product="phosphate/sulphate permease"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0354"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73318"
FT                   /db_xref="GOA:E8NA84"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniProtKB/TrEMBL:E8NA84"
FT                   /protein_id="BAJ73318.1"
FT                   /translation="MESAALVIVLVIGLALFFDFTNGFHDTANAMATPIATGALKPKVA
FT                   VLLAACLNLVGAFLSTEVAKTISGGMIREDQLSPDIFPPIIFAGLIGAITWNMLTWLLG
FT                   LPSSSSHALFGGLIGATLVGVGVSAIDTGVVLSKVILPALIAPLTAGIIAFTVTKIAYG
FT                   ITRRYDTKADGRDGFRWGQIFTSSLVALAHGTNDAQKTMGVITLALITVGWQSASDPDP
FT                   HIWVVLACAITIALGTYMGGWRIIRTLGKGLTDVKPAQGFSAETSTAATILASSALGFA
FT                   LSTTQVASGSVIGSGLGRRGSTVRWNTVGRIMIGWVLTLPAAGAVGAAAALIVVWLGGW
FT                   GVAVDAVIAVVIILGLFLRSRRDSVTSANAMSEVADSGAAVKVPRKPGPTRRQRRLERS
FT                   GKDDA"
FT   regulatory      complement(355249..355254)
FT                   /locus_tag="MTES_0353"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(356463..356468)
FT                   /locus_tag="MTES_0354"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      356664..356669
FT                   /locus_tag="MTES_0355"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        356678..358792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0355"
FT                   /product="protease II"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0355"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73319"
FT                   /db_xref="GOA:E8NA85"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR002470"
FT                   /db_xref="InterPro:IPR002471"
FT                   /db_xref="InterPro:IPR023302"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E8NA85"
FT                   /protein_id="BAJ73319.1"
FT                   /translation="MTDIDVSSVPPVAARRPVARSHHGDTFDDPYEWLRAKDDAEVVAH
FT                   LEAENAYTDARTAHLASLRDEIFGEIKGRTLETDLSVPVRRGEWWYYGRTVAGAQYGIQ
FT                   CRAPLSSPDDWTPPALSPDEPVPGEQVLFDGNVEAEGTDFFSLGSFEISNDGTRMLYGI
FT                   DVAGDERYTVRVRDLTTGETLPDEIPGTFSGATFSPDGRFIVYTTVDDAWRPDTVWLHE
FT                   IGTAVDADEKLFHEPDERYWVGADFTRSDRYLVIGVGSSITSEDRLIDADDLRGEARIV
FT                   WPRREGVEYSVDHAVVDGEDVLYILHNDDALDFELVRVSASDPEGSREIVVPHRGGQRL
FT                   LGVDTFRDWGIIAYRRDGLARLAMLSYADGAVDEITFDEPLYSVGTGGNPEWAPPVLRV
FT                   GYGSFVTPGTVYDYVIETGELLLRKRQPVLGDFDPADYGQARVWAPAEDGTQVPVSLVW
FT                   KRSFGEPGSSPRPVHLYGYGSYEHSIEPGFSVPRLSLLDRGVIFAVAHVRGGGEMGRQW
FT                   YEDGKLLAKRNTFTDFVAAGRHLVAEGYTTPDRIVAEGGSAGGLLMGAVANLAPELFAG
FT                   ILADVPFVDALTTILDPSLPLTVIEWDEWGDPLHNADVYAYMKSYSPYENVRSGVEYPR
FT                   ILAVTSLNDTRVLYVEPAKWVQRLREVGADALLKCEMVAGHGGVSGRYNAWRERAFELA
FT                   WLLDVLGVAE"
FT   CDS_pept        complement(359025..359942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0356"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0356"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73320"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:E8NA86"
FT                   /protein_id="BAJ73320.1"
FT                   /translation="MTRRHPLPESLPDRFHVTEALRRGASRTRLRASDLVAPFHGVRSR
FT                   SLGDDDSIFERCRAYAPRLAEGQFFSHETVFVLRGLSTPEWPYTPRLHVSAHRPAREPR
FT                   TQGVVGHRLQTREPATESGPEGMPIENAVRAWRQCGRLWPLDDLVAGADALLAGRQPIA
FT                   CVADLDAEISLMGDVRGGVLRRALALARPGVRSPRETRLRLLLVRHGLPEPDVNIDIFS
FT                   VRGDFIAEVDLAFEKWRVAVEYDGRVHAEDPRQFARDADRWAAIRDAGWDHVRILNHHF
FT                   RGDGAAAVGLARAALLRAGWRPGQ"
FT   regulatory      complement(359952..359957)
FT                   /locus_tag="MTES_0356"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(360358..361386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pfkA"
FT                   /locus_tag="MTES_0357"
FT                   /product="6-phosphofructokinase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0357"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73321"
FT                   /db_xref="GOA:E8NA87"
FT                   /db_xref="InterPro:IPR000023"
FT                   /db_xref="InterPro:IPR012003"
FT                   /db_xref="InterPro:IPR012829"
FT                   /db_xref="InterPro:IPR015912"
FT                   /db_xref="InterPro:IPR022953"
FT                   /db_xref="InterPro:IPR035966"
FT                   /db_xref="UniProtKB/TrEMBL:E8NA87"
FT                   /protein_id="BAJ73321.1"
FT                   /translation="MKIGILTSGGDCPGLNAVIRGVVLKGTTNYDIEFVGIRDGWRGVV
FT                   DGDFFPLTRHEVKGLSKVGGTILGTSRTNPYEGVRGGAENISKTLYGHRIDGILAIGGE
FT                   GTLAAADRLSKDGINVLGVPKTIDNDLRATDYSFGFDTAVNIATDAMDRLRTTGDSHQR
FT                   CMVAEVMGRHVGWIALHAGIAAGAHVICIPEVPMSIDEIVEQVTRAHDRGRAPLVVVSE
FT                   GFKLTGMDEAFSDKGLDAFNRPRLGGIGELLAPEIERLTGIETRSTVLGHIQRGGSPSA
FT                   FDRVLATRLGLHAADALHEGAWGQMVAMRGTDIVRVPFADALGELNSVPLYRYEEAAAL
FT                   FG"
FT   regulatory      complement(361395..361400)
FT                   /gene="pfkA"
FT                   /locus_tag="MTES_0357"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(361540..362595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0358"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0358"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73322"
FT                   /db_xref="UniProtKB/TrEMBL:E8NA88"
FT                   /protein_id="BAJ73322.1"
FT                   /translation="MPLTVDMLLAGPRGRRLCLEVLRLAPDGPAVRDATWAVSWAARAL
FT                   AENPGTILAIGGDSSSFTEPEVSPAEAAAALERVAMPELTDALLFEALSIAVDLAAYWQ
FT                   PPSGEDVLAGTEELRPVLERVAAAVAGTPGIEWWESGVERNAQARVRWENYPASTEAPD
FT                   EISARWRSEQVAEEVDFAQQLDNVRRSGSWWSTPAARLPRSTRVRAAGGPVGLTLVEDS
FT                   LGWTSAHVQPIAAPDGEVIEIDGPEAWAALCRRHPFPLTASRRNVWEWTTGREGMWVQP
FT                   DWAAVAGEAAGVHLSVSGYLATAGRVIELGDLGASTVAGWGPDETFWFTPVEPSAPEEE
FT                   WVCDGPAWRVA"
FT   regulatory      complement(362604..362609)
FT                   /locus_tag="MTES_0358"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(362849..365008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0359"
FT                   /product="superfamily II DNA/RNA helicase, SNF2 family"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0359"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73323"
FT                   /db_xref="GOA:E8NA89"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:E8NA89"
FT                   /protein_id="BAJ73323.1"
FT                   /translation="MPTTATASRGSSQRRRKTTSSRRDDEAPVIPILARKVREVEAKAQ
FT                   RGKLGPTNRVKFQVIAFLVREERARVKADTEITDAARAELLKRLDGVATILAKTAARDT
FT                   SLIQLLEVDQATSPVARRMRRDWLLESGAELPPDELIITDTAPKIAPVVPAALAEKQVI
FT                   PPSIEARQMANPFLAPDLTPRSTGDAPRRRLDGWELMGPLYKAFEIGAGGSAASMELPP
FT                   VPEFDRLSPRGLEVMPHQSRFLEAVRLGHREFLLADEPGLGKTAESVLAASVADAYPLL
FT                   VVVPNVVKMNWAREVQRWTPQRRATVISGGGADIDAFADVFIVNYEILDRHLSWLSSIG
FT                   LKGIVVDEAHFIKNLTSQRSQNVLALASRVRQQTRDPLLLALTGTPLINDVEDFDAIWR
FT                   FLGWTNGEKPGPELMEKLDATGLTPADKAFYPEAREAVISMGIVRRKKKDVAADLPDKL
FT                   VADLPVELDDEYGRSIRQAERELGARLAAKYRRILEARGDRGLAPGEIDDDIVRLVAHG
FT                   ELEESKAAGSGSENVFTMVRRIGQAKAHLAADYAVQLQRSVGKVVFFAKHIDVMDAAEA
FT                   HFKASGLKAVSVRGEQTSTARQAAIDAFNSDPDVGIAVCSLTAAGVGLNMQAASNVVLA
FT                   ELSWTAAEQTQAIDRVHRIGQEEPVTAWRIIAAHTIDTKIAELIDSKEGLAARALDGQA
FT                   IEPGSSDSVQLSALMHLLRQALGAA"
FT   regulatory      364911..364916
FT                   /locus_tag="MTES_0360"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        364920..365108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0360"
FT                   /product="signal peptidase I"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0360"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73324"
FT                   /db_xref="UniProtKB/TrEMBL:E8NA90"
FT                   /protein_id="BAJ73324.1"
FT                   /translation="MTGASSSRREDVVFLRRWLEPRDAVAVVGMLLLSVSSGHLSGTFR
FT                   REAGGSVTPENIARHAA"
FT   regulatory      complement(365012..365017)
FT                   /locus_tag="MTES_0359"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(365378..367834)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0361"
FT                   /product="cation transport ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0361"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73325"
FT                   /db_xref="GOA:E8NA91"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:E8NA91"
FT                   /protein_id="BAJ73325.1"
FT                   /translation="MDGTRDATASGDGVAEAVLDIEGMTCASCVARVEKRLGRVEGVRA
FT                   AVNLATETARVQYPAGLDTTALVEAVRSAGYDATVRTRGVSRDAVSVPPRGETPIEVPA
FT                   PGGPVDALTGDGLEPAARGAHGDSAHGDGAHGDSAHDQRAHDHGGDHAGEDHGGHVHDT
FT                   ADAAGATPLRTRLLVSAALAIPVVALGMVPAWQFPGWQWVSLALTTPVVLWGGWPFHRA
FT                   TLRNARHGAATMDTLITLGTFAAYLWSVWALVFGNAGRIGIRHEVMLFGPVHDASAVVY
FT                   FEVAAAVTVLLLLGRFIEQRSTRRAGAALRALLDLGAREAELADGRRIPVDELTVGDVF
FT                   VVRPGSVVATDGVVVDGHASVDESMLTGESVPVEVAAGSEVTGGTIAAGGRLAVRATGV
FT                   GEETRLARIARLVEDAQLGKSRVQRLADRISGVFVPVVIVLAALTLVAWIVAGQPLAAG
FT                   FTAAVAVLIIACPCALGLATPIAILVGTGRGAQLGVLVTGPEALESAERIDTIVLDKTG
FT                   TLTSGRMSVANVVPVEGEDAADVLARAAAVERGSEHSVAAAIVAAAGEGPTAADLEAIA
FT                   GRGVIGTVDGVRILAGRPAWIVERGAALTPALATAVEQGEERGTVVVVGWADAEGAMRA
FT                   RAVIEIADTVRPESAEAVARLRGMRLEPVLLTGDNPRIARAVAAELGIERVRAGVLPEG
FT                   KVDEIAALRAEGRTVAMVGDGVNDAAALASADLGIAMGGGTDAALHASDIALMRDDPRG
FT                   IVTAVALSRRTMRIIRGNLFWAFAYNVAALPLAALGLLNPMIAGAAMAFSSVFVVLNSL
FT                   RLRRAA"
FT   regulatory      complement(367839..367844)
FT                   /locus_tag="MTES_0361"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      367960..367965
FT                   /locus_tag="MTES_0362"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        367972..369309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0362"
FT                   /product="permease of the major facilitator superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0362"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73326"
FT                   /db_xref="GOA:E8NA92"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E8NA92"
FT                   /protein_id="BAJ73326.1"
FT                   /translation="MVLTVAVLASFVSFLDGTVVNVALPAIARDLGGGLSTQQWVVDAY
FT                   LVTLGAFILVAGSLSDVLGRVLVLRIGLIGFALTSVAIAGAPTAEFLIIARALQGVAGA
FT                   LLVPSSLALITSTFRGAAQARAIGIWTGATTIAMLAGPLVGGLFVDTLSWRLVFLVNVL
FT                   PIGVTMWLLVRLGHADHRRPGARVDILGAVLCAAGLGGIVFALIEQPNLGWASPVIWMP
FT                   GVLGILSFAGFLVRQRLARQPMMPLGLFRSRNFWAGNLATVFVYAALSLNGFVVSVYLQ
FT                   QGAGLSATLAGLASLPSTILMILLSSRMGALAGKYGPRLFMTLGPLVMAAGGLLLLGVR
FT                   SDFDYWTQVLPGIVVWGLGLTATVSPLTAAVLGAIESERSGIASAVNNAVSRVAGLLAI
FT                   AAVSAVVGGSLDLEGFHRAAIFAAVLMLLGSTASFLGIRNHLSRRD"
FT   CDS_pept        complement(369430..370374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0363"
FT                   /product="FAD synthase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0363"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73327"
FT                   /db_xref="GOA:E8NA93"
FT                   /db_xref="InterPro:IPR002606"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015864"
FT                   /db_xref="InterPro:IPR015865"
FT                   /db_xref="InterPro:IPR023465"
FT                   /db_xref="InterPro:IPR023468"
FT                   /db_xref="UniProtKB/TrEMBL:E8NA93"
FT                   /protein_id="BAJ73327.1"
FT                   /translation="MIVFRDPAEVPADFGPSVVAIGKFDGVHTGHRAVIDRARVDASDG
FT                   AQVVAVTFDRNPLSVLRPDRCPPDVIGPHQKLDLLDRAGVDATLLLTFDEALAAIPAEE
FT                   FARRVIVDALKARTVLVGRDFRFGAGGTGDPDLLTRMGAAHGFRVDVVDDVRAVHADRR
FT                   VSSTWIREALSAGDVTTAARLLGRAPSVWGEVVHGLKRGRELGYPTANLSPDLEGFVPA
FT                   DGVYAGWLVDVEGGRRISYPAAISVGTNPTFDDVHARQVEAYVLDETDLDLYGHHVEVR
FT                   FVERVRGMTAFDGVDALLIQMADDVERTRAILR"
FT   CDS_pept        complement(370371..370790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0364"
FT                   /product="DNA uptake lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0364"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73328"
FT                   /db_xref="GOA:E8NA94"
FT                   /db_xref="UniProtKB/TrEMBL:E8NA94"
FT                   /protein_id="BAJ73328.1"
FT                   /translation="MASTTPTRTRGMTGIGRVLVVVYGIMALAATGRSFVQIVREFDDA
FT                   PLAYSLSALAAVVYILATLALIFSARPAWYRVAWVAIGFELVGVLVVGTLSLVDPALFQ
FT                   HPTVWSVYGYGYLFIPLVLPFLGLWWLMRHRRAAS"
FT   regulatory      complement(370378..370383)
FT                   /locus_tag="MTES_0363"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(370800..370805)
FT                   /locus_tag="MTES_0364"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(370970..371338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0365"
FT                   /product="glycogen synthase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0365"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73329"
FT                   /db_xref="GOA:E8NA95"
FT                   /db_xref="UniProtKB/TrEMBL:E8NA95"
FT                   /protein_id="BAJ73329.1"
FT                   /translation="MILWFTLAQVGVAVLAGVVAIVAGLIGRRPGDVTVGSLALIELLL
FT                   IVQIVVAIIAPFAGNPPSGSLLEFWTYLVSAALVPVAGAAWALIERSRWSTVIMGVAAL
FT                   AVAVMVWRMHVIWTVQLA"
FT   CDS_pept        complement(371335..372219)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0366"
FT                   /product="pseudouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0366"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73330"
FT                   /db_xref="GOA:E8NA96"
FT                   /db_xref="InterPro:IPR002501"
FT                   /db_xref="InterPro:IPR014780"
FT                   /db_xref="InterPro:IPR015225"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR032819"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="UniProtKB/TrEMBL:E8NA96"
FT                   /protein_id="BAJ73330.1"
FT                   /translation="MVRPGILLVDKPGGITSHDVVSRARRALGTRKIGHAGTLDPMATG
FT                   LLVLGVEGATRLLTYIVGADKTYEATILLGVATDSDDADGVETSRADATDVTDDAIAAG
FT                   IADLTGEIEQVPSTVSAIKVAGRRAYDLARAGEEVELKARRVTVSRFDVLTVRRGDGVI
FT                   ELDVVVDCTSGTYIRALARDLGRALSVGGHLTALRRTRIGSFDVPAAASVDDIAEERLI
FT                   SPATAASVVVGAIAVGEEEARDLRHGKRIDGGGRLTGPVAAAIDPDGRLVGIVEKRGAQ
FT                   LKSVMNMPEEASR"
FT   regulatory      complement(371346..371351)
FT                   /locus_tag="MTES_0365"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(372219..372698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0367"
FT                   /product="predicted GTPase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0367"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73331"
FT                   /db_xref="UniProtKB/TrEMBL:E8NA97"
FT                   /protein_id="BAJ73331.1"
FT                   /translation="MSSPENPVETLQRSLRDLMRQNARAGRVVVAVDGRDGERARAFAD
FT                   GFAAVLAEDGTLVERASVDDAALDVREGIVAPFRAGEGDAVLVVDGRFLHTTERRGLWN
FT                   FSVWLESNPPIGAPRPALPDAEKRYLATARPKATASVIVENSDPAHPVQVFGDFC"
FT   regulatory      complement(372226..372231)
FT                   /locus_tag="MTES_0366"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(372704..372709)
FT                   /locus_tag="MTES_0367"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      372862..372867
FT                   /gene="nth"
FT                   /locus_tag="MTES_0368"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        372873..373739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nth"
FT                   /locus_tag="MTES_0368"
FT                   /product="A/G-specific DNA glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0368"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73332"
FT                   /db_xref="GOA:E8NA98"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR004035"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:E8NA98"
FT                   /protein_id="BAJ73332.1"
FT                   /translation="MPGLAAPLIAWYRDAARDLPWRREGFGAWGTLVSEFMLQQTPVAR
FT                   VIPHLEAWLARWPTPTDLAASPPAEAVTQWANLGYPRRALWLHRAAVEIRDRHDGVVPR
FT                   DVDALLALTGIGDYTARAVAVFAYGDRHPVVDTNTRRVLARAVEGRAQPGPPHRRDLER
FT                   MDAELPDDIAASAIVNAAAMELGAIVCTARSPKCDLCPLAAQCAWRAAGYPESEDLRRR
FT                   QAKYEGSDRQARGAVLKTLREAAPAPVPLFAIVPDWPDARQRDRAIDSLVADGLVEIED
FT                   DLLHLPR"
FT   CDS_pept        complement(373752..374729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0369"
FT                   /product="predicted metal-dependent membrane protease"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0369"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73333"
FT                   /db_xref="GOA:E8NA99"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="InterPro:IPR042150"
FT                   /db_xref="UniProtKB/TrEMBL:E8NA99"
FT                   /protein_id="BAJ73333.1"
FT                   /translation="MHVQNRPDWPALTVFAVTSLALSWLIALPLWLGGRGLADPFFGVV
FT                   AAGMMFTPALATVAALLVQRRTRGRRGARVVLRELGMWPLRPAARTIWTCVAVIFAAPV
FT                   LVALGLFVMSVTGILTLDLVGFSGFAQTLQSAVPAGTPLPPMGVLVVVQLATIPLGALF
FT                   NAPLAFGEELGWRGWLLPALRPLGTWPALLISGAFWGLWHAPLILLGYNFAEPNALGVL
FT                   LMIVGCVLFGILLGWTRLRTASVWPAVFAHGAFNASAGMVALFVAAGAPTPPLTVISPL
FT                   GAVMWGVFAVVIAVLVLLGQFRPARLAAELGPDRRPVGASAPAS"
FT   regulatory      complement(374736..374741)
FT                   /locus_tag="MTES_0369"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(374853..375344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbfA"
FT                   /locus_tag="MTES_0370"
FT                   /product="ribosome-binding factor A"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0370"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73334"
FT                   /db_xref="GOA:E8NAA0"
FT                   /db_xref="InterPro:IPR000238"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR023799"
FT                   /db_xref="UniProtKB/TrEMBL:E8NAA0"
FT                   /protein_id="BAJ73334.1"
FT                   /translation="MAGERQARVADRIRVVLAERLEKGLRDPRLGFVTITDVRVTGDLQ
FT                   HASVFYTVMGDEAHRNDTAAALKSATGMLRSEVGKNLNTRLTPTLEFILDAIPENADHI
FT                   SALLREARERDESVAGLAASATYAGEADPYVKPREDDAEDDDAEDDDAEDDDAEDDKRA
FT                   "
FT   regulatory      complement(375351..375356)
FT                   /gene="rbfA"
FT                   /locus_tag="MTES_0370"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(375545..378328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infB"
FT                   /locus_tag="MTES_0371"
FT                   /product="translation initiation factor 2 (IF-2; GTPase)"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0371"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73335"
FT                   /db_xref="GOA:E8NAA1"
FT                   /db_xref="InterPro:IPR000178"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006847"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR015760"
FT                   /db_xref="InterPro:IPR023115"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036925"
FT                   /db_xref="UniProtKB/TrEMBL:E8NAA1"
FT                   /protein_id="BAJ73335.1"
FT                   /translation="MAKPRVHEIASELGVDSKVALAKLKELGEFVKSPSSTIEPPVARK
FT                   LRAALAAEGSSGSSDAKPAAPAARPGSGARPGPSRPAATPGARPSGPTPGPAKPAAPAA
FT                   PAAAEAAPAASAPEPSAPAAKPTTPSATPSSPPSPGSTAPKPGPSSPPRPGGARPGNNP
FT                   FASSQGMGQRPAGPRPGNNPFASAQGMGQRPTPGNIPRPQAPRPGAPRPGAPRPGGAGR
FT                   PGGGGRPGAPFQQRPGGPGRPGGAGGGFQRPGGGAPAGGFAGRPGGGGGRGRGPGGGTA
FT                   GAFGKGGGKSKQRKSRRAKRQEFEMRSAPVVGGVNVSKGNGEIIRLRRGASIADFADKL
FT                   EALRGYTVQPGTLVTILFNLGEMATATESLDEATFEVLGAELGYKIQMVSPEDEDKELL
FT                   EGFGLDLDAELEAESEDDLEIRPPVVTVMGHVDHGKTRLLDAIRQTNVVAGEAGGITQH
FT                   IGAYQIWTEHEGIERAITFIDTPGHEAFTAMRARGAQVTDIAILVVAADDGIMPQTVEA
FT                   LNHAQAANVPIVVAVNKVDKPDANPAKVRQQLTEYGLVAEEYGGDVMFVDVSARQNLNI
FT                   QALLDAVLLTADAGLDLTANPNKAARGVAIEAKLDKGRGSVATVLIQSGTLRVGDAIVA
FT                   GTAYGRVRAMMDENGEAVEEAYPSRPVSVQGLNSVPRAGDVFIVTEEDRTARQIAEKRE
FT                   AAERNAQLAKARKRISLEDFTRALEEGKVESLNLIIKGDVSGAVEALEESLLKIEVDDS
FT                   VQLRIIHRGVGAITESDINLATIDNAIVIGFNVRPDTKARERAAREGVDVRFYSVIYNA
FT                   IDDVEQSLKGLLKPEFEEVQSGVAEIREVFRSSKFGNIAGVIVRSGTITRNAKARVIRD
FT                   GVVLADGLAIESLRRFKDDVTEVRTDFEAGIGLGKFNDIQIGDEIETTEMVEKPRG"
FT   regulatory      complement(378332..378337)
FT                   /gene="infB"
FT                   /locus_tag="MTES_0371"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(378707..379696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusA"
FT                   /locus_tag="MTES_0372"
FT                   /product="transcription elongation factor"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0372"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73336"
FT                   /db_xref="GOA:E8NAA2"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR010213"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013735"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR025249"
FT                   /db_xref="InterPro:IPR030842"
FT                   /db_xref="InterPro:IPR036555"
FT                   /db_xref="UniProtKB/TrEMBL:E8NAA2"
FT                   /protein_id="BAJ73336.1"
FT                   /translation="MDIDLALLKTIEREKEIPFDELARIIEQAILTAYAKHISPSGEIP
FT                   AGARAELDRKTGHVGIFTPVTDEEGAVIGEEEQAPDDFGRIAAFAAKQVISQRLRDIAD
FT                   DAVLGEFRGKEGDIVAGVVQQGPNPRMVHVDLGTVEAILPPEEQVPGETYAHGSRLRVY
FT                   VTSVSKGNKGPQITVSRTHPGLVRKLFALEVPEIAAGLVEIVSLAREAGHRSKIAVKAN
FT                   DPTVNAKGACIGELGRRVRAVTEELAGEKIDIIDYDAELPRFVANALSPAKVTSSFVLD
FT                   ASTKAVRALVPDYQLSLAIGKEGQNARLAAKLTGAKIDIQPDSILEDN"
FT   regulatory      complement(379704..379709)
FT                   /gene="nusA"
FT                   /locus_tag="MTES_0372"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(379817..380491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0373"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0373"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73337"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:E8NAA3"
FT                   /protein_id="BAJ73337.1"
FT                   /translation="MTAVHLPVGTRARQSGGPPEPGGPVQIADIPVPDTLAARGALALA
FT                   KQYQSPAITAHALRSWLWAEAFARVDGIAGIDHELLYVAAVLHDIGTVTEFDNHTISYE
FT                   HAGGHVGVALTAGAGWPPERRQRVLEVVVRHNWPSVNPSMDAEGYLLETATALDISGAR
FT                   PDDLSVAFVAEVLAAHPRGALAAEFGACVQDQAARKPDTAARRLVDGGVVAKLAANPLE
FT                   LL"
FT   regulatory      complement(380502..380507)
FT                   /locus_tag="MTES_0373"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(380567..383062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0374"
FT                   /product="glucan phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0374"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73338"
FT                   /db_xref="GOA:E8NAA4"
FT                   /db_xref="InterPro:IPR000811"
FT                   /db_xref="InterPro:IPR011833"
FT                   /db_xref="InterPro:IPR035090"
FT                   /db_xref="UniProtKB/TrEMBL:E8NAA4"
FT                   /protein_id="BAJ73338.1"
FT                   /translation="MPDKSSELRPTHPLAIAPVVAPAASVDGFTKQFLQNLNFDQGVTL
FT                   STSDVNDQYLALAYTVRDYLMARWFDDRANQKTQQAKTVCYLSAEYLLGRQLDNNLLAA
FT                   RLTDIATEALAQCGIDIEDLRQVEIEPGLGNGGLGRLAACFIDSLATMSVPTIGYGIRY
FT                   EYGIFRQAFADGQQIEQPDAWLRMGSPWDFAHPEAAQTISFSGHTETYDDEGVERTRWV
FT                   PEWNVLAVPYNMMVPGYHNGRVNTLRLWRAVATNAFDLHTFNSGDYVESVRAQTFAENI
FT                   SKVLYPEDSTPQGKELRLQQQYFFVAASIADFIENVLPDDFALENLPERVIFQLNDTHP
FT                   VIGVPELMRVLVDEKKLEWDAAWAITQKCFAYTCHTLLPEALEVWPVDLLGRLLPRHLE
FT                   IIYRINDEFLLEVRERFGDDEMLIRNMSIIGEHPYRSVRMAYLATVAGSKVNGVAELHS
FT                   QLLRDNVLKDFAAMWPDKFTNVTNGVTPRRFLRLANPELSALITEALGAGWTVDLERLR
FT                   GLEALADDADFRERFAAVKASNKRRLSHVLEARGEAPLDDGHMLDVMIKRLHEYKRQTL
FT                   KVLHIVSTYEGIVSGRLDVDAVQPRTFLFGAKAAPGYGMAKRIIHLINAVGEVVSADER
FT                   VKGKLKVLYPANYNVTLAESIIPAADLSEQISLAGKEASGTGNMKLALNGALTIGTDDG
FT                   ANVEIRKLVGDDNFFLFGMSEPEVEALWAEGYRPADFYQEDGELQRAIDLIASGAFSDG
FT                   DRSVFEPLVSNLLYDDRFMALADFRSYLDAQDRVDAAYADQDGWVRSAILNVARSGYFS
FT                   SDRAMRDYLDRIWHATPIS"
FT   regulatory      complement(383071..383076)
FT                   /locus_tag="MTES_0374"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(383149..384984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0375"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0375"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73339"
FT                   /db_xref="GOA:E8NAA5"
FT                   /db_xref="InterPro:IPR005152"
FT                   /db_xref="InterPro:IPR005325"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E8NAA5"
FT                   /protein_id="BAJ73339.1"
FT                   /translation="MPASRRPLVRRWNALPALTRNAPPRVLLIVGAVVVLLGALIVSRP
FT                   LTSIVLLGVYVGASAVVMGVFELFGRSTRWWARAVAIAWIVAGIAVLVWLGRSLELLPS
FT                   VLAVLLVIGGLASVGRAVTGGAVSARVLSLAWGVAQIAFGVLSFTWPDVTVLVLAVVFG
FT                   VRTIVFGVGVFARGVGGIRRRPRATPFDPERAVRRRRRRARWTAAGRYALSLVLVATAA
FT                   GGWWVNDWLHEGAPVVDAFYNPPAEVPGGHGRLIRSAASPWRAPQNGDVTRILYTTRDA
FT                   VSRPAVASAMVITPKDPPPGPRPVIIWNHGTTGVAQGCAPSLRDSTATRWAIPALEQAL
FT                   KAGWVVIASDFSGQGAPGAYPYLIGKGEARSSLDAVLAAAELRSDLTLSPDTVVWGHSQ
FT                   GGHAALWTTAIAKDYAPGIDVLGTAVVAPVADPPALARELLSGPPNAMLSVITSWVLVP
FT                   YSETYADVHLDDYIAEGSRSIVLEMTQRCPTEPGVVVSVLTALGVSEDRPLYNADLTDG
FT                   ALGRRLAENAMIEPLGTPMLVAWGADDEVIPPKLQRDYIDKLCAEGQPVRWASYAGYDH
FT                   LRPILPKSRFLPVLFDWTENLIERKPQVVDGCGLR"
FT   regulatory      complement(384992..384997)
FT                   /locus_tag="MTES_0375"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      385051..385056
FT                   /locus_tag="MTES_0376"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        385063..385872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0376"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0376"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73340"
FT                   /db_xref="GOA:E8NAA6"
FT                   /db_xref="InterPro:IPR009597"
FT                   /db_xref="UniProtKB/TrEMBL:E8NAA6"
FT                   /protein_id="BAJ73340.1"
FT                   /translation="MPSSARSAAREAEANPAFRVAARAGYVANGILHLLVGGLVLAVGF
FT                   GAAEDSDQTGAFRAVAALPLGAVALWALAAGLVALGGWHVLQAVAPRGLPGRKRVARIA
FT                   AEAPQGIVFVVIGVISAAVALGARPRAEQTTEDVSQSVLSLPIGGFVLGTAGLVVAAVG
FT                   VGFVWMGVRRSFHSKVRIPDGAAGHALSALGAVGFVAKGIALGVVGVLVVVAAIRVEPD
FT                   TAGGLDGAVSALMALPAGPLLAALVGLGFLAYGVFTIFRARYARLDA"
FT   CDS_pept        complement(385879..386700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0377"
FT                   /product="aldo/keto reductase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0377"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73341"
FT                   /db_xref="GOA:E8NAA7"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:E8NAA7"
FT                   /protein_id="BAJ73341.1"
FT                   /translation="MISAPRLSLSDGSTIPQLGIGTYKVPADVTADLVEGALAAGYRHV
FT                   DTAALYGNETEVGQGLRASGLDRDEVFVTTKVWNDDQGFDETLRAFDASAARLGLDRVD
FT                   LYLIHWPIPSADRYVDTWRALIRLQKEGRATSIGVSNFAIPHLERLRDETGVLPAVNQV
FT                   ELHPRFPQNELVDWDAENGVVTQSWAPLARGGLLDEPALARIAEKYGKTPAQVVVRWHL
FT                   DRDLVVFPKSVSLDRIRENGDVFDFALDADDHAAIATLETGERTGRDPSLD"
FT   regulatory      complement(386703..386708)
FT                   /locus_tag="MTES_0377"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(386785..388587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proS"
FT                   /locus_tag="MTES_0378"
FT                   /product="prolyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0378"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73342"
FT                   /db_xref="GOA:E8NAA8"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004500"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR023717"
FT                   /db_xref="InterPro:IPR033730"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:E8NAA8"
FT                   /protein_id="BAJ73342.1"
FT                   /translation="MIVVTRLSNFFLRTLREDPSDAEVASHRLLVRAGYIRRNAPGIFA
FT                   WLPLGLKVKAKIETVVREEMANAGAFEVHFPALLPREPYEVTGRWEEYGDALFRLQDRK
FT                   GADYLLAPTHEEMFTLLVKDLYSSYKDLPLTIYQIQDKYRDEARPRAGLLRGREFTMKD
FT                   AYSFDATDAGLNASYQAQRDAYERIFTRLGLEYVIVAADAGAMGGSKSEEFLHPTPIGE
FT                   DTFVRSAGGYAANVEAFTTVVPEALPIEGQPDAVIFDSPNTPTIATLVDHANAHLDAPA
FT                   PGIAGPATAEATAWTAAHTLKNVVLALTHLDGTRELVVVGLPGDRDVDDKRVEVAFAPA
FT                   EVEAATEEDFAKNPLLVKGYIGPWSPTGPVLGEESATKIRYYLDPRVVDGTAWITGANI
FT                   DQKHVHSLVAGRDFVGDGFVEVSTVRAGDPAPDGSGPVELARGMEIGHVFQLGRKYAEA
FT                   LGLKVLDENGKLATVTMGSYGIGVTRILAIIAELNNDEKGLIWPASVAPFDVHVVATGR
FT                   DAAAFELAEQVSADLEAAGLDVLYDDRPKVSPGVKFGDAELVGIPRILIVGRGAAEGQV
FT                   ELWDRRTGERETLPVADALAALAR"
FT   regulatory      complement(388594..388599)
FT                   /gene="proS"
FT                   /locus_tag="MTES_0378"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(388665..389783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0379"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0379"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73343"
FT                   /db_xref="GOA:E8NAA9"
FT                   /db_xref="UniProtKB/TrEMBL:E8NAA9"
FT                   /protein_id="BAJ73343.1"
FT                   /translation="MNDELTPEERAVMRSRIVGGARGIAPAGAHRNAWIAGSVAAVLVV
FT                   ALAGGVVATSTLSAPQIANTPSPTATATTVPTPAPITTSTPTPTTSVASLGSPPFDGSC
FT                   ANVVDEQALADATGHPMAAAGVKWDDGRGTVRGGLTCWWVSADEFLAAIVRVAVFPIDQ
FT                   EPTEPELFGQEGCTSGVGDECTRVGTVDGTRVWVRMSGSPDNLESRSSDVLAEVLSRVG
FT                   AYAPGIPATPTGAWWGALDCSAVESVIDPTDIGYDSVTVEPPTFSSFPDGCSLAFRQGY
FT                   EGWTASAFPVAGGAVAVPSVIAAGGEQIDVAGAREAYWVAASDGVDGGGGYALIASDGV
FT                   NALQVYVGAGMSSLETDLQRATFVAERILPLL"
FT   CDS_pept        complement(389780..390328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0380"
FT                   /product="DNA-directed RNA polymerase specialized sigma
FT                   subunit, sigma24 homolog"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0380"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73344"
FT                   /db_xref="GOA:E8NAB0"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:E8NAB0"
FT                   /protein_id="BAJ73344.1"
FT                   /translation="MVSGADMGSEDDAGLWARVLGGDELALAALFDRYDGRLFRHASRL
FT                   LTHREDAKDAVTVAFFELWRKRASVRLVEGSPLPWLLNTVAHCARNLERSGRRYRALLD
FT                   RAPVSVAAPHDHDDSDVMAALRRLPEREQAVVVLSVLEGYAEREVAQVLGIPVGTVKSR
FT                   LARAKTKLRGELGQEGARA"
FT   regulatory      complement(389791..389796)
FT                   /locus_tag="MTES_0379"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(390336..390341)
FT                   /locus_tag="MTES_0380"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(390391..391593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0381"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0381"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73345"
FT                   /db_xref="GOA:E8NAB1"
FT                   /db_xref="UniProtKB/TrEMBL:E8NAB1"
FT                   /protein_id="BAJ73345.1"
FT                   /translation="MNDQLTPDERAAMRSRILGGARDIKPVGAHRGAVIAGAIAAVLVV
FT                   AIAGGVATTSTLSAPQIANTPSPSPTATVAPVVPTPTLTPTPTPTPTFTPTLAPAPSTP
FT                   VVAFNGDCGQMLTDTDLSELLVGGPGRLYTEPGLGTNVEDSLALLGGLSCIWIGNQDSI
FT                   SVVVAAPSAVATDLQASMASVTCSVDRGCATGRVVGDLWVGVLVSATAGNYEAGFTQDE
FT                   VSAASARLDRVISRVAAKPHASPVASFGSVHADGWVLSDCVALKGRMEGITGLSLEMQI
FT                   APGAYPTPTRPVESLLMSSAGVSTCLFREPADGSREMIEVTLMPGASAPPASALAVTGT
FT                   SETSVPGADRAWVHADPSRGYLTDLVAVVGDNRLLVRRFTGSPSGTDADKIAAAVLESV
FT                   R"
FT   CDS_pept        complement(391590..391970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0382"
FT                   /product="DNA-directed RNA polymerase specialized sigma
FT                   subunit, sigma24 homolog"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0382"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73346"
FT                   /db_xref="GOA:E8NAB2"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:E8NAB2"
FT                   /protein_id="BAJ73346.1"
FT                   /translation="MAFFELWRKRASVRLVEGSPLPWLLNTVAHCARNLERSGRRYRAL
FT                   LDRAPVSVAASHDHDDSDVMAALRRLPEREQAVMVLAVLEGYSEREVAQALGIPAGTVK
FT                   SRLARAKARLRGELSSLEGVRA"
FT   regulatory      complement(391601..391606)
FT                   /locus_tag="MTES_0381"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(391980..391985)
FT                   /locus_tag="MTES_0382"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      392225..392230
FT                   /locus_tag="MTES_0383"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        392237..393076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0383"
FT                   /product="NADH:ubiquinone oxidoreductase subunit 4 (chain
FT                   M)"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0383"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73347"
FT                   /db_xref="UniProtKB/TrEMBL:E8NAB3"
FT                   /protein_id="BAJ73347.1"
FT                   /translation="MHPRWIAVIASSVALVLGVVFWGTTGLVVWSITQSQAAAELGTGL
FT                   PPLDDPIRETDDDFRITEVYEVGADGILSPSPSAEAAAVWAEIERVFTPRVAATRISQL
FT                   KVGDDPSSDTLAWVSREDTPEYWTFAANVAYADDEELWLGTLVHEYAHVLSLGPDSVDS
FT                   YTDTCDTIWTGQGCLLPETALLAFSDRFWEAYSDAPEADNVDVDVADAFYAAHEDDFVD
FT                   AYAATNVAEDFAESFMAYVMEDEPTDGGVVADKLRFFRDYPPYVLIRERLRAEFDLG"
FT   regulatory      393107..393112
FT                   /locus_tag="MTES_0384"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        393120..393752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0384"
FT                   /product="pyrrolidone-carboxylate peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0384"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73348"
FT                   /db_xref="GOA:E8NAB4"
FT                   /db_xref="InterPro:IPR000816"
FT                   /db_xref="InterPro:IPR016125"
FT                   /db_xref="InterPro:IPR029762"
FT                   /db_xref="InterPro:IPR033693"
FT                   /db_xref="InterPro:IPR033694"
FT                   /db_xref="InterPro:IPR036440"
FT                   /db_xref="UniProtKB/TrEMBL:E8NAB4"
FT                   /protein_id="BAJ73348.1"
FT                   /translation="METVLLTGFEPFAGDATNPSGDAVRAVEERWTGTERLIVEVLPVA
FT                   FDAAATRLRQLLDEHRPDIVIATGLAGGRAQVTPERVAINLADARIPDNDGAQPVDRPV
FT                   VEGGPAAYFATLPVKAIAAALTREGIPAAVSHSAGTFVCNHVMYTALDAAAPGVRAGFV
FT                   HVPSAREHAPEGAASLPLDDIVRAVELTVRTALDVREDVAAPGGTLH"
FT   CDS_pept        complement(393763..394947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0385"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0385"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73349"
FT                   /db_xref="GOA:E8NAB5"
FT                   /db_xref="InterPro:IPR004711"
FT                   /db_xref="UniProtKB/TrEMBL:E8NAB5"
FT                   /protein_id="BAJ73349.1"
FT                   /translation="MTETSHASLARPLIAGVVTALVGFTSTFAVVLTGLRSVGATPEQA
FT                   ASGLLAITLMVGIGCIFLAWRYRMPITIAWSTPGVALLAATGAVEGGWPAVVGGFLVSG
FT                   ALILCTALFPPLGALIARIPPSIAQAMLAGVLFPLCVQPFLGLVADPWGVAPVLIVWLV
FT                   ASRLLPRWAVPLAFVAAIVVVAVSLGRTGADLDAASLVPQLAFTAPTLTVGSVVGIALP
FT                   LFVVTMASQNVPGVAVMRSLGYTIPWRPAMLVTGAGSMLAATGGGHAVNLGAISAAIAA
FT                   GPDSHPDPKRRWVAGVSAGSTYLVLGALSAAFAAIVLLAPAGVIPAVAGVALFAAFGSA
FT                   VQQAIDDPGERTPAVVTFLIAASGIAIAGVSAAFWALVAGLLVRTILHLGRRAG"
FT   regulatory      complement(394960..394965)
FT                   /locus_tag="MTES_0385"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(395015..396157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispG"
FT                   /locus_tag="MTES_0386"
FT                   /product="enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0386"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73350"
FT                   /db_xref="GOA:E8NAB6"
FT                   /db_xref="InterPro:IPR004588"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR016425"
FT                   /db_xref="UniProtKB/TrEMBL:E8NAB6"
FT                   /protein_id="BAJ73350.1"
FT                   /translation="MNIGMPRVPEVLAPRRKTRQIKVGKVLVGGDAPVSVQSMTTTPTT
FT                   NINATLQQIAELTASGCEIVRVAVPSQDDADVLHIIAKKSQIPVIADIHFQPKYVFQAI
FT                   DAGCGAVRVNPGNIRKFDDQVGAIAKAAKDAGVSLRIGVNAGSLDRRLLEKYGKATPEA
FT                   LVESAVWEASLFEEHDFHDFKISVKHNDPIVMVKAYRLLAERGDWPLHLGVTEAGPAFQ
FT                   GTIKSATAFGILLSEGIGDTIRVSLSAPPAEEVKVGHQILQSLNLRERKLEIVSCPSCG
FT                   RAQVDVYTLADDVTEGLKDMTVPLRVAVMGCVVNGPGEARDADLGVASGNGKGQIFVKG
FT                   EVIKTVPEAEIVRTLIEEANRLADEMGPDAAPGTAQVITA"
FT   CDS_pept        complement(396154..396402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0387"
FT                   /product="bacteriophage capsid portal protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0387"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73351"
FT                   /db_xref="UniProtKB/TrEMBL:E8NAB7"
FT                   /protein_id="BAJ73351.1"
FT                   /translation="MRVEGSGPVIEVSFVYERGSKAAAENTKTARIPQGEGGLLHACAP
FT                   PRRWATRMCTRAWRRTYHRAPSAPVRVRKRRLWTCLQ"
FT   regulatory      complement(396168..396173)
FT                   /gene="ispG"
FT                   /locus_tag="MTES_0386"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      396362..396367
FT                   /locus_tag="MTES_0388"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        396374..398308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0388"
FT                   /product="anthranilate/para-aminobenzoate synthase
FT                   component I"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0388"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73352"
FT                   /db_xref="GOA:E8NAB8"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:E8NAB8"
FT                   /protein_id="BAJ73352.1"
FT                   /translation="MTGPDPSTLIPDLLAGSAPFALIARDGRTVEVLTGDVVDVDLLSD
FT                   IPLTDATGTAREVLALVPFRQVRERGFVCHDDGAPLRCLVVDERVSLDRAETVASLPSS
FT                   PVPLADAGFDIADEEYADIVRRVIADEIGRGEGANFVIRRDFVAGVDVDPRVAALTWFR
FT                   ALLEHEKGAYWTFAVVTEGHIAVGASPEAHVSAQNGIVTMNPISGTFRHPAGGATAETL
FT                   AEFLRSTKETEELFMVVDEELKMMSAVCSDGGRITGPHLKVMSRLTHTEYMLRGRSDLD
FT                   PRDILRETMFAPTVTGSPMQNACTVIARHETTPRGYYSGVAALFTPNGATEGPTHDLDA
FT                   PILIRTAYLVDGRLRVPVGATLVRHSDPDGEVGETHGKAAGVLGAIGAIPRDVPAAPPA
FT                   ADPDAPTDPRRPLDEDPAIAELLASRNDRLAPFWMNPQDPDGSGPFAGRTALVVDAEDR
FT                   FTTMLAHQLRHLGLDTRIVHWSEVSDAELDAADLVVSGPGPGDPRDESPRMEAMRHVVG
FT                   RRRVAGAPLLAVCLSHQILADALGIDLQPLAQPHQGLQKTVDVFGEPASIGFYNTFTAR
FT                   VHPGDRRGITSGGGDVVTHVDIDVAADPATGDVYALRGPGYASVQGHLESILSRDGMRT
FT                   LERLISHVL"
FT   regulatory      complement(396409..396414)
FT                   /locus_tag="MTES_0387"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(398461..399777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0389"
FT                   /product="predicted membrane-associated Zn-dependent
FT                   protease 1"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0389"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73353"
FT                   /db_xref="GOA:E8NAB9"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR008915"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:E8NAB9"
FT                   /protein_id="BAJ73353.1"
FT                   /translation="MTAIAFLIGVLVLVVGLAISIALHEMGHLLPAKIFGVRVGQYMIG
FT                   FGPTLWSRRIGETEYGFKALPLGGFISMAGMYPPAPEGEEPSKRRSRFFATMVQDARDA
FT                   NAETLIGGDDRAFYRLPVWKRIIIMLGGPAMNLVLAVVLFTIALSGIGIQQGTTTVASV
FT                   SECVIPASQQRQDCAPSDPVAPAKAAGMQPGDKMISIDGTPVSTFTEAAAIIQASPGKP
FT                   LSMVIERDGAEQTIQFTPQSTDRAVTDAQGQPMTDASGAREYETIGFAGLSPQIAYEPQ
FT                   PIWTGVDATGQYIEHVAQIMVQLPVRIYGVAVDTLTGQPRDADSPMSVVGAGRMAGEIA
FT                   AVDTPILDRVQQMILLLGGLNIALFAFNLIPLLPLDGGHVVVALWDGLKKLIARARGRI
FT                   AKPVDATRLVPVTFVVVILLVGMGGVLFLADIFNPVKLL"
FT   regulatory      complement(399789..399794)
FT                   /locus_tag="MTES_0389"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      399855..399860
FT                   /locus_tag="MTES_0390"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        399865..401523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0390"
FT                   /product="UDP-N-acetylmuramyl tripeptide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0390"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73354"
FT                   /db_xref="GOA:E8NAC0"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005761"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:E8NAC0"
FT                   /protein_id="BAJ73354.1"
FT                   /translation="MPTDATPNLPPVLRPERPPQRDLAELARRFGVRSVGEVEGTTLTG
FT                   ITLATADLRAGEAFVAIRGVNRHGAEFAATAAERGAVAVITDAEGAEIAASTGLPIVIV
FT                   EDPRALLGDLSAWVYGTGPDDDIPQLLATTGTNGKTSVSHLLEGILGQLGVVTGLSSTA
FT                   ERHIAGEVIVSRLTTPEASEFHALLALMRERGVEAVAVEVSAQALTRHRVDGLVFDVAG
FT                   FTNLTHDHLDDYADMREYFEAKLPLFRADRARRGVVCLDSASGAEIVARAEIPVVTIVT
FT                   PAIAEDPSADADWTVDIVDERQEGTEFTLRARDGRALTTVVPVIGRHMAANAGLAIVML
FT                   LETGYAWERLVDALDGGRIDASLPGRTQLVSGPEGPAVYVDFGHSPDAFEKTLAAVRRV
FT                   TPGKVVMLFGADGDRDATKRHDMGRTAVLGSDILVVTDHHPRHEDPDAIRAVLVEGARR
FT                   ARPDAEILEFTPPERAILEAVKLVGEGDAILWAGPGHQDYRDIRGVRTPYSARELSRRA
FT                   LRAAGWAVPEPQWPVPYPDDSTPSSDPERPVDFPA"
FT   CDS_pept        complement(401548..402375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0391"
FT                   /product="predicted transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0391"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73355"
FT                   /db_xref="GOA:E8NAC1"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:E8NAC1"
FT                   /protein_id="BAJ73355.1"
FT                   /translation="MLHIGEFSALTGLTVKALRHYDEQGLLGPARVDETSGHRFYAPRQ
FT                   IRDALTILALREADVPLPLIARVLGSPGDVGALEEQRDRVLRERRRHDAAFDAVLQAFD
FT                   APAGEIVLARREEPEQAFLGYPLAADPHAGVAEDGDTREGDTRSEDARDDDASDPFARA
FT                   GVDVSDSHWVSTRVRDQETHDVTLCWPVPEAAAPDDLPGFISGVLPARTELFVTRGTDA
FT                   AGLQDLGWYAEALTRLVEALAAEQRPHRDGFLMRYQVSPTGADSWDIDLSVVL"
FT   regulatory      complement(402381..402386)
FT                   /locus_tag="MTES_0391"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(402417..403499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dxr"
FT                   /locus_tag="MTES_0392"
FT                   /product="1-deoxy-D-xylulose 5-phosphate reductoisomerase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0392"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73356"
FT                   /db_xref="GOA:E8NAC2"
FT                   /db_xref="InterPro:IPR003821"
FT                   /db_xref="InterPro:IPR013512"
FT                   /db_xref="InterPro:IPR013644"
FT                   /db_xref="InterPro:IPR026877"
FT                   /db_xref="InterPro:IPR036169"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E8NAC2"
FT                   /protein_id="BAJ73356.1"
FT                   /translation="MRRVLLLGSTGSIGTQALDVIRANADRFEVVGLAAGSDRAGVEAQ
FT                   AREFGVEHVALGAVEAEQLVRDVEADVVVNGITGSVGLGPTIAALETGRTLALANKESL
FT                   IVGGDLVTALAAPGQIVPVDSEHSAIAQALRSGEAHEVRRLVLTASGGPFRGRSREQLR
FT                   SVTPAEALAHPTWDMGRVVTTNSATLVNKGLEVIEAHLLFDVPYDRIDVTVHPQSIVHS
FT                   MVEFIDGSTIAQASPPDMRLPISLGLDWPRRVSGVGAPLDWTTASHWTFEPLDEKAFGA
FT                   VALAKKVGRAGATYPAVFNAANEQAVDAFHEGRLSFLGILEVVEAVVDRHDAPGTLTRE
FT                   SLAEAEDWARRTADAVIVAR"
FT   regulatory      complement(403508..403513)
FT                   /gene="dxr"
FT                   /locus_tag="MTES_0392"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(403509..404471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0393"
FT                   /product="FKBP-type peptidyl-prolyl cis-trans isomerase 1"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0393"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73357"
FT                   /db_xref="GOA:E8NAC3"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="UniProtKB/TrEMBL:E8NAC3"
FT                   /protein_id="BAJ73357.1"
FT                   /translation="MRFRPIASLSVAAVAVLLLAGCAGSSDDSQTPDASASPDAGQCQT
FT                   PFTGDVPAGLEVSGDFQGAVTVTRPDGYAPTAIQRSTLIQGTGDEVKAGDLVKANYTVI
FT                   DASTGAVALDSLKSDPSGMDMIVNAQQIFGAAVSCVPIGSRTVSTFPAGTLGEGSPAYI
FT                   LVADSISELPTRAEGTEVAPVEGMPTVTFADNGAPTITVPSTPAPTETRIENLRQGTGD
FT                   VVNPGDTVIVQYTGVLYDGGTVFDSSWDKGAPTQFATTDVVPGFKQALEGQTVGSQVVA
FT                   VIPPADGYGDQAKGSIPAGSTLVFVVDILGVQHATPTAQ"
FT   regulatory      complement(404478..404483)
FT                   /locus_tag="MTES_0393"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      404569..404574
FT                   /gene="plsC"
FT                   /locus_tag="MTES_0394"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        404583..405332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="plsC"
FT                   /locus_tag="MTES_0394"
FT                   /product="1-acyl-sn-glycerol-3-phosphate acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0394"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73358"
FT                   /db_xref="GOA:E8NAC4"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:E8NAC4"
FT                   /protein_id="BAJ73358.1"
FT                   /translation="MSSDVPAETPAAVPQQMGATYVLGRSLIAPLARAVYRPRVEGREN
FT                   VPRTGPVIFASNHLSFIDSIAIPVAAPRPVHFMAKSAYFEKWASRQFFTAIGAIPVERG
FT                   AGQKALDALDQQRALLEDGRAVALYPEGTRSLDGRLYKGRTGVAFLALQTGAPVVPVGL
FT                   IGTDKVMPVGAKIPTTKERITVRFGEPLDLSPHGPATSGRARRGATDEIMAAIHALSEQ
FT                   ELANAYNEAPAQNPLERIKQVLPHERL"
FT   regulatory      405409..405414
FT                   /gene="dhaK"
FT                   /locus_tag="MTES_0395"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        405419..406414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dhaK"
FT                   /locus_tag="MTES_0395"
FT                   /product="dihydroxyacetone kinase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0395"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73359"
FT                   /db_xref="GOA:E8NAC5"
FT                   /db_xref="InterPro:IPR004006"
FT                   /db_xref="InterPro:IPR012736"
FT                   /db_xref="UniProtKB/TrEMBL:E8NAC5"
FT                   /protein_id="BAJ73359.1"
FT                   /translation="MKKFVNDPADVLAEALRGIQAAYPQLRVDAENRVILRAEPTRAGK
FT                   VALVSGGGSGHEPLHGGFVGRGMLDAAAAGEVFTSPTPDQVLAATQAVDSGAGVLHIVK
FT                   NYTGDVLNFEMAAELAAAEGVQVESVVVADDVAVQDSTWTAGRRGTGTTVVLEKIVGAS
FT                   AEEGADLATVAELARRVSAAGRSMGVALTSCTVPAAGRPTFELPDDEMEVGVGIHGEPG
FT                   RSRVKLASAHEIAKLMVDPIVHDFGDPVGPAIVLLSGLGGTPLIEQYLLYGEIAPLLAD
FT                   AGVDVQRVLIGDYITSLDMAGASLTVVKADDEMLRLWDAPVVTPGLRWGA"
FT   regulatory      406401..406406
FT                   /locus_tag="MTES_0396"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        406411..407049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0396"
FT                   /product="dihydroxyacetone kinase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0396"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73360"
FT                   /db_xref="GOA:E8NAC6"
FT                   /db_xref="InterPro:IPR004007"
FT                   /db_xref="InterPro:IPR012737"
FT                   /db_xref="InterPro:IPR036117"
FT                   /db_xref="UniProtKB/TrEMBL:E8NAC6"
FT                   /protein_id="BAJ73360.1"
FT                   /translation="MSGTVSTGDLVAWIRAFRDAVHQHKDELTRLDSEIGDADHGSNMA
FT                   RGLDAVVAKLDSAPANAGDLFKTVGMTLVSSVGGASGPLYGTLFLRMGPALSSDEVDAT
FT                   ALGAALRAGVEGVVARGKAELGDKTMIDALSPALDAWDAAVTEGADAAGAARAAADAAA
FT                   RGRDATEPLVARKGRASYLGERSAGHLDPGAASATLLLEALRDALADAA"
FT   regulatory      407034..407039
FT                   /locus_tag="MTES_0397"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        407046..407768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0397"
FT                   /product="uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0397"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73361"
FT                   /db_xref="GOA:E8NAC7"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR002114"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR012844"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="InterPro:IPR039643"
FT                   /db_xref="UniProtKB/TrEMBL:E8NAC7"
FT                   /protein_id="BAJ73361.1"
FT                   /translation="MIGLVAVSHSRALADAAVELALQMGGENPPTVRVAAGGPDGDLGT
FT                   DAVAIAAAIDEADSGDGVLVLMDLGSAILSAETALEFVAEPDRVRLSPAPFVEGLVAAV
FT                   VTAAGGADLAAVAAECATAGDAKRRQLGEDDGAGVSASGTGEAAAEASFEAVVTNPSGL
FT                   HARPAATFVKTASRYDADVRIADLDAGSEEISGRSLLALMALGIRQGSRVRVSASGPEA
FT                   PAALTELRALIEDGFGER"
FT   CDS_pept        complement(407775..408740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0398"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0398"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73362"
FT                   /db_xref="GOA:E8NAC8"
FT                   /db_xref="InterPro:IPR007324"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:E8NAC8"
FT                   /protein_id="BAJ73362.1"
FT                   /translation="MVTQAEARGRDALRAAQLYYMQDLTMDAIAHEMRVSRSSVSRLLQ
FT                   HARDVGLVTISISPPDDARGQMAQRIADRFGIAAHVVPTPARTTEADRLERTALTAARI
FT                   LTERVESSMTVGIAWGSTLSAIARHVPAKDVHDTHIVQMNGAANVRTSGIPYAGEILSR
FT                   FGTAWSSSVHQFPVPALFDDPQTKRAMWRERSVRSVLEIQDRVGLFVFGLGSPQADVPS
FT                   HVYSSDYFDVRDRAVIEREGVVGDCATVFYRVDGSSDIPELNARSSGPDLDTVRRIPRR
FT                   FCVVSSLSKLDALRGALAAGLVTELVVEEALARRLLSVTR"
FT   regulatory      complement(408747..408752)
FT                   /locus_tag="MTES_0398"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      408831..408836
FT                   /locus_tag="MTES_0399"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        408848..410566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0399"
FT                   /product="glycerol-3-phosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0399"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73363"
FT                   /db_xref="GOA:E8NAC9"
FT                   /db_xref="InterPro:IPR000447"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR031656"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR038299"
FT                   /db_xref="UniProtKB/TrEMBL:E8NAC9"
FT                   /protein_id="BAJ73363.1"
FT                   /translation="MSSPATSLRADVQALRDAEDIDVLIIGGGINGLATLRDLSLQGVS
FT                   VALVERGDFVSGASSASSHMVHGGIRYLENGEFRLVKEAVTERNDLLKTAPHYVKPLET
FT                   TIPIYKTFSGILSAPFRLLVTHGRGKPNERGALLIKVGLIMYDTFSRDGGSVPRHTFLG
FT                   KKKSLQALPKLNPDLAYTATYFDASMHDPERIALDVLHDGIVAGAGRTQAVNYVSAVGA
FT                   DANGVRVRDEVSGEEFSVKAKVILNTAGPWTDLANAAMGLKTQFMGGTKGSHIVLDNPE
FT                   LLAATGGREIFFEHSDGRIVLIYPLKDRVLVGTTDIDADPAKPVVCTDDEIDYFFDLVG
FT                   HVFPSIAVDRSQIVYTFSGIRPLPRHDDTAPGFVSRDYRIVEDEIAGVPAMSLVGGKWT
FT                   TFRALAEHLSMKTLQKLRRPHRVSTQGLPIGGGAGFPATPEARRRWVAARTNAHSRELV
FT                   EALLTRYGTRADLLLEALPAEPTPIEHAPGYYVEELEWIARNEQVVHLIDVLLRRTHLA
FT                   FVGGMTERTLVEVAEAVAGPLGWDADRVQEEVERTREILLTAHRVDLAEAGVAAI"
FT   regulatory      410671..410676
FT                   /locus_tag="MTES_0400"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        410688..411443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0400"
FT                   /product="glycerol uptake facilitator"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0400"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73364"
FT                   /db_xref="GOA:E8NAD0"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="InterPro:IPR022357"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="UniProtKB/TrEMBL:E8NAD0"
FT                   /protein_id="BAJ73364.1"
FT                   /translation="MQEVNLGLYFLSEVVGTAMLILLGCGVVANVALAKTKGNAGGTLM
FT                   VNWGWGLAVFAGVIVSAYSGAQLNPAVSIGLLVAGKIGFVQFLVAIAAQMVGAIIGAVL
FT                   TWASYKQHFDEEPDPAAKLGVFSTGPAIRSYGFNFLTEVIATFVLVFVIFGFADYGVAD
FT                   IGVPGGIGGLAAVPVALLVVGIGASLGGPTGYAINPARDLGPRIAHAILPIKGKGSSDW
FT                   SYAWVPVAGPLVGGLLAGLLAPVLLHLGK"
FT   regulatory      411526..411531
FT                   /gene="glpk"
FT                   /locus_tag="MTES_0401"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        411539..413050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpk"
FT                   /locus_tag="MTES_0401"
FT                   /product="glycerol kinase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0401"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73365"
FT                   /db_xref="GOA:E8NAD1"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR005999"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:E8NAD1"
FT                   /protein_id="BAJ73365.1"
FT                   /translation="MADYVLAIDQGTTSTRAMIFDKSGGVVAVGQKEHEQIFPRAGWVE
FT                   HDPLEIWRNTQEVIGLALSRADITRHDIAAVGITNQRETAVVWDKNTGKPVYNAIVWQD
FT                   TRTQSIVDRLADGDTERYKSIVGLPLATYFSGTKIVWILENVDGAREKAEAGDLIFGTT
FT                   DTWVLWNLTGGIDGGVHATDVTNASRTLFMDLETLEWRDDILADFGVPRSMMPEIRSSS
FT                   EVYGTVESSSLLRETPVAGILGDQQAATFGQAAFDPGESKNTYGTGNFLIFQTGEEIVH
FT                   SKNGLLTTLGYKLGDQPARYALEGSIAVTGSLIQWLRDQLGIISSAPEVETLASSVDDN
FT                   GGVYFVPAFSGLFAPYWRPDARGAIVGMTRYVNKGHIARAALEATAFQTREVLDAVNAD
FT                   SGVDLTELKVDGGMTANDALMQFQADILGVPVVRPVVAETTALGAAYAAGLAVGFWDNL
FT                   DDLRANWQEDKRWEPDMDSDERDRELRLWKKAVTKSMDWVDEDVR"
FT   CDS_pept        complement(413293..413796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0402"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0402"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73366"
FT                   /db_xref="GOA:E8NAD2"
FT                   /db_xref="UniProtKB/TrEMBL:E8NAD2"
FT                   /protein_id="BAJ73366.1"
FT                   /translation="MGASYSERMQLEPALRRLDRIAGGRQADHRVDVPDDPRVRRALRA
FT                   ITLLLALGFVLGVATVVIALIMTANGADVGFAVWMRCLVVLAITTTLFYFLWRARAGWY
FT                   WAFRRLQLFSRIFPVVALVLAAIPGLYPFWVVTEQILFAILLIGVSDYLQSDVVRAAYP
FT                   KPQR"
FT   regulatory      complement(413805..413810)
FT                   /locus_tag="MTES_0402"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(413809..414279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0403"
FT                   /product="predicted redox protein, regulator of disulfide
FT                   bond formation"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0403"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73367"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:E8NAD3"
FT                   /protein_id="BAJ73367.1"
FT                   /translation="MNGEHHYRLRSTWTGDRGSGTSGYRDYDRAVTLEVEGKPAIAASA
FT                   DKPFRGDPAKWNPEELLLAALSECHLLSYLHACVTTGVVVTAYEDDASGTMQEDGNSGG
FT                   AFTEVVLRPRVRVADESMVEAARAAHKQAREWCFIANSVNFPVRHEPEITVG"
FT   regulatory      complement(414284..414289)
FT                   /locus_tag="MTES_0403"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      414374..414379
FT                   /gene="ansA"
FT                   /locus_tag="MTES_0404"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        414382..415365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ansA"
FT                   /locus_tag="MTES_0404"
FT                   /product="L-asparaginase II"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0404"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73368"
FT                   /db_xref="InterPro:IPR010349"
FT                   /db_xref="UniProtKB/TrEMBL:E8NAD4"
FT                   /protein_id="BAJ73368.1"
FT                   /translation="MPATPPASVELAVVERNGFIESRHHGVAVVLAPDGSEKLTLGEAT
FT                   ASFLPRSSMKPLQALACLSAGADLADERLAIAMASHCGTERHVETARGILQSAGLTEDD
FT                   LGCPAAWPSDTAARDELVRDHGAPSPLRMNCSGKHAAMLLTCVANGWSTADYLDPQHPL
FT                   QVHIREVLERLVGERMTTTAIDGCGAPVYAMSLIGLARAIQRIATSSERSPFALHRSAG
FT                   TLVRAVKEHPWTIDGPGRPDTVVIERLGVFSKLGAEGVQVMTAPDGTTVALKMLDGSNR
FT                   AGHAVALRLLERVGALTPAAVADTLALLPLTVSGGGHEVGGIRSTV"
FT   CDS_pept        complement(415456..416988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0405"
FT                   /product="amino acid transporters"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0405"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73369"
FT                   /db_xref="GOA:E8NAD5"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:E8NAD5"
FT                   /protein_id="BAJ73369.1"
FT                   /translation="MTSAPERTSGKGLATGTLGLWGSTVIGLASTAPVYSLVATLGFVV
FT                   VAVGAQAPIAFVLAFIPMLFIAFAYRELNNEVPDCGTTFTWGTKAFGPWVGWMGGWGVA
FT                   VAGMVVLANLSQIAGIYLWSLIGDGSLAENVPLVTATGVAFIAAMTYVSYRGVEIGERI
FT                   QNILLAVQYVVLALFVVVALWKFFDGTAPNPTPFDFAWFNPFGFTEWSGFTEAVLLALF
FT                   IYWGWDTCLALNEETKDPKRIPGRAALLTTVILLGTYVTVTVAAMMYAGVGEDGAGLAN
FT                   ASNADDVFLAMKDGLFGPFAWVLVVAVLISAVSSTQTTILPTARGTLAMAAYKALPARF
FT                   QTVHPRFHTPSFSTLVMGIVASVYYVGMTIISDNILQDSILSLGLAIAFYYALTGYACV
FT                   WYFRRELFTSGKNLLYRGILPLLGALMLTYAFVQSAIDMYDVDYGNSELLGIGGTFVVG
FT                   IGALAFGVVLMLVWYLVPASKPFFRGESLNRDTEVLVPDEPIAYPRSVDGGI"
FT   regulatory      complement(417000..417005)
FT                   /locus_tag="MTES_0405"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(417034..417807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0406"
FT                   /product="serine/threonine protein phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0406"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73370"
FT                   /db_xref="GOA:E8NAD6"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:E8NAD6"
FT                   /protein_id="BAJ73370.1"
FT                   /translation="MPEVTTHTRTVPLSETTLDLAWAAGTDTGKRREVNQDAVLAEYPL
FT                   FVVADGMGGHLGGEIASASTVDRLQAVVSGGTVSPRHIEKALSRAVKDIVSHPETTDEG
FT                   TGTTLTGLYLETTAEEPHWVTLNIGDSRVYLLRDGEIVQVTTDHSVVQELIAAGRLSPE
FT                   EAENHPYGNVITRAVGPSDSVKPDYLRLEVVDGDRFVVCSDGLTKELTDFGIKHFLEAN
FT                   ADPAAAVEAMMAAALENGGRDNITIIVLDVSRQSS"
FT   regulatory      complement(417814..417819)
FT                   /locus_tag="MTES_0406"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(417926..418906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0407"
FT                   /product="predicted oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0407"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73371"
FT                   /db_xref="GOA:E8NAD7"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:E8NAD7"
FT                   /protein_id="BAJ73371.1"
FT                   /translation="MTSSPLPQRPVGRSGLRVSAIGLGCNNFGRAGTATETLDGTRAVL
FT                   NAALDAGVTFLDTADVYGREFGLSETLMGEALQGRRDEVVLATKFGHADLAPGVPGGAK
FT                   ASRTSIRRSVEGSLRRLRTDWIDLYQLHTPDPSTPIDETLDALADLVREGKVRYVGHSN
FT                   FSGWQIAEADHAAKGVRFVSSQNQYSLLARAAEREVLPAVDRFGLGLLPFFPLHNGLLT
FT                   GKFSREGGPEHSRIMRQRPHLWRNAPWDALERYQTFCDERGITMLQATFAWFLANPLVA
FT                   SVIAGATSPEQVQANAAAATAWEPSVDDIAEIDGILSLPADPAAG"
FT   regulatory      complement(418915..418920)
FT                   /locus_tag="MTES_0407"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(418971..419681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0408"
FT                   /product="large exoproteins"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0408"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73372"
FT                   /db_xref="GOA:E8NAV0"
FT                   /db_xref="UniProtKB/TrEMBL:E8NAV0"
FT                   /protein_id="BAJ73372.1"
FT                   /translation="MDILHLAYSDPYDTSGAAGLAVMGAVYAFAAVIGLIGYVIGSFLL
FT                   MKVFERAGVEGKWRAWVPVYNYMVFVKLGDISPWVILGIAVAWAIPFLNFLAIPVGLVV
FT                   LIMAAVRVNAKFGREWPILLLFLLSGLGVWIWLGILGFSGNRWNPAAASPSPWGSSFLA
FT                   DKTVWNGIPVQPAQQGAGVNGGGYGAAPQGYAAPSNPSYPPAPPASGATPPPPAPPATG
FT                   TTPPPPAPPAGPQV"
FT   regulatory      complement(419687..419692)
FT                   /locus_tag="MTES_0408"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(419795..420544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0409"
FT                   /product="uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0409"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73373"
FT                   /db_xref="InterPro:IPR005583"
FT                   /db_xref="UniProtKB/TrEMBL:E8NAV1"
FT                   /protein_id="BAJ73373.1"
FT                   /translation="MLVLLPPSETKRRGGDGPPLRLDALAMPSLRAPREAVVDALVALS
FT                   ADEDEAARVLKLSAKRRHEIADNAALRSSPTMPAIDRYTGVLFDALDAGSLGATARSWV
FT                   AAHVAIHSAPLGPIGALDGIPTYRLAAGTSIPGLPALRRVWAGAVSAALSTLAPSFVLD
FT                   LRSEAYAALGPVPADVQSSYVRVVTGGGDSPVRALNHFNKHAKGELVRSLATTAPEIHS
FT                   VGDFTAWAEASGWVVREGEPGEIALVV"
FT   regulatory      complement(420548..420553)
FT                   /locus_tag="MTES_0409"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(420616..420876)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpC"
FT                   /locus_tag="MTES_0410"
FT                   /product="F0F1-type ATP synthase, epsilon subunit"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0410"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73374"
FT                   /db_xref="GOA:E8NAV2"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="InterPro:IPR036771"
FT                   /db_xref="UniProtKB/TrEMBL:E8NAV2"
FT                   /protein_id="BAJ73374.1"
FT                   /translation="MSLRVSLVSADAEVWTGEASLVVAKTVEGEIGFMQGHEPVLAILA
FT                   QGEVRITRADGSKILASAQDGFLSMANDELTIVAGNAALVS"
FT   CDS_pept        complement(420878..422326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpD"
FT                   /locus_tag="MTES_0411"
FT                   /product="F0F1-type ATP synthase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0411"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73375"
FT                   /db_xref="GOA:E8NAV3"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/TrEMBL:E8NAV3"
FT                   /protein_id="BAJ73375.1"
FT                   /translation="MSLTAEKTDAAVVGRVARVTGPVVDIEFPHDAIPEIYNALKTTIT
FT                   IGDESTEITLEVAQHLGDDLVRAIALKPTDGIVRGQEVRNTGGPISVPVGDVTKGKVFD
FT                   VTGEVLNAAPGEQIEVTERWGIHRKAPSFDQLESKTEMFETGIKSIDLLTPYVQGGKIG
FT                   LFGGAGVGKTVLIQEMIQRVAQDHGGVSVFAGVGERTREGNDLIGEMEEAGVFDKTALV
FT                   FGQMDEPPGTRLRVALSALTMAEYFRDVQKQDVLLFIDNIFRFTQAGSEVSTLLGRMPS
FT                   AVGYQPNLADEMGVLQERITSTRGHSITSLQAIYVPADDYTDPAPATTFAHLDATTELS
FT                   REIASKGLYPAIDPLTSTSRILDPRYIGADHYRVATAVKQILQKNKELQEIIAILGVDE
FT                   LSEEDKIVVSRARRIQQFLSQNTYMAKKFTGVEGSTVPIKETIESFDAIVKGDFDHVAE
FT                   QAFFNVGGISDVEAKWAQIQKENG"
FT   regulatory      complement(420887..420892)
FT                   /gene="atpC"
FT                   /locus_tag="MTES_0410"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(422337..422342)
FT                   /gene="atpD"
FT                   /locus_tag="MTES_0411"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(422349..423248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpG"
FT                   /locus_tag="MTES_0412"
FT                   /product="F0F1-type ATP synthase, gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0412"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73376"
FT                   /db_xref="GOA:E8NAV4"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="InterPro:IPR035968"
FT                   /db_xref="UniProtKB/TrEMBL:E8NAV4"
FT                   /protein_id="BAJ73376.1"
FT                   /translation="MGAQLRVYKQKISSAQTTKKITKAMELIAASRIQKAMARVRAASP
FT                   FARAVTSAVSAVATYSSVDHPLTTERENIRRSAVVIFTSDRGLAGAFNSQILREGLELA
FT                   ELLRSQGKEVVFYLVGRKAVGYFQFRRMASVEQWVGDTDTPQFSTAEEISEAVLKAYRA
FT                   GGENDGVDEIHLVYNRFVSMMTQSPESVRLLPLEVIEADEAPAQSEIYPLYEFEPDAET
FT                   VLDALLPVYVQSRIFNALLQSSAAKHAATQKAMKSASDNADKLITDYTRLRNNARQAEI
FT                   TQQIAEIVGGADALASGK"
FT   regulatory      complement(423252..423257)
FT                   /gene="atpG"
FT                   /locus_tag="MTES_0412"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(423273..424904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpA"
FT                   /locus_tag="MTES_0413"
FT                   /product="F0F1-type ATP synthase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0413"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73377"
FT                   /db_xref="GOA:E8NAV5"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033732"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="InterPro:IPR038376"
FT                   /db_xref="UniProtKB/TrEMBL:E8NAV5"
FT                   /protein_id="BAJ73377.1"
FT                   /translation="MADLSISPDVIRDALKDFVNAYEPTGAAATEVGAVVDAADGIAHV
FT                   EGLPGVMANELIRFADGTLGLAQNLDENEVGVVVLGEFSGIEAGQSVTRTGEVLSVGVG
FT                   EGYLGRVVDPLGNPIDGLGEIATTGRRALELQAPGVMQRKSVHEPLQTGIKAIDAMIPV
FT                   GRGQRQLIIGDRQTGKTAIAIDTIINQKANWESGDVNKQVRCIYVAIGQKGSTIASVKG
FT                   ALEDAGAMEYTTIVAAPASDPAGFKYLAPYTGSAIGQHWMYEGKHVLIIFDDLSKQAEA
FT                   YRAVSLLLRRPPGREAYPGDVFYLHSRLLERCAKLSDELGAGSMTGLPIIETKANDVSA
FT                   YIPTNVISITDGQIFLQSDLFNANQRPAVDVGISVSRVGGDAQVKSIKKVSGTLKLELA
FT                   QYRSLEAFAMFASDLDAASRRQLARGARLTELLKQPQYSPYPVEEQVVSIWAGTNGKLD
FT                   SVEVSDVLRFERELLDYLRRNSTVLDTLRETNVLDDDTLAELEKKVDAFALEFQPGGDQ
FT                   SVVGAEKVDAAEAEDVNQERIVKGRR"
FT   regulatory      complement(424909..424914)
FT                   /gene="atpA"
FT                   /locus_tag="MTES_0413"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(424967..425755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0414"
FT                   /product="F0F1-type ATP synthase, delta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0414"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73378"
FT                   /db_xref="GOA:E8NAV6"
FT                   /db_xref="InterPro:IPR000711"
FT                   /db_xref="UniProtKB/TrEMBL:E8NAV6"
FT                   /protein_id="BAJ73378.1"
FT                   /translation="MGSATTQARTATAEALASTSGVDLDVARELFAAVGAVSGSAQLSG
FT                   ALSDSSVPAPARAGLVSAVFGSSYRPATVALLSSAAQQRWSNSAEFVEGLEELAVRATA
FT                   VAESADIEPELFSFSRTVAANGELELALGGRLGDASAKGALVTKLLDGRVSAGTALIVS
FT                   SLVENARGRRVRAILRRAESIVADQRARVVASVYAASPLNAEQQTRLQNALSARYGSAV
FT                   TLNTVIDPTVVGGLRVQVADDVIDASVSARLADLRQRIAG"
FT   CDS_pept        complement(425755..426333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpF"
FT                   /locus_tag="MTES_0415"
FT                   /product="F0F1-type ATP synthase, subunit b"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0415"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73379"
FT                   /db_xref="GOA:E8NAV7"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="InterPro:IPR005864"
FT                   /db_xref="InterPro:IPR028987"
FT                   /db_xref="UniProtKB/TrEMBL:E8NAV7"
FT                   /protein_id="BAJ73379.1"
FT                   /translation="MLNALVTLAAEPAGEAHNPLFPAIYDIIWSAVCFVVIVFVVWRVA
FT                   LPRMAKLLDERSAAIEGNIAKADEAQRQAEAALEQYTAQLAEARREAGEIRETANQDGR
FT                   KIVAEAKETASAEAARITAAAHSQIEAERQTALVQLRTEVGTLAVDLAGNVIGETLADD
FT                   ARANAVVDRFLAELEASETLRQAQGPVSN"
FT   regulatory      complement(425769..425774)
FT                   /locus_tag="MTES_0414"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(426339..426344)
FT                   /gene="atpF"
FT                   /locus_tag="MTES_0415"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(426369..426515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpE"
FT                   /locus_tag="MTES_0416"
FT                   /product="F0F1-type ATP synthase, subunit
FT                   c/Archaeal/vacuolar-type H+-ATPase, subunit K"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0416"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73380"
FT                   /db_xref="GOA:E8NAV8"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR005953"
FT                   /db_xref="InterPro:IPR020537"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="InterPro:IPR038662"
FT                   /db_xref="UniProtKB/TrEMBL:E8NAV8"
FT                   /protein_id="BAJ73380.1"
FT                   /translation="MGIVVGKTIEGVARQPELAGRLQVLMFIGIAFTEALAFIGIATGF
FT                   IFT"
FT   regulatory      complement(426528..426533)
FT                   /gene="atpE"
FT                   /locus_tag="MTES_0416"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(426647..427579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpB"
FT                   /locus_tag="MTES_0417"
FT                   /product="F0F1-type ATP synthase, subunit a"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0417"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73381"
FT                   /db_xref="GOA:E8NAV9"
FT                   /db_xref="InterPro:IPR000568"
FT                   /db_xref="InterPro:IPR035908"
FT                   /db_xref="UniProtKB/TrEMBL:E8NAV9"
FT                   /protein_id="BAJ73381.1"
FT                   /translation="MIGLGKYPPAPGLSLRFALWVLSPTIVATVHTDAPKLEPALTTQA
FT                   ATLITNLASAGAEFHPPSIGEFFPDAVLFEGTIFAITRINLTQMLATLVLVLFLVIGTR
FT                   RMKVVPGRFQSVVEMGLDFVRVNIAEDILGRKDGKRFLPILTTIFFMVLFMNITGVIPG
FT                   LNIAGTSVIAVPMLLALVAYVTFIYAGIKKSPGGFFKNALLPSGVPWPLYIIIVPLEFL
FT                   STFIIRPVTLTLRLLMNMVVGHLMLVLFFSATQFFVVDLSGWWTALGAGSLAFGFAFTL
FT                   FEIFVAFLQAYVFAILTAVYIQLAVAEEH"
FT   regulatory      complement(427591..427596)
FT                   /gene="atpB"
FT                   /locus_tag="MTES_0417"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(427682..428164)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0418"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0418"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73382"
FT                   /db_xref="GOA:E8NAW0"
FT                   /db_xref="UniProtKB/TrEMBL:E8NAW0"
FT                   /protein_id="BAJ73382.1"
FT                   /translation="MTSTSPARRPSSTPVLRTALVWGGIVTAVLLVVGAVVGFAVGGAS
FT                   GLGSALAGVAVSAVFLAVTATSILVANRWFGDPLYVPIFFGIVLGGWLLKLVLFIVAIV
FT                   VLREQAWVDPMTFYVALVVSVLASLVVDVVVLLRMRIPSASDVTLPTDPDEGDRRS"
FT   CDS_pept        complement(428161..429339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0419"
FT                   /product="UDP-N-acetylmuramyl pentapeptide
FT                   phosphotransferase/UDP-N-acetylglucosamine-1-phosphate
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0419"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73383"
FT                   /db_xref="GOA:E8NAW1"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="UniProtKB/TrEMBL:E8NAW1"
FT                   /protein_id="BAJ73383.1"
FT                   /translation="MTQYLLTILFTAAVTLALSWVVWKLALRFKLYPGIRDRDVHKTPT
FT                   PRLGGVAMFLGVVAAFALSSRNPYFSIFWTDPVPVLWLLGAVLLIVLIGVADDLWDLDW
FT                   MIKLGAQFVAAGMIAWFGQLQILSLPIGALTVGSSWVSFLLTVFAMVVVMNAVNFIDGL
FT                   NGLVAGVCLIANGVFFAYSYLLVRDTGASTYFNLASFIAAVLVGACLGFLPMNWTPAKL
FT                   FMGDAGALMLGLLMASSAVAITGQLDPAVLDPEKIGRSQLLGAFIPILLPVVIVLLPLL
FT                   DFGLAVIRRQWAGRSPFSPDRKHLHHRMLDMGHTDTSAVLIFYSWTAVVSLAFLLMYIG
FT                   TQQSWPGDYLAGILFGVVGVIACAVLTLLPSSHRLRRLSPRRARPTPPEPHS"
FT   regulatory      complement(428174..428179)
FT                   /locus_tag="MTES_0418"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(429336..430097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0420"
FT                   /product="putative translation factor (SUA5)"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0420"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73384"
FT                   /db_xref="GOA:E8NAW2"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR010923"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="UniProtKB/TrEMBL:E8NAW2"
FT                   /protein_id="BAJ73384.1"
FT                   /translation="MSPVYDCRDESQLLSGMRHARQAIGRGELVVLPTDTVYGIAADAF
FT                   NARAVAGLLEAKGRGRQQPPPVLVAGVGTLRALVAEIPAAVDDLVREFWPGGLTIVLPA
FT                   QPSLSWDLGDTHGTVAVRMPAHHLTLELLEETGPLAVSSANLTGMAAAVDIDSARDMLG
FT                   DSVSAYLDSGPSETGIASTIVDATTLVGGAEPRVRVLREGAVSRERLREVLGDLLEPDP
FT                   DPDAPAPIIAAPSVEAPKAESSETDAEAPGP"
FT   regulatory      complement(429347..429352)
FT                   /locus_tag="MTES_0419"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(430111..430116)
FT                   /locus_tag="MTES_0420"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(430136..431029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemK"
FT                   /locus_tag="MTES_0421"
FT                   /product="methylase of polypeptide chain release factors"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0421"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73385"
FT                   /db_xref="GOA:E8NAW3"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004556"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR019874"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR040758"
FT                   /db_xref="UniProtKB/TrEMBL:E8NAW3"
FT                   /protein_id="BAJ73385.1"
FT                   /translation="MRDTAPPSAPTAAPVAEVVRDLEARFSAAGIPDPRVDAELLVGHV
FT                   LRTSRGGVQAAAIRGDRMPPAAAADLLPLADRRCAREPLQHLTGVAPFRSLELAVGPGV
FT                   FVPRPETEMVAQLAIDALGAAAAPAPIAVDLGTGSGAIALAMATEVPHARVFAAENSVD
FT                   AFIWTKENVARVGATNVTLAFVDLADAFPELDGTVSVVASNPPYVPDDAIPRDPEVRLY
FT                   DPPAALYGGPDGLDAVRHLSRVGLRLGHPGATLVIEHGEWQGAAIRDLLTADGWRAAAT
FT                   HPDLTSRDRATTAVRP"
FT   regulatory      complement(431036..431041)
FT                   /gene="hemK"
FT                   /locus_tag="MTES_0421"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      431116..431121
FT                   /locus_tag="MTES_0422"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        431128..432066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0422"
FT                   /product="cysteine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0422"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73386"
FT                   /db_xref="GOA:E8NAW4"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005856"
FT                   /db_xref="InterPro:IPR005859"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:E8NAW4"
FT                   /protein_id="BAJ73386.1"
FT                   /translation="MPGIHSDITSAFGDTPLVRLNRVAEGTEAQILAKLEFYNPASSVK
FT                   DRLGIAIVDAAEASGELKPGGTIVESTSGNTGIALAMVGAARGYKVILTMPASMSKERR
FT                   ILLKAFGAELVLTDPTKGMSYAVDEAKRIVAETPGAVWARQFENEANPAIHRKTTAEEI
FT                   LRDTDGKVDYFVAGIGTGGTITGVGQVLKERVPGVKIVAVEPADSPILTKGHPGPHKIQ
FT                   GIGPNFVPAILDRDILDEVIDVEFDDAIRLARETAAKDGILVGMSSGAAIWAALEIAKR
FT                   PEAAGKNIVVIIPSYGERYLSTALYEHLRED"
FT   regulatory      432059..432064
FT                   /locus_tag="MTES_0423"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        432069..432638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0423"
FT                   /product="serine acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0423"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73387"
FT                   /db_xref="GOA:E8NAW5"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005881"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR042122"
FT                   /db_xref="UniProtKB/TrEMBL:E8NAW5"
FT                   /protein_id="BAJ73387.1"
FT                   /translation="MGVLSRVREDISSAKLRDPAARGGIEIALLYPGLHAVWSYRIANR
FT                   LWRRGLRFPARALSQLTRWLTGIEIHPGATIGRRFFIDHGMGVVIGETAEVGDDVMLYH
FT                   GVTLGGRQREGGKRHPTLHDGVAVGAGAKVLGPITIGARAVIGANAVVTRDAPADSVLV
FT                   GVPAKARSRRVGEETRALLMAPEYSI"
FT   regulatory      432664..432669
FT                   /locus_tag="MTES_0424"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        432676..434079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0424"
FT                   /product="Asp-tRNAAsn/Glu-tRNAGln amidotransferase A
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0424"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73388"
FT                   /db_xref="GOA:E8NAW6"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:E8NAW6"
FT                   /protein_id="BAJ73388.1"
FT                   /translation="MTRLHDLSLAAQVGALRAGTLSPVDLTEHYLGRIARFADLGAFAE
FT                   VTPDAARRRSALLQESPAHGALWGIPLADKDLVARAGVPTRYGSRSRAGLVPTASDPLA
FT                   DALDAAGAVNVGKTSTSEFGLTGFTEPLIHAPARDPWRLSAGAGGSSGGAAVAVAAGLL
FT                   PAAVGSDGGGSIRIPSATVGVVGLKPSRGRLPIGSGFDSPDGLSVTGPIARTVEDAALL
FT                   LDALVGLAPFAYATAAPGHGPFIDATARDPRGLRIGVTTVSPWDDDEDIRLDADARTAF
FT                   ETAAAWLSDTGHEVTDTAWHPFGYAALFHVLWRASAARIPLSEDDMSLVEPLTAWLVRE
FT                   GRRLSSLDLLDGLAAARAFERRTIADFARFDAVLTPALAQPPQPIGSYAGHTPERTFAM
FT                   QVEYAPYSSFVNVAGLPALTLPVTTDATGHPVSVQLIGRPGGEATLLSIAAQLEERRGP
FT                   LPHPPAWDA"
FT   CDS_pept        complement(434099..435205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prfA"
FT                   /locus_tag="MTES_0425"
FT                   /product="protein chain release factor A"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0425"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73389"
FT                   /db_xref="GOA:E8NAW7"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004373"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/TrEMBL:E8NAW7"
FT                   /protein_id="BAJ73389.1"
FT                   /translation="MSAEPAEASGIFESVRGLIDEHREIELELNDPAVHADAARAKRVN
FT                   RRYAELNRIVHAYQAWVSASDDLEAARELAREDEAFAAEIPALEERVSETQERLRRLLI
FT                   PRDPDDARDVIMEIKGGEGGAESALFAADLLRMYLQYAASMGWKTELLERTESDLGGYK
FT                   DVQVAIKGSSSDPAQGVWAHLKYEGGVHRVQRVPATESQGRIHTSTTGVLVFPEVDEPE
FT                   EVAIDPNDLKIDVFRSSGPGGQSVNTTDSAVRITHVPTGIVVSMQNEKSQLQNREAGMR
FT                   VLRARLLAKQQEERDAVAADARRSQIRGMDRSERIRTYNFPENRIADHRTGYKAYNLDQ
FT                   VMDGALGPIIESAITADEEARLAALAGD"
FT   CDS_pept        complement(435209..437350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rho"
FT                   /locus_tag="MTES_0426"
FT                   /product="transcription termination factor"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0426"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73390"
FT                   /db_xref="GOA:E8NAW8"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004665"
FT                   /db_xref="InterPro:IPR011113"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041703"
FT                   /db_xref="UniProtKB/TrEMBL:E8NAW8"
FT                   /protein_id="BAJ73390.1"
FT                   /translation="MESISETQPVDAPEGAEIPAEELSAEAQGTDTDQAEAAVETPDAE
FT                   GVDASDTEAAPADAAQPEALFTDDTLTAEVPAVEEPAADTPAAEASTEPAAEPAADEPA
FT                   VAEKPVKAPRKRAPRRATTASAKEKAAAEAAAAEAAASAEAEATPEAEAAPEAVVAPEA
FT                   TTPVTTAADVADDAAATEETPAVNEAEATPAEDAASVDAAAPEDAASEETASEDTASET
FT                   ASDAAETPATDDTADETPARGRGRNRSRNRNRNKPDAADKPEAQPATGGDEAEAPQQGG
FT                   QRDGGSQNGQQAQQQGGTSNRNRQRNKRRGPNTTGDEFDSEISEDDVLVPIAGILDVLD
FT                   NYAFVRTTGYLPGPSDVYVSLGQVKKYNLRKGDAVVGSIKQPRENEQSSRQKYNALVKV
FT                   DSINGLSVDDAATRVEFNNLTPLYPQERLRLETGPEKLTQRIIDLVAPVGKGQRGLIVA
FT                   PPKAGKTIVLQQIANAIAHNNPEVHLMVVLVDERPEEVTDMQRTVKGEVIASTFDRPAE
FT                   DHTTVAELAIERAKRLVELGRDVVVLLDSITRLGRAYNLSAPTSGRVLTGGVDASALYP
FT                   PKRFFGAARNIENGGSLTILATALVETGSKMDDVIFEEFKGTGNSELRLSRQLADKRIF
FT                   PAVDVNASSTRREEMLLSPDEVKITWKLRRALAGLEPQQALEVVLGKLKETQSNVEFLV
FT                   QMQKSIPAPSRGGDDNSIR"
FT   regulatory      complement(435217..435222)
FT                   /gene="prfA"
FT                   /locus_tag="MTES_0425"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(437357..437362)
FT                   /gene="rho"
FT                   /locus_tag="MTES_0426"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(437504..438436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrB"
FT                   /locus_tag="MTES_0427"
FT                   /product="homoserine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0427"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73391"
FT                   /db_xref="GOA:E8NAW9"
FT                   /db_xref="InterPro:IPR000870"
FT                   /db_xref="InterPro:IPR006203"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:E8NAW9"
FT                   /protein_id="BAJ73391.1"
FT                   /translation="MSSGPGRRVAVRVPATSANLGPGFDTLGLALSVYDELVVEQLDGD
FT                   RLEIEVEGEGTADVPRDASHLVVRAMAHTYASVGRTLPGLRLTAHNVIPHGRGMGSSGA
FT                   AVVAGILAAKGLLEGEVAFTDVDLLRLATELEGHPDNVAPGLFGGLTIAWMDAEGPQHK
FT                   QLIVHRGVSPLVFVPSFTMSTAVARSLQPLQVPREDAVFNVSRSALLIAAMTQSPELLM
FT                   AATEDKLHQNYRAQAMPETDRLVRALRAAGYAAVVSGAGPSVLVLADGPGQRLAAADLM
FT                   ASVVDTPWQALMLAVDVKGGTVKNAEGSA"
FT   CDS_pept        complement(438433..439515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrC"
FT                   /locus_tag="MTES_0428"
FT                   /product="threonine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0428"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73392"
FT                   /db_xref="GOA:E8NAX0"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR004450"
FT                   /db_xref="InterPro:IPR026260"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:E8NAX0"
FT                   /protein_id="BAJ73392.1"
FT                   /translation="MAHLWGGVLREYADRLGVTDASTVVTLGEGGTPLLPAPALSRRTG
FT                   ADVWVKYEGMNPTGSFKDRGMTVALSRAVEHGAKAVICASTGNTSASAAAYAAHAGITA
FT                   AVLVPEGKIAMGKLSQAVAHNGRLIQIRGNFDDCLEIARELADHYPVHLVNSVNPDRIE
FT                   GQKTAAYEVVEVLGDAPDFHFIPVGNAGNYTAYSRGYREEAARGVATRVPRMFGFQAAG
FT                   SAPLVRGEVVKNPETIASAIRIGNPASWELALEARDATDGYFGAIDDARILEAQKILAG
FT                   EVGIFVEPASAISVAGLLERAEAGVVPAGAKVVLTVTGHGLKDPQWALRQSDGTDVTPT
FT                   VVDATTSEVASVLDLQPVTA"
FT   regulatory      complement(438443..438448)
FT                   /gene="thrB"
FT                   /locus_tag="MTES_0427"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(439518..440840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0429"
FT                   /product="homoserine dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0429"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73393"
FT                   /db_xref="GOA:E8NAX1"
FT                   /db_xref="InterPro:IPR001342"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005106"
FT                   /db_xref="InterPro:IPR016204"
FT                   /db_xref="InterPro:IPR019811"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E8NAX1"
FT                   /protein_id="BAJ73393.1"
FT                   /translation="MTDYRTLRVALLGAGAVGSQVADLLLKHGDELADRAGAKLELAGI
FT                   AVRNLDAKRDADLPQELFTTDAETLIVGSDIVIELMGGIEPARTQVLHAIASGADVVTA
FT                   NKALLATHGSEVFEAADQVGAEVYYEAAAAGAIPIIRPLRDSLAGDRVVRIMGIVNGTT
FT                   NYILDRMDTEGADFADVLAQAQALGYAEADPTADVEGYDAAQKAAILASLAFHTTVPLD
FT                   AVHREGITSVDAAMIESARHAGYVIKLLAVCERLTAADGAESISVRVYPALVDRTHPLA
FT                   SVHGANNAVFVQAEAAGDLMFYGAGAGGVQTASAVLGDVVSAARRHIAGGVGVGESTRA
FT                   NLPAVPIGHVITRYQITLEVDDKPGVLATVAGILSEGRVSIATVEQTVIEADEKTQTGG
FT                   SARLVIGTHKAREQDLSETVERLAASGVVERVVSVLRVEGN"
FT   regulatory      complement(439523..439528)
FT                   /gene="thrC"
FT                   /locus_tag="MTES_0428"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(440837..442267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysA"
FT                   /locus_tag="MTES_0430"
FT                   /product="diaminopimelate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0430"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73394"
FT                   /db_xref="GOA:E8NAX2"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002986"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR022653"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:E8NAX2"
FT                   /protein_id="BAJ73394.1"
FT                   /translation="MSASHSALVPEWLTAPAEANELVAPVWPASARRVDDGSVEIGGVS
FT                   VFDLRDRFGTPLYVLDEDEVRTHARRARAAFDSAAERHGIRARVYYAGKAFLSTEVVRW
FT                   VVDEGLAVDVCTRGELEVALAAGADPARLGFHGNNKSVGELERAVEVGIGSVVIDSPIE
FT                   IERLAAIADRRGVVQSVLVRVRTGVHAETHAFLATAHEDQKFGFSLEGAAEAVARIREL
FT                   PSLRFVGLHAHIGSQIFDSSGFRESAARLVDLHADLLAGGEIPVLNVGGGFGISYTSVD
FT                   DPKPIEEIADGILDAIADECAVRGIPMPDVATEPGRVIVGQAGVTLYEVGTVKTVTATE
FT                   NLERTYVSVDGGMSDNARPALYGADFSARVVSRTSSATPALSRVVGRHCESGDIVVDAE
FT                   YLPADVTPGDLLAVPATGAYCFSLASNYNYTPRPPVVAVRDGQARVIVRGETVDDLLSR
FT                   DAGIPASVSTDTPHGDTE"
FT   regulatory      complement(440848..440853)
FT                   /locus_tag="MTES_0429"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(442275..442280)
FT                   /gene="lysA"
FT                   /locus_tag="MTES_0430"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(442592..448192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0431"
FT                   /product="alpha-tubulin suppressor"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0431"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73395"
FT                   /db_xref="InterPro:IPR000408"
FT                   /db_xref="InterPro:IPR003344"
FT                   /db_xref="InterPro:IPR006624"
FT                   /db_xref="InterPro:IPR008964"
FT                   /db_xref="InterPro:IPR009091"
FT                   /db_xref="UniProtKB/TrEMBL:E8NAX3"
FT                   /protein_id="BAJ73395.1"
FT                   /translation="MSLASATPAFANGSSVSNMTIAGPASGVPASAAVPMTVTVKDSQG
FT                   QPQAGQPVSFSGPDGATFSASDGVTNGAGRYTTNFNLNKPWATPGSTVTVAAVSGSSNA
FT                   SQSFGVLGANVLGWGSGLFGMAGLGTTDNAPTPRQVMQVFPSPVVQVAQGGYNFTLFRL
FT                   SNGDVWGVGRNGDGQLADGTTTDRYWPPQQIAGLSNVVDIAAGYSTGYAVMPDGTVRSW
FT                   GSNYESALGDGTTYAQKSFSTSVVTVSGVSNAARVAGGSWFGLALLKDATVMGWGRNGA
FT                   GQLGDTTNQNRPTAVSVSGVSDVIQVAATSVAGYALRTDGSIMAWGGNWKGQQGDGSTQ
FT                   SGNHYTPTPVVGVSNAASIAAASQTGYALLADKTVVAWGDGENGELGNGASAASPSVVA
FT                   VQGLSDVANIGSGYALKTDGTVWAWGPNDKGQLGNGSSASNSNVPVQVSLPAGIPVTAI
FT                   GGSADGGARFAISGELTLNVDVVETEVAAGTAGTVTATVSSGSSGVGGAEVSLTSSGNA
FT                   VLGASLGQTNAAGVFQTSVTPDRWTVPGAQLQVRASTDAASSVDGYTVLGANALGFGRD
FT                   TGSELGDNGAAGPQSGTSSISRVTPSQLTCIFPSPIVQMVSTGYSADSYYSYNASFVLL
FT                   RDGSVWAIGGNSHGQIGDGVANYHTSWTQIPGVENVKQITAGNQTVLALLSDGTVIGWG
FT                   DNYFGQIGTNTAAQGRAYTPVAIPGLSNVAQISSSSQNSFFLLKDKTVWALGRGGAGLG
FT                   TGNANEPDASTPVQVSGLTDVIQVAGTYALKSDGTVWSWGGNYSGALGQGTNPVPPRWS
FT                   QGVPDYSSATPAKVVGLSGKTVTSISSYGGGALALTSDGAVYAWGDGQSGTIGDGGSVS
FT                   RSSATAVSGLTSGVTLISSSGLSGYALKSDGTLVAWGDNSCGQLGDGTTTNRATPVSVT
FT                   GLDGLAVTGLMTYSPVTFRMFALSSPTSISVDVADTQVAAGVASAVQAKVATGSKGVAG
FT                   AAVTLAATDNAAIAATSGATDSSGVFQTTVTPDRWTTPGDVVRVTASANSGSAQDTFLV
FT                   LGANMLASGFDGQGHLGIDNSGSTPLMPVQVNRAFPSPVVQVSSGAVHAMALLRDGSVW
FT                   TAGLYDYGRLGRSTSTVPGTQWGQVPGLSGVTQIAAGWNNSYALLSDGTVMAWGWNIWG
FT                   QCGDGTNTDRYSPVAVIGLPKKVISLVAGRVNGLVVLEDNTAMAWGASNASGQLGNGST
FT                   SNSSTPVVISNISGVVKLAGGNDTHSALLSDGSVWAWGANANGQVGDGTTVTRLTPVKL
FT                   SGVTGVKDIARGGDAGYAQLSDGSISGWGSNAYGQVGDGSTTDRWSPVPVSGLSNVVQL
FT                   AGGYYNGYALQSDGSAKAWGRNDAGQLGNNSSTQSASPVTVQGLNGKPVTSLATGARME
FT                   APLFVIGQSTVAVDVASPAIAGSANQVTATVSTGSTPVEGAAVSLTASGAAVLAASSGQ
FT                   TNSSGQLVTTVTPDVWTRPGASLSVTAANGSSTAADVYTVIGSNLMHAGYGLWGAGGDG
FT                   TNNNATTATQTSRAFSSPVVQAYSGFIFGVALLADGSVWSVGRNDYGQLGDPSVPVYDG
FT                   SNGSAGRATWGRVPNLPANVVQITGGRATVYALTADGTVYAWGWNANGQIGNGTTTDQS
FT                   SPLKVPGLSGVKRLGGAYRSCFAIMGDGSVKAWGKNDGGSLGDGTTTQRLSPVSVSAWG
FT                   TVSDIGGDHQQTAALRTDGTVWACSAVSGTLGNGDGATSASPVQVAGLANVQALAVGFG
FT                   FFHVLQADGTVAGWGANDVGQIGNGGSSTVLSPTAVSGLGGVARIAARWGGGYATLGNG
FT                   QVWGWGKNDSGQLGDGTTTNRPTPVQMGGLGSRSVARLDAGVSAEGCFLVV"
FT   regulatory      complement(448199..448204)
FT                   /locus_tag="MTES_0431"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(448626..450818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0432"
FT                   /product="Ni,Fe-hydrogenase III small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0432"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73396"
FT                   /db_xref="UniProtKB/TrEMBL:E8NAX4"
FT                   /protein_id="BAJ73396.1"
FT                   /translation="MTVSADSHSDIDRKADRSEAGGWAVRRRTVVAGAAWGLPVIMIAT
FT                   AAPAYAAASQTVNLAFDKVQYVATGCQPITGATVTATNRTDGRPVAGLSISVTLPRGFS
FT                   YPTGATTYTGTTNASGVVALPDIVTPSTGGTVTLTAVAATVSTSASASVTVNLNTQATL
FT                   ALGTSVSKTYASAAGGVSVGNRHFLTASGDLFFENTKIASGVASAAGWFTTNWAKGVCF
FT                   VLSSGGAKQAQFGSIVDSYPAVPVGSKAVGGVGFLAPNGDLYYGNTVLATGVVTAWGYR
FT                   ITATGEAIDFVGSDGVPKRILNGAVDKTYSAIPTSVPNPGTSVGNRHFLTASGDLFFEN
FT                   TKIASGVASAAGWFTTNWAKGVCFVLSSGGAKQAQFGSIVDSYPAVPVGSKAVGGVGFL
FT                   APNGDLYYGNTVLATGVVTAWGYRITATGEAIDFVGSDGVPKRILNGAVDKTYSAIPTS
FT                   KAIKPVGQSYFIAANGDLYRDATKLASNVVAARAWVNAAWTYQADFVTSDGKLFTTDGT
FT                   NVGSAGTAAAGAATLPVGAGYFLTAAGALYLWDTLVTSNVTSAYGLAGNPGAGEGSEGS
FT                   FVTSDAKSWLALGSAAPTQYASVPVESVVKAAKPVGQSYFIAANGDLYRDATKLASNVV
FT                   AARAWVNAAWTYQADFVTSDGKLFTTDGTNVGSAGTAAAGAATLPVGAGYFLTAAGALY
FT                   LWDTLVTSNVTSAYGLAGNPGAGEGSEGSYAVQVAC"
FT   regulatory      complement(450826..450831)
FT                   /locus_tag="MTES_0432"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      451105..451110
FT                   /locus_tag="MTES_0433"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        451116..452294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0433"
FT                   /product="AraC-type DNA-binding domain-containing proteins"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0433"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73397"
FT                   /db_xref="GOA:E8NAX5"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:E8NAX5"
FT                   /protein_id="BAJ73397.1"
FT                   /translation="MPSTVLEDQTMTAPLEPSAVTIERRVHRRGSHAYEWLRQRGWGAE
FT                   GGLRSDAMIHADELRTSSVVARRLRTSALGLQSLAANTNHAFFVLQIEGSTDVLFRDGS
FT                   VSRVGPLGFLSCALRDVAAIRSHGPVRRIEVIAVLPLFISTSASSSAHVPHPSAPGGLG
FT                   TGLPPPPPPPPAWALVTSVVDVILGSTLTSDSAAVAPLEASLLHALTALMVEARGGVTA
FT                   QRATLLSRAQDIIRRRVTQSDFTVEQLAASLNVSSRYLTQIFREAGTSPGRAIRAARLS
FT                   QAQLVLHGGASSDPAVVARAAGFSSVRAMKEAFRRAGQPLPLPAAVRTPPVAGQITTTS
FT                   PRRTNREAADRCDLDGVCRLSSRVDRRPPSAARGRASHDEASVPDRHVLRGG"
FT   CDS_pept        complement(452244..454541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0434"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0434"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73398"
FT                   /db_xref="InterPro:IPR008964"
FT                   /db_xref="InterPro:IPR031161"
FT                   /db_xref="InterPro:IPR042279"
FT                   /db_xref="UniProtKB/TrEMBL:E8NAX6"
FT                   /protein_id="BAJ73398.1"
FT                   /translation="MTLDATRRSVLAAGAWALPVMGSAVLVPSSVASPTGTLTVVTERS
FT                   RLYPDEATTVRVTRSDDAGRPRPGDPVTLTLDDPSRGVIDQPSGVTDGAGVYETSLRIR
FT                   SDAASGIGTLTGSSAASVASATFEVRPVAVVMHAADGASTRVIALSHGSQDEVMTLENR
FT                   GFAHSDLQPTGRHVSRGEVIDVVVDADAPATLSLFIGARGPWRGFNSGQTTDLQTVSLS
FT                   RGQQSVAAAQDGIVFVRNTSSETAAEVSLSGGSPHPVWVKNRTTATEFADQLAAWTSAP
FT                   VVSLVGDRVVVDVQRRVVDDLGTRGVSWDPADVVLRLDRVLSYTCDVYGLTYAAVGIAH
FT                   KYPGRVYFSGPDSGAGWAFATNQWLCFQVDTGASEALLTTPDNWGTWHEVGHTFQTPAY
FT                   TWSGLGEVTVNISSLALQQRLTGEHRLDQWPEAKDRITRYFSQAVGDRSFSQLTDEDPF
FT                   YPLFLFDQLRQSFGEGFYPAVSQAYRVRRIRGLAMPSTDQEKKDLFAQIASQVADRDLG
FT                   PFFTAWGVPIAASVLSSLGTYPALQNQIWTAIDSRDAHRERTVGYNLPVGVLSARNVTL
FT                   YLGEATSSVGDVSGLSTLDGSPSSVAGRESSAANVGPREGRVLALLRAPDATPEALWRT
FT                   VPVTVTSALEFVGIYDIRAGWIGMSKDGKRLVVTSTGVAPHDYYFRGKLYYQVILQNAA
FT                   RQTLVSVTVNGDDTHDKVVAALNGVAVSSGYRLRVNAAEPSRVRIYQDGERVGTLSSTP
FT                   QNVSIRNGRFVV"
FT   regulatory      complement(454553..454558)
FT                   /locus_tag="MTES_0434"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(454672..455445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0435"
FT                   /product="protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0435"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73399"
FT                   /db_xref="InterPro:IPR021373"
FT                   /db_xref="UniProtKB/TrEMBL:E8NAX7"
FT                   /protein_id="BAJ73399.1"
FT                   /translation="MTDATAPRPRKTGRWIAILIVVLVLVGGAVVAAEFIARSVVASTV
FT                   RSLVVKNVGLPEDQNVDVSVAGIVLPQLLGGRLDDVTITSNDVTLGPITGDVRVEMQGV
FT                   PTSGGTAADGGTASVRLDQDQLRTLLSQIPGFPSGTVQMAAPDLTLTNELSVFGVGIPV
FT                   GVSVTPGASNGDLTLTPAGFELGGNRIDADTLRAQFGGVADSILGTQSLCIADRLPAAL
FT                   TLTSATVQGQDLVAGFTIDGGVLNDPALQRDGSCG"
FT   CDS_pept        complement(455450..457114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argS"
FT                   /locus_tag="MTES_0436"
FT                   /product="arginyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0436"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73400"
FT                   /db_xref="GOA:E8NAX8"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/TrEMBL:E8NAX8"
FT                   /protein_id="BAJ73400.1"
FT                   /translation="MDPAALSAALLAVIAPLAEARREGSSAGLSAADLPLERPKNRDHG
FT                   DWASNAAMKLAKVVGANPREFAAEIAAGLESVDGIASVEVAGPGFINIRLDAAAAGALA
FT                   KVIVEQGEAFGTNDSRADEVINLEFVSANPTGPIHLGGTRWAALGDALARILSAQGAQV
FT                   TREYYFNDHGAQIDRFARSLVAAHQGDPTPEDGYGGAYIGDIAKRVAEAYDGDVDALDA
FT                   DAKQEAFRELGVNFMFDEIKQSLHEFGVDFDVYFHENDLHNSGAVERAVARLRELGHIF
FT                   EADGATWLRSTEFGDDKDRVIIKSDGQPAYISGDLAYYLDKRERGFNRCIIMLGADHHG
FT                   YVQRLMAMCAAFGDEPNVNLQVLIGQMVNLVRDGQPMRMSKRAGTVVTLEDLVEIVGVD
FT                   AARYALTRSSADSNLDIDLDVLQKRTNDNPVFYVQYAHARTHNVARNAAASGVDRSEFA
FT                   PELLDHESESALLGALQEYPRIVAHAADVREPHRVARYLEELAGLYHRWYDNCRVIPLS
FT                   DAPVETVHRTRLWLNDATGQVLRNGLTLLGVSAPERM"
FT   regulatory      complement(455455..455460)
FT                   /locus_tag="MTES_0435"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(457124..457129)
FT                   /gene="argS"
FT                   /locus_tag="MTES_0436"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(457154..457963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0437"
FT                   /product="transglutaminase-like enzyme, putative cysteine
FT                   protease"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0437"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73401"
FT                   /db_xref="GOA:E8NAX9"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:E8NAX9"
FT                   /protein_id="BAJ73401.1"
FT                   /translation="MPRRVTAELDLDLGASVDLIFQITAAQGVPLASESLTFSQGDRLY
FT                   TPTEIVDQSGSRLHRLTAEQGPLAVRYDAVVQGASQTPRTSDLETITYLRPSRYCQSDE
FT                   VFAQARRQFRGLAGVELLAAVSNFVATTVTYTPGLSLGTDSAVTTLMTGQGVCRDYAHV
FT                   VIALLRAMDMPARYAACFAPGLEPMDFHAVAEAYLDGAWYVVDATRLADRRSLVRIATG
FT                   RDAADCAFLSYHGGYVGLERLHVDAVLENEIPDATPPDDHEALVQIA"
FT   regulatory      complement(457969..457974)
FT                   /locus_tag="MTES_0437"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(458018..458521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0438"
FT                   /product="DNA polymerase III, gamma/tau subunits"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0438"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73402"
FT                   /db_xref="UniProtKB/TrEMBL:E8NAY0"
FT                   /protein_id="BAJ73402.1"
FT                   /translation="MRRRILLPAGLPLAATLALTGCTPPEAQPTAWQSTVQMVANQASA
FT                   GDYASALSTLDALEAEVVSRRDAGTLSAGDADGILSRIAAVRADLSSLTPTPTPTPTPT
FT                   PTPTPTAEPMPDEQPTISEDGGADDEEPANPGDQGPGGNGKGKGPGKDDQGPGSGGGPG
FT                   KKDG"
FT   CDS_pept        complement(458518..459648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0439"
FT                   /product="serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0439"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73403"
FT                   /db_xref="GOA:E8NAY1"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:E8NAY1"
FT                   /protein_id="BAJ73403.1"
FT                   /translation="MTESMPTAPYDAPVDDLFDGRYRLGRVLGRGGYARVYEAVDTSLG
FT                   RTVALKVIDGEGADPEDAARVRSEIRLLASLSHPSLVTLYDARLASTPAYLSMELIAGP
FT                   TLADLIARGPIAEPDVARTGAEIAEAFAVIHSRGIVHRDVKPSNILVRPGAHAGETPRA
FT                   TLADFGIASLVGSTRLTKAETVVGTAAYLSPEQARGMPAAPASDVYSLGLVLLEALTGR
FT                   RPFAGRTPHEALAARLVAAPDIPAHLPGPWRDVLERMTATNPAERPDAAGLIAALRPLA
FT                   GHTGAGASVPSGGGATRTRVLPKETTPTRVLEKERPRRSRRMLVVASVLAVLLVGGGIA
FT                   TAVALAGSPSSAAPDLPALPSPLDQHLGELWTEVGP"
FT   regulatory      complement(458530..458535)
FT                   /locus_tag="MTES_0438"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(459654..459659)
FT                   /locus_tag="MTES_0439"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(459683..459937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0440"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73404"
FT                   /db_xref="GOA:E8NAY2"
FT                   /db_xref="UniProtKB/TrEMBL:E8NAY2"
FT                   /protein_id="BAJ73404.1"
FT                   /translation="MSIGAGIALFVIGAILAFAVNLPNDFVNLSMIGYIMMGAGFVVFV
FT                   IGIVLLARRRQTDTVTRTEGAGGAQVTRSTTRSSNDDLV"
FT   regulatory      complement(459944..459949)
FT                   /locus_tag="MTES_0440"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      460111..460116
FT                   /locus_tag="MTES_0441"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        460122..461231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0441"
FT                   /product="ABC-type sugar transport systems, ATPase
FT                   components"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0441"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73405"
FT                   /db_xref="GOA:E8NAY3"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E8NAY3"
FT                   /protein_id="BAJ73405.1"
FT                   /translation="MIPRAAGDHPLDVDALGVSIRIDDSGLPPVDREHLAEAWSGARST
FT                   TERSPAGIVTPRPSFHFDDTVADITTQVTLAALAARRGGLWMVHAGAVADEDGRVVMFS
FT                   GRSGMGKTTLMSRLAREFAYVTDESVGIDAEGDVLPYRKPLSIIDDRARAKRQVSPDRL
FT                   GLLPLPDVPLRLHAIVVLDRTEVDTPARLGALDVADALGALAPQCSYLSDLQAPLQTIV
FT                   GHIERVGGALRLRYREAEDTIGLVRAVFAEARGAFPASVAPQAVTPARGKEGFARTPVL
FT                   DAVALGEDRLALLRRAAPDETAVHIIDGVGPSLWQAADGVSFDELVAAAVRRHGAPVEG
FT                   DASDAVRAAVEALCSAGLLEERPGTRRAR"
FT   tRNA            complement(461333..461405)
FT                   /locus_tag="MTES_t002"
FT                   /product="tRNA-Arg"
FT   CDS_pept        complement(461752..462255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0442"
FT                   /product="predicted HKD family nuclease"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0442"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73406"
FT                   /db_xref="UniProtKB/TrEMBL:E8NAY4"
FT                   /protein_id="BAJ73406.1"
FT                   /translation="MPPSDAGVTLGGREAGGRMGERKFEWGGLSADRADYVTAAEALAM
FT                   LEVLAIAHTDLQITTELRDGAARARFARGQRWAVVSTPGSRWFSVETDTGHRTQLVDAT
FT                   SSKDESARLLAVYVDIAEAYVRGDAEPTRAGVFGGTTVTVDVNGRPVVLAPSLGRRVKG
FT                   LFGR"
FT   regulatory      complement(462262..462267)
FT                   /locus_tag="MTES_0442"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      462292..462297
FT                   /locus_tag="MTES_0443"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        462304..462699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0443"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0443"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73407"
FT                   /db_xref="GOA:E8NAY5"
FT                   /db_xref="UniProtKB/TrEMBL:E8NAY5"
FT                   /protein_id="BAJ73407.1"
FT                   /translation="MHTSSPYSITDQTSIFALSATNSLIGLAVYVLLVVALWRVFTKAG
FT                   YPGWLAIIPIVNLVFLTKIAGFSGWFALLYLIPIVGFVFYIIVSIRVGRAFGHGWFFSI
FT                   VLLVLLHVIGYLILAFSSDTYRAERIR"
FT   CDS_pept        complement(462781..463050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0444"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0444"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73408"
FT                   /db_xref="UniProtKB/TrEMBL:E8NAY6"
FT                   /protein_id="BAJ73408.1"
FT                   /translation="MSAASARERQRTAIRAAQARLAAFITSTAGDVEDAARDAEAALRT
FT                   AVSSGAGLERVSAELELSPRALRAILEGSVRLRSLHPDDGLRPA"
FT   regulatory      complement(463056..463061)
FT                   /locus_tag="MTES_0444"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(463254..463883)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0445"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0445"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73409"
FT                   /db_xref="GOA:E8NAY7"
FT                   /db_xref="UniProtKB/TrEMBL:E8NAY7"
FT                   /protein_id="BAJ73409.1"
FT                   /translation="MRARTRTWRTGGILLGVAGVLTLLAGQYMVNAFALRLVIDLVWAA
FT                   GVVVFAVGFSRDASVVARRPLGMTALVIAAATPLVSDGVMTALPDAFSADDPVIAAISV
FT                   VSWGGWIVSAAAGLVAAVQIARLGAVPPRWRWMPMWALCLTVGAAAVQYITVSVLFGAG
FT                   AGQDVLVVANMIGVVSALAPTLGLGVVALVAAASERPDSVDIYRSA"
FT   regulatory      complement(463892..463897)
FT                   /locus_tag="MTES_0445"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(463955..465124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0446"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0446"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73410"
FT                   /db_xref="GOA:E8NAY8"
FT                   /db_xref="InterPro:IPR001233"
FT                   /db_xref="InterPro:IPR036025"
FT                   /db_xref="UniProtKB/TrEMBL:E8NAY8"
FT                   /protein_id="BAJ73410.1"
FT                   /translation="MQKLTERLVSWASLIDDKTIEQARTSSRMPFIHPHLALMPDAHLG
FT                   LGATVGSVIPTLGAIMPAAVGVDIGCGMIAVKTQFHASDLDGRDLAELRQQIERAIPLS
FT                   AGRDNRKIVATAEPRVAELEALAEKAEFDPGTYAGHWRHQLGSLGSGNHFIEISLDEND
FT                   DVWMFLHSGSRGVGNRIAQHHIKVAQRLAKQWWIELPHPDLAYLVEGTPEFTRYIRELR
FT                   WAQHFALLNREEMMDRVANQLGRFLDTPVEERERINCHHNFTESERHFGKQVWVSRKGA
FT                   IMADAGRPGLIPGSMGTASYVVEGLGNPLALNSSPHGAGREYSRSAARKTFTHEQLREA
FT                   MVGIEYRDTDAFIDEIPQAYKPIDRVMADAADLVTVRHTLRQIVNVKGD"
FT   regulatory      complement(465128..465133)
FT                   /locus_tag="MTES_0446"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(465471..465818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0447"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0447"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73411"
FT                   /db_xref="UniProtKB/TrEMBL:E8NAY9"
FT                   /protein_id="BAJ73411.1"
FT                   /translation="MTYAGETVMTTDDVASSLIELTAAVAKEGQAEAVSIPIVTGDKKV
FT                   AQAELVIGVGNDVLSAPVEWDDEEPDFSSAAKELKDHRLYPHTQLRMVEPDPDVDDDGA
FT                   IDWDFDQPTQA"
FT   regulatory      complement(465827..465832)
FT                   /locus_tag="MTES_0447"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(465899..466078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0448"
FT                   /product="glycerol kinase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0448"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73412"
FT                   /db_xref="GOA:E8NAZ0"
FT                   /db_xref="UniProtKB/TrEMBL:E8NAZ0"
FT                   /protein_id="BAJ73412.1"
FT                   /translation="MIYVLVGGPRDGQHVDDLPRGYRLSLADPPPEPFGEFETVRAVWF
FT                   ELDEAMFRSAQRRD"
FT   CDS_pept        complement(466075..466617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0449"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0449"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73413"
FT                   /db_xref="GOA:E8NAZ1"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E8NAZ1"
FT                   /protein_id="BAJ73413.1"
FT                   /translation="MTDVDLANPGATATESSYWYGETVSDRRQRHKAVLEALRIYRAAE
FT                   VAMRRRTRDSMSMGENELLVLRYLLRDTSGGVRPGELTRYLGLSTASTTALLDRLERSG
FT                   HIVRVANPGDRRSVFIQSTPRADAEVRQTLGNMHGRMLAAVVDMTPEESAVVVAFLRRM
FT                   SDAVDGVAIEGAADESS"
FT   regulatory      complement(466083..466088)
FT                   /locus_tag="MTES_0448"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(466623..466628)
FT                   /locus_tag="MTES_0449"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      466718..466723
FT                   /locus_tag="MTES_0450"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        466731..467111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0450"
FT                   /product="ABC-type dipeptide/oligopeptide/nickel transport
FT                   systems, permease components"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0450"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73414"
FT                   /db_xref="GOA:E8NAZ2"
FT                   /db_xref="UniProtKB/TrEMBL:E8NAZ2"
FT                   /protein_id="BAJ73414.1"
FT                   /translation="MGTVTHRSSAESVMIADRPAPSVATPSARTMWAKVDTGFWVAHRA
FT                   GEYFGCVDEVAGGYVSRDAHGIPIGRYDGLEEAKASLRSTTHPLNVARRRRAERVSLAA
FT                   ATAVGVTALGFALTAGALAPFL"
FT   regulatory      467296..467301
FT                   /locus_tag="MTES_0451"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        467307..467456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0451"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0451"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73415"
FT                   /db_xref="UniProtKB/TrEMBL:E8NAZ3"
FT                   /protein_id="BAJ73415.1"
FT                   /translation="MTNHDGRADDAPDQDSNGAGSESPEEGAAAQQDADEAATTSDSPT
FT                   GDIS"
FT   CDS_pept        complement(467463..468533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0452"
FT                   /product="DNA repair photolyase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0452"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73416"
FT                   /db_xref="GOA:E8NAZ4"
FT                   /db_xref="InterPro:IPR023805"
FT                   /db_xref="UniProtKB/TrEMBL:E8NAZ4"
FT                   /protein_id="BAJ73416.1"
FT                   /translation="MAVDRENLLRVTRIYAEDAALELERGREIVARWPDADIVPVASHW
FT                   QIPEVHGDETNVARWVRIKTEALVLGVKKSVTTRVNGRSADFIAPSLSNGCAMACSYCY
FT                   VPRRKGYSNPITVFANIEQIAKHLARHVAARGPKTEPNQCDPEAWVYDIGENGDCSVDA
FT                   MISENVRDICDLFRMTPTAKASFATKFVNRDLLAWDPAGRTRIRFSLMPAATARVTDLR
FT                   TSPMSERIAAINDFVDAGYEVHVNFSPVILTPTWLADWAELFDEIDAILHPRAKAQLAC
FT                   EVIFLTHNEALHEVNLGWHPRGEDLLWTPTEQEQKRSQNGAINVRYRHPLKAQSVDALT
FT                   ALIAERLPYCRVRYAF"
FT   regulatory      complement(468537..468542)
FT                   /locus_tag="MTES_0452"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(468543..469376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0453"
FT                   /product="formamidopyrimidine-DNA glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0453"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73417"
FT                   /db_xref="GOA:E8NAZ5"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/TrEMBL:E8NAZ5"
FT                   /protein_id="BAJ73417.1"
FT                   /translation="MPEGDSVYRLRQRLDAATTGHRVREGELRSGSAAGTSLAGRRIVG
FT                   YDTHGKHLLTRFDDGTTLHTHLRMQGSWAITRAGRALPTPVREKARVRLRLDDGREVWG
FT                   LDLPVVELVPTPRERDVIGHLGPDPLREDWDAADAVRRLSSRPERAFVAALLDQTRIAG
FT                   LGNLWVNELAFLRGIHPFAPIGTTDLDALAALAARCLRISATVPRMYQVTTGDRRRGSS
FT                   HWVAGRAGRPCLRCGTRILVREEVAGDPEQRRTWWCPLCQPMPGPPVGTDVGAPE"
FT   CDS_pept        complement(469379..470860)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0454"
FT                   /product="phytoene dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0454"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73418"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E8NAZ6"
FT                   /protein_id="BAJ73418.1"
FT                   /translation="MSESYDAIVVGSGPNGLAAAVTLARSGLSVAVYERADTFGGAAST
FT                   AELTLPGFRHDVGSAVHPLALESWFFREFGLDRRVPFVVPEISYAHPLDGGRAGLAFRD
FT                   LERASDTLGVDGPAYERIMRPLVEHLRGVADFTGNALLRIPGDPLAAFFFGIRSLQQGG
FT                   PWWNARFRDEVAPSLMTGVSAHTILRQPSLAAGGAGLVLATYGHGRGWPIPIGGSQSIA
FT                   DAMITDIRAHGGVLHAGVEVTSLDELPPARVVLLDTTPRALIRLAGDRMPPAYRRMLER
FT                   FRYGGGVAKVDFALSDPVPWANADIARAGTVHIGGTRAEIAAAENAVVRGDLPDAPYVL
FT                   AAQPTLFDGTRAPEGKHVLWAYTHVPAGSPADREEAIVRQIERFAPGFRDTVLASTSRT
FT                   AEDIAAWNPNFPGGDISAGAPTLLQLVGRPVYSPDPWRTPMKGVYLCSSSTSPGPGVHG
FT                   LAGWHAALSALRHEFGTRLRPDLAPREDQLVPPTS"
FT   CDS_pept        complement(470857..471360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0455"
FT                   /product="membrane proteins"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0455"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73419"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:E8NAZ7"
FT                   /protein_id="BAJ73419.1"
FT                   /translation="MARNVRLMRCAPDDVFRVLANGWLYPLWVVGASRMRDVAEEWPAE
FT                   DSTLHHSFGSWPALVNDTTIMRVWDPPRRAVLEPHGGPIGIARVAIDVKPRGDMCVVRI
FT                   QEEPVTGPTKLLPHVVFDAITRWRNAETLHRLAYLAEGGAPGTSGGSAARGHESTAERE
FT                   PIDR"
FT   regulatory      complement(470868..470873)
FT                   /locus_tag="MTES_0454"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(471368..471373)
FT                   /locus_tag="MTES_0455"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(471458..472633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0456"
FT                   /product="signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0456"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73420"
FT                   /db_xref="GOA:E8NAZ8"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E8NAZ8"
FT                   /protein_id="BAJ73420.1"
FT                   /translation="MSTAHDVTRREAIAQYRLIGEPSEPDLQGLVELAATICGVPTAVI
FT                   NIIDDRMQHQVAAVGLAAASCSREDSMCAAVITNPGRVVVPDAQLDPRFAQNAFVTGEI
FT                   ANVRFYASSPLITPAGVAIGTLCVFDDVVGELSDASSHALDLLAHQVIDVLELRRIQRE
FT                   LVESNAQLEQFAVQVSHDLRNPLTALAGFIELAADSPEMAEAPRAAQSLARAEAAAGRM
FT                   TSMVTDLLDFARMGGTRPSITDVDVADTVDAVLEDLDGAVVRTGAEVTVDVSTVVRADD
FT                   TLLRVLLQNLIANAVKFTVAAERVPRIRVTVETLPDGWRVNIDDNGEAVEPELRDRVFE
FT                   PMQRGHGADVPGIGIGLATCRRIVDAHHGSIGLDASPEGGTRAWFVLPSAA"
FT   regulatory      complement(472643..472648)
FT                   /locus_tag="MTES_0456"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      472878..472883
FT                   /locus_tag="MTES_0457"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        472887..473030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0457"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0457"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73421"
FT                   /db_xref="UniProtKB/TrEMBL:E8NAZ9"
FT                   /protein_id="BAJ73421.1"
FT                   /translation="MSGRPDDDTAGAFAEDEADAVGTAEMHADNPVEEDMIEAVDPGGS
FT                   PD"
FT   CDS_pept        complement(473099..474421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0458"
FT                   /product="predicted integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0458"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73422"
FT                   /db_xref="GOA:E8NB00"
FT                   /db_xref="InterPro:IPR007315"
FT                   /db_xref="UniProtKB/TrEMBL:E8NB00"
FT                   /protein_id="BAJ73422.1"
FT                   /translation="MSAPPSELASPTRPSRVIERPSRYRRLDRLRGSRIGRALRQYGED
FT                   VLRPPQGVVPVERGSFTRVLLLWAVARAVNFGFLWGFYSIAKAARWGFGPDSERLGTFF
FT                   DYLTGWDADRYGQIAAQGYPMSLPMNVSGDILPNNWAFLPVFPGLVRVLSDATGLGWQP
FT                   IAILLSLGASLGATWLLFLLLRTVTKPQPAWWAVVFFSFAPMSFLFVIGYSEGLFMALM
FT                   FGAMLLAIKRKYLWIMPIGLVTAYTRPGVLALGLALGIVFLVRFFRRRVDPFPVREWAS
FT                   LMVTGGTIAVAGLSWNHIAQYVTGTHNAYIRTELGWWLDYVGNDAFTPFTPWFRQAGTH
FT                   LGVVGIVLVIALIVAFLALMWSRPVRRLGLMVVSYAFSYGVYILAVFLPQQSTFRLLMP
FT                   MAPMMADERWSSTPRRRVAIVTGCLVLQVVAILLLWTRGNP"
FT   regulatory      complement(474427..474432)
FT                   /locus_tag="MTES_0458"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(474552..474875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0459"
FT                   /product="membrane transporters of cations and cationic
FT                   drugs"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0459"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73423"
FT                   /db_xref="GOA:E8NB01"
FT                   /db_xref="InterPro:IPR000390"
FT                   /db_xref="UniProtKB/TrEMBL:E8NB01"
FT                   /protein_id="BAJ73423.1"
FT                   /translation="MSWIVLILSGVLESVWATALGRSEGFTKLWPTVIFGVALVASMGG
FT                   LAFAMREIPTGTAYAVWVGIGAALTVVFAMVTGAEALSVVKVLLVLGLVGCVIGLKLVS
FT                   DTH"
FT   regulatory      complement(474883..474888)
FT                   /locus_tag="MTES_0459"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(475003..475863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0460"
FT                   /product="predicted metal-dependent membrane protease"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0460"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73424"
FT                   /db_xref="GOA:E8NB02"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:E8NB02"
FT                   /protein_id="BAJ73424.1"
FT                   /translation="MTAHTAVPVRERSTWTPKLLPALLVCLAAPALFIVQIVWLGWMLL
FT                   ALAVASGIFVDRRNGVALARGEEPSIARDVSLVAIGQFIVSLIPLHAELDNAAFVRFTL
FT                   ALGGAVVVPYVISRFVYRDRAISFPWRGGGRWTWWQWAWLGGVIMLGYLILPFYFITSG
FT                   VYRNWPEVTTPELIARLFVGVGAVGIWDELFFICTVFVLLRRHFPDLTANLLQAIVFVS
FT                   FLWELGYQAWGPLLTIPFAIVQGFLFLRTRSLWYVVTVHLLFDAVVFGVLVHAHNPGAA
FT                   SIFLI"
FT   CDS_pept        complement(475860..476645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0461"
FT                   /product="predicted S-adenosylmethionine-dependent
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0461"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73425"
FT                   /db_xref="GOA:E8NB03"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E8NB03"
FT                   /protein_id="BAJ73425.1"
FT                   /translation="MSGRKVPVRHTPEGQPNTPDARDTAPVFRDKPVSFVRRSGRMSEA
FT                   QDRAWAELSPVYLLPVERAAAATSVKAGTAADLEHVYGRAARLVVEIGSGQGHQIVSAA
FT                   SADPDTDFLAVEVFTAGLARTMLDADREGVKNLRLVEANAPEVLEHMLPAASVDELWVF
FT                   FPDPWHKNKHTKRRLVAPEFARIAAQALRPGGTLRLATDWQDYADQMRDVLDEAPGFER
FT                   AFAGEWADRFEGRVLTAFERKGLRVGRDIRDLTYTRVSP"
FT   regulatory      complement(475870..475875)
FT                   /locus_tag="MTES_0460"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(476642..477475)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0462"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0462"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73426"
FT                   /db_xref="InterPro:IPR021447"
FT                   /db_xref="UniProtKB/TrEMBL:E8NB04"
FT                   /protein_id="BAJ73426.1"
FT                   /translation="MDDRYGTDVLARGWRDAGRIKPAEVAASVDLVVEVAGTDYVGAVT
FT                   RVEGMNVELEDRFGKRRLFPLGGGFLVDGKPVVLKAPSAAPKGRTRTASGSFAAEDQRA
FT                   RTARASRIFVEGKHDAELVEKVWGADLRAEGVVVEFLEGVDLLEQVLDAEPPTAERRYG
FT                   VLVDHLVPNSKESRIAERIARGRHGAHVRIVGHPFVDVWQCVTPRALGIAAWPEVPRGI
FT                   EWKVGVCRALGWPAEEQADTARAWQHILSKVTTFRDLEPALLGRVEELIDFVTVP"
FT   regulatory      complement(476653..476658)
FT                   /locus_tag="MTES_0461"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(477481..477486)
FT                   /locus_tag="MTES_0462"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      477589..477594
FT                   /locus_tag="MTES_0463"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        477600..479639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0463"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0463"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73427"
FT                   /db_xref="GOA:E8NB05"
FT                   /db_xref="InterPro:IPR007621"
FT                   /db_xref="UniProtKB/TrEMBL:E8NB05"
FT                   /protein_id="BAJ73427.1"
FT                   /translation="MRKPSAAKATVALLVLVAGVLGWPLSAAAVPPPSLGSSFVLDQAD
FT                   VLTNAQEAEVQSRLVRLTTDTGFDMWVAYVDEFTQPEAAEEWANETANRNNLGPHQYLL
FT                   AVSVTGRAYYLSGDVDDGALTSAQLADIEQNLVQPALASGDWAGAAVKAADGLTSAERA
FT                   APAPSPPTPAGSGPDFGLIVLLVLLALGIVGSLLWFGLRRRRAASGGPAAAVEDIDDLA
FT                   RRAGSALVATDDAVKNSEQELGFARAQFGDEAAAPFVEVLAQAKADLDRAFTISQQLDD
FT                   ETPETPEQRRAGYTEILRLCASADEALDAKAAAFEELRALEAEAPEALARVQQQHAAAA
FT                   AALAGADAELARLRQRYADSALAPVSDNPAQARARLDLAAQQIAEASTALTAGERGDAA
FT                   VALRASQVAVSQAETLEKAISTLADDLGAAERRSADLAAEIDGDIAAAGALPDPDGRIA
FT                   GAVAAATAQRNAARASLGGERSDPLSALATLEQANTTIDTVLAAARDEAERQRRAAAQL
FT                   DSTLAQARAQVSSTESFIAARRGAVGPTARTRLAEAGAALVQAEQLRATDPGAALSLAQ
FT                   RAAQLSSEAGSLAQNDVGGFGGGSGGGTDMLGAILGGIAVNSLLGGGSRSRGGFGGGFG
FT                   GSFGGGGFGGRSGGSRSRSSGGGMRSGGSRSSGGGRSRRGGGRF"
FT   regulatory      479718..479723
FT                   /locus_tag="MTES_0464"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        479730..480485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0464"
FT                   /product="phage shock protein A (IM30), suppresses
FT                   sigma54-dependent transcription"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0464"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73428"
FT                   /db_xref="InterPro:IPR007157"
FT                   /db_xref="UniProtKB/TrEMBL:E8NB06"
FT                   /protein_id="BAJ73428.1"
FT                   /translation="MAKQSIFGRMTTLVRANINALLDQAEDPQKMLDQLVRDYSNSIAD
FT                   AESAIAETIGNLRLLERDHQEDRQAAAEWGNKALAASRKGDELRSSGNVAEADKFDNLA
FT                   KIALQRQITAEGEAKAAEPTIAAQTEVVDKLKDGLNGMKSKLEQLKAKRNELTARAKVA
FT                   EAQNKVHDAVRSIDVLDPTSELGRFEDKIRRQEALAAGKQELAASSIDAQFNALEDVGE
FT                   LTEVEARLAALKVGGPQRAAIDAPSPDQV"
FT   regulatory      480541..480546
FT                   /locus_tag="MTES_0465"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        480551..481363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0465"
FT                   /product="arginase/agmatinase/formimionoglutamate
FT                   hydrolase, arginase family"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0465"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73429"
FT                   /db_xref="GOA:E8NB07"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="UniProtKB/TrEMBL:E8NB07"
FT                   /protein_id="BAJ73429.1"
FT                   /translation="MARFIVAPQWQGSSSSRAMQLIDGAEAIAGDLPRASTTVLDAVPE
FT                   AGDAQGTGVHRLSALMRMRERIEDAVRAGDEPAIVIGGDCGVALGSVSAVAGDDLAVVW
FT                   IDAHADLNTPASSPSGAFHGMVLRAIAGEGDDLHRLEPGITPGRIVLAGTRALDAEEQR
FT                   FIEHHGVRVIAPDDLADPDVLAEAVVATGASRVYVHVDLDVLDPAEMTGVALPEPFGAR
FT                   TADVVASIRRLRERLPLAGATLTEFSPSSPAAAVDDLGTILRLIGALA"
FT   regulatory      481347..481352
FT                   /locus_tag="MTES_0466"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        481360..481815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0466"
FT                   /product="Fe-S oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0466"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73430"
FT                   /db_xref="UniProtKB/TrEMBL:E8NB08"
FT                   /protein_id="BAJ73430.1"
FT                   /translation="MSPIPRPPAGWRERADRAVARGRAWDRLIPGFLLDSPISRLGYWY
FT                   GCTVGWVWGSLWSTGRIEKRHGLWIFRGLPRWAFPRGGVCVGGCFLTGDDRPTGTVLGH
FT                   EAVHKRQWQRYGFLMPVLYALAGRDPLRNRFEIEAGLAEGNYVPRGS"
FT   CDS_pept        complement(481960..482424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0467"
FT                   /product="siderophore-interacting protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0467"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73431"
FT                   /db_xref="InterPro:IPR007037"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:E8NB09"
FT                   /protein_id="BAJ73431.1"
FT                   /translation="MAPSSEHNDAACRASRHTRVQHLVTADETSLVELETLLATLPICS
FT                   TGRVFIEVPDASWVGRIAAPARMTLSWLDRSRRGGAPGTGRSCAPGEALARAVSGWAGE
FT                   MLCCDDDDTRIFLLGGYLGTAEIVDDLVARHGVDAQAIHTPERFGLATAR"
FT   regulatory      complement(482432..482437)
FT                   /locus_tag="MTES_0467"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(482502..483212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0468"
FT                   /product="protein tyrosine/serine phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0468"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73432"
FT                   /db_xref="GOA:E8NB10"
FT                   /db_xref="InterPro:IPR000387"
FT                   /db_xref="InterPro:IPR016130"
FT                   /db_xref="InterPro:IPR026893"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:E8NB10"
FT                   /protein_id="BAJ73432.1"
FT                   /translation="MTSLVSGAANFRDVGGLPAGEGRTREGVFFRSGNLVAVDDAGIEA
FT                   LRSLGIRRVIDLRDETEVTHAPSRFDDLPVEVQHEPLFLGSVDSFFARDVSLDELYASI
FT                   VDESADRVVAVVRGILSAQPVLVHCTVGKDRTGVTVAIALAAAGVDREAVVADYARTEA
FT                   LLPPERNAAVLRAIRAFHPENVHAEALATLSPAPVMRALLARLDREYGSPAGYLRAHGM
FT                   SDAELRRLREVLVD"
FT   CDS_pept        complement(483209..483730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0469"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0469"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73433"
FT                   /db_xref="GOA:E8NB11"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:E8NB11"
FT                   /protein_id="BAJ73433.1"
FT                   /translation="MGEEKRVHLSKKAPEAYAALRSFSSTVGRLAAEAGIDARLREIVQ
FT                   IHASQLNGCAYCVRVHVDAAVKAGLDADVIAQIATWRESGVFDERERAALELTESFTFI
FT                   HEDGIPDEVYDHAGGILSEAEYVALSWVLVAINSFNRVAIAGRYPVPPRSAAPAPATEP
FT                   VPHDHGGESA"
FT   regulatory      complement(483216..483221)
FT                   /locus_tag="MTES_0468"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(483736..483741)
FT                   /locus_tag="MTES_0469"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      483824..483829
FT                   /locus_tag="MTES_0470"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        483836..484753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0470"
FT                   /product="predicted hydrolase or acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0470"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73434"
FT                   /db_xref="GOA:E8NB12"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E8NB12"
FT                   /protein_id="BAJ73434.1"
FT                   /translation="MPEVDEFSFLPAQAADIGRPTPTVERVQLTLDDGRTLSGLRWGDA
FT                   PPAVTLLHGAGLNAHTWDTTLLHLGLPALALDLPGHGDSSWRDDAAYVARVLAPDVVTA
FT                   LEAWTTRPQTLVGHSLGGLTGAAVAASRPDLVERLVVVDITPGIDPSGGPAQLRAFFAG
FT                   PTDWASRDELVERALSFGLGGSRTAAERGVFHNSRVRPDGRVEWKHHFAHLAAAAVNAG
FT                   ADPSTPDAVRAVLATTGWDDVAQVTTPLTLVRGERGFVTADDADEFVRRAPAAEVRTLA
FT                   TGHNAQEEDPAGLASLIREVAPLG"
FT   regulatory      484873..484878
FT                   /locus_tag="MTES_0471"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        484889..486400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0471"
FT                   /product="ABC-type dipeptide transport system, periplasmic
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0471"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73435"
FT                   /db_xref="GOA:E8NB13"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:E8NB13"
FT                   /protein_id="BAJ73435.1"
FT                   /translation="MLRRTALATSALLIGALLLTSCTASSNDPAPSGEADPNATLTVRL
FT                   SLEPSNLDIRHTSGAALEQALIDNVYQGLVTRDGDQNNEIVPALATEWTVSPDGLTYSF
FT                   TLRQGVTFHDGSALTADDVVTSLQTAKDDATIQNSADLANVASISSPDASTVVLTLAKP
FT                   NIDFLFALTGRAGLIFKNGDTTALQTAENGTGPFRVETWNTGQSLTLSRYDGYWGERAG
FT                   VAQVVLDYIPDQSAATNAAVSGDVDVALEIDPELQSQIEGTGNFTIESGLTTDKGILAF
FT                   NNQRAPLSDQRVREALRLAVDHNALAETLITAQPLNGPIPPLDPGYEDLTGSISYNPDR
FT                   ARELLAEAGADNLSLTLTIPNVYPGTLTTFLVSAYADVGVKLQVKQVDFSTWLTDVYTN
FT                   HDYDLSFVRHVEARDFGNWADPTYYFGFDNAEVQSLYAQSLATTDAQQSSDLLAEAAQI
FT                   VDDQDAADWLFLSAPRAAVGTNVANFPKNSLNVRLPLAGVTVASE"
FT   regulatory      486382..486387
FT                   /locus_tag="MTES_0472"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        486397..487347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0472"
FT                   /product="ABC-type dipeptide/oligopeptide/nickel transport
FT                   systems, permease components"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0472"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73436"
FT                   /db_xref="GOA:E8NB14"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E8NB14"
FT                   /protein_id="BAJ73436.1"
FT                   /translation="MTRYALTRLGLLVLGLVVASALIFVSLRVLPGDVAQLVGGTQASP
FT                   DQVAALRESLGLNIPLWQQYVEWIGGLFRGDLGTSLLTGTPVVTELVAKAQVTLPLAAM
FT                   SLIVALVVGIPFGVLSALGRRHAGGTALSVGAQALAAVPVVWAGMMLVVVFAVWLGWLP
FT                   PQGFPRAGWNDPGAAFRALILPAVTIGVVEGAMLLRFVRSATLQAIGQDYVRTAAAKGL
FT                   TRTRALLRHGLPNVGLSIITVLGLQIAGIIVGAVVIEQLFTLPGVGRMLVADVAARDLP
FT                   KVQGELLAVTGFVLVVGFVVDLLHRLIDPRQREAS"
FT   regulatory      487335..487340
FT                   /locus_tag="MTES_0473"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        487344..488213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0473"
FT                   /product="ABC-type dipeptide/oligopeptide/nickel transport
FT                   systems, permease components"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0473"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73437"
FT                   /db_xref="GOA:E8NB15"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E8NB15"
FT                   /protein_id="BAJ73437.1"
FT                   /translation="MSTLKRLWGLGTGRFGILIVVLLVVVAIVSLFWTPFDPGAVDVRA
FT                   RWADPSWPHVLGTDNNGRDIASLLMAGTRTTILVAVGAGIVASVLGIALAALGSLTARW
FT                   IRESVAVLVDILIAFPVLIIAMMISAVWGGSLAVVIWAVGIGFGVNIARVTRPELRRVL
FT                   QSDFVLAGRASGLTAWQNLTRHLLPNVAPVFIVQLSWGMAVAVLAEAGLSYLGFGAPIT
FT                   QPSWGVLLNDLQAYIAVHPLTVVWPGLAITLTVLALNLLGDALREAGDPTLADRAPAAR
FT                   THVPGVVA"
FT   regulatory      488198..488203
FT                   /gene="oppD"
FT                   /locus_tag="MTES_0474"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        488210..489076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oppD"
FT                   /locus_tag="MTES_0474"
FT                   /product="ABC-type dipeptide/oligopeptide/nickel transport
FT                   system, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0474"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73438"
FT                   /db_xref="GOA:E8NB16"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E8NB16"
FT                   /protein_id="BAJ73438.1"
FT                   /translation="MSLRVTDLRVEIAGRAVVDGVSFEVPDGARVGLIGESGSGKSLTA
FT                   LAILGLLPDGARATGSVRWNEREILGLPDRELAALRGDDIGMVFQEPRTALNPLHTVGR
FT                   QIGESVRIHEGVSRREALWRAIAEAERVALPDPERIVSRYPHQLSGGQRQRVAIAMALA
FT                   CRPHLLIADEPTTALDVTIQAGILSLLRSLVQDAGMSLVFITHDLAVLAQVATHAVVLD
FT                   RGRVVEEGEVGALLRAPSSPITRALVRDATATLWHPEIAGADAGTPAFPAGPGPSHGEA
FT                   AKGEETP"
FT   regulatory      489063..489068
FT                   /locus_tag="MTES_0475"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        489073..489864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0475"
FT                   /product="ABC-type oligopeptide transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0475"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73439"
FT                   /db_xref="GOA:E8NB17"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E8NB17"
FT                   /protein_id="BAJ73439.1"
FT                   /translation="MTETLIQARGLSRSYPAPRRGFGRPERTVGLDDVDLSVRAGSAVG
FT                   IIGESGSGKSTLVRLLLGLDVPTAGTVEVDGRAVDARSSARSLHGLRRATGIVFQDPYA
FT                   SLDPRMSVGRIVGEPLWALGIDGDRRARVREVLEQVGLDADMAARFPHEFSGGQRQRIA
FT                   LARAIVHRPRILVGDEPLSALDVTVRAQILRLLARLRAEEDLTLVLVSHDIGVVQNVCD
FT                   HVVVMKDGRVVEQGPTEKVLLQPQAAYTRQLLASIPTLPRG"
FT   regulatory      489860..489865
FT                   /locus_tag="MTES_0476"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        489870..490208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0476"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0476"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73440"
FT                   /db_xref="InterPro:IPR027395"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E8NB18"
FT                   /protein_id="BAJ73440.1"
FT                   /translation="MAKDSREDGRAASVEPRFDEAIHAPTRLRICAMLRPLAEADFADV
FT                   KAALDLSDANLSKTLRALIELGYVRTTKQSSPERADGRRTTRLSLTPLGRDAFDAHFAA
FT                   LRAMAPGP"
FT   regulatory      490256..490261
FT                   /locus_tag="MTES_0477"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        490270..491328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0477"
FT                   /product="zinc metalloprotease"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0477"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73441"
FT                   /db_xref="GOA:E8NB19"
FT                   /db_xref="InterPro:IPR001570"
FT                   /db_xref="InterPro:IPR013856"
FT                   /db_xref="InterPro:IPR023612"
FT                   /db_xref="InterPro:IPR027268"
FT                   /db_xref="UniProtKB/TrEMBL:E8NB19"
FT                   /protein_id="BAJ73441.1"
FT                   /translation="MIPGIVPPFLLDRLASTDDPRLARAAAAARKTLAMPRPSRPTRRR
FT                   LRLSIDGDALVAEAVPAPDRVISDARNTENLPGRRVRSEDEPPSGDSAVDEAYEGLGAT
FT                   YDFFWDAFSRDGIDAAGGSLLATVHFGDDYDNAFWNGERMVFGDGDGDVFVGFTRSLSV
FT                   IAHELGHGVTEAAGGLEYQGQSGALNESLSDVFGALAEQHHRGERADEASWLIGAGIFA
FT                   EAVQGEALRSMKAPGTAYDDDVLGKDPQPGHMRDYVETDDDNGGVHINSGIPNRAFFLV
FT                   ATRLGGFAWERAGLIWYRTLTAGTLSPTADFAAFARATLVAAATEYGEESEEVAAVRAA
FT                   WAGVGVEEDAAG"
FT   regulatory      491306..491311
FT                   /locus_tag="MTES_0478"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        491315..491626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0478"
FT                   /product="FOG: TPR repeat, SEL1 subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0478"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73442"
FT                   /db_xref="UniProtKB/TrEMBL:E8NB20"
FT                   /protein_id="BAJ73442.1"
FT                   /translation="MPQADDDERFAILVVRSGGIAGLSKQWRAEPDPERAPHWRELVES
FT                   CPWDAPPAPTAGADRYQWRIEVHRGDTAVHRARLSDAQVEGPWRSLVDEVRQAASPGR"
FT   CDS_pept        complement(491771..492397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0479"
FT                   /product="predicted transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0479"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73443"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR026881"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:E8NB21"
FT                   /protein_id="BAJ73443.1"
FT                   /translation="MAREFSVSVRTVKRDLAALERSGTPIWSRPGPGGGYGLAVGSSLP
FT                   PVTLSSAQAVALLAAVAANPDAPYNDLARAGVAKILDVVDPRTRARAEELAARVWVDAP
FT                   VSASRAVRSALEEALADQRVVRVRYTTAAGQTTTRDIEPVLFASREGRWFLIGWCRLRE
FT                   AMRWFALERVERATVLAEERSGHTVQEVGEPPRTSHPVSGVRSTR"
FT   regulatory      complement(492402..492407)
FT                   /locus_tag="MTES_0479"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      492537..492542
FT                   /locus_tag="MTES_0480"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        492549..493265
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0480"
FT                   /product="predicted hydrolase or acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0480"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73444"
FT                   /db_xref="GOA:E8NB22"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E8NB22"
FT                   /protein_id="BAJ73444.1"
FT                   /translation="MNITTGTPPLIFLAGHWLGAWAWDDLLAHLPSTRTIALTLPGLDP
FT                   DDPDRTSRAVDDQAAAIIDLLARLDSPAVVVAHSGANAPLSVVLDRHPQLVRRVVWVDS
FT                   GPWNGRAFAPELPVDVRELALPPFDVLAQQASLAGLTPDLLERFRARAVAEPAPVLRQA
FT                   VELTNDLRHDVPTTLVCCSLPSAQVHELADAGHPMFADVARLTRVESVDLPTGHWPMWS
FT                   RPSDLAAVILAAARQD"
FT   CDS_pept        complement(493419..494030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0481"
FT                   /product="sortase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0481"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73445"
FT                   /db_xref="GOA:E8NB23"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:E8NB23"
FT                   /protein_id="BAJ73445.1"
FT                   /translation="MLEEEYEKSRRRLPAHLRRAPEPERPFSYEIRPATEADIPDIREI
FT                   YNYYVRNSVVTFDEKAWSIAKWRDKFATLKRLGLPFLVAESPSGQVLGYALVQPWQSKS
FT                   AYRYTVENSIYLGQAAAGKGLGRALLEALIAACQDLGIREMVAAISDKGADASIALHEK
FT                   LGFTEVGRMGRVGFKFGRWLGVVYLQKSIPSKKKKRKLFG"
FT   regulatory      complement(494038..494043)
FT                   /locus_tag="MTES_0481"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(494093..494779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ung"
FT                   /locus_tag="MTES_0482"
FT                   /product="uracil DNA glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0482"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73446"
FT                   /db_xref="GOA:E8NB24"
FT                   /db_xref="InterPro:IPR002043"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR018085"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:E8NB24"
FT                   /protein_id="BAJ73446.1"
FT                   /translation="MTAKSLAELADAGLIDRSWVEPLAPVAADIAAVGERLRSEGKPYL
FT                   PAGDLVLRAFRTPLDAVRVLIVGQDPYPTPGHPIGLSFAVDPHVRPLPRSLSNIYRELS
FT                   DDLGIAPAPHGDLSAWSAQGVMLLNRVLTVAPGAPASHRGWGWERVTEHAIHTLAAREA
FT                   PLVAVLWGRDAMNLAPLLGDTAIVSSPHPSPLSASRGFFGSKPFSRVNALLEEQGAPPV
FT                   DWRLPS"
FT   CDS_pept        complement(494776..495261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0483"
FT                   /product="predicted phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0483"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73447"
FT                   /db_xref="GOA:E8NB25"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:E8NB25"
FT                   /protein_id="BAJ73447.1"
FT                   /translation="MTDERERLTWDDFGAATRDISRAIVADGFHPEVVVAIARGGLLPG
FT                   GAIAYGLGVKNCGALNVEFYTGVGTVLDAPEVLPPALDLSYLSGRRVLLVDDVADSGRT
FT                   LDLAVKLLDRHGAEARSAVIYTKPSTIITPDYSWKNTDLWIDFPWSFQGSVHEEDAA"
FT   regulatory      complement(494787..494792)
FT                   /gene="ung"
FT                   /locus_tag="MTES_0482"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(495269..495274)
FT                   /locus_tag="MTES_0483"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      495377..495382
FT                   /locus_tag="MTES_0484"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        495391..496890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0484"
FT                   /product="permease of the major facilitator superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0484"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73448"
FT                   /db_xref="GOA:E8NB26"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E8NB26"
FT                   /protein_id="BAJ73448.1"
FT                   /translation="MSRVSGAVGRVRSSALGVTAGLIGWFVVVELVSGILQGFYVPLLP
FT                   DIVVHLGIRDADVNWFEAAQLLLSALVLPVLAKLGDMFGHKRILLLSALATAAASWWLV
FT                   FADSFTSFLLAWALQGFYVVWLPLEIALIFDRGRRLQRGVSRTRSAAGLLVVGLQAGAI
FT                   IGALAAGRLFAATGGNLRLALMVPAVAVTLVSLVIWLGVPESERSPDARRLDVGGFAIL
FT                   AGALLCVTGALSFVRLPEGPGPLAITALLVAGVALLVVFVWFELRQSDPAVDIRVLRRP
FT                   EMWPVQTTAFLVGISLLGAQGPLATYAGTDRALGYGLGLDATDRSNVIGVYLVSLIVGA
FT                   VLFAVTSRRASPRAVLIGAAVLVGAGYALLLPLHVELWQVLLCLAIAGLGSGALVAAMP
FT                   AAAAAAAPRGQTGVASALTNTTKTVGGTMSSAVFGVVLAAGAGSAVAATAAPLAGYLTV
FT                   WAICAAGGFAAAVLLLFVPKVAFADRAEAEVDAQAARGEVS"
FT   CDS_pept        complement(496903..497982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0485"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0485"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73449"
FT                   /db_xref="GOA:E8NB27"
FT                   /db_xref="UniProtKB/TrEMBL:E8NB27"
FT                   /protein_id="BAJ73449.1"
FT                   /translation="MTASTTLDVEALRAHPSRAELRRFWARFRQEYPRVRDSERRGRRA
FT                   VFTFLLITSTVGALGMWANIAAEMRQGGSDEVRPMFLFVFLFLGVLVFSVWGIVRTGKR
FT                   RTRPREHWALARFADDNGLEYVPGPRSGTMRAWWSITGHTVARAMTRENADGRTVEWAD
FT                   YEIRNATRRFTYPPVGGWIKIGLRRPLPHIIVRATRRGTRAFAVAAVPDSGQRLSLEGD
FT                   FDEHFDLYCPEGYEADALYLFTPDVMAQAIDDAGGWDIEIVDDLLILVHPRDVVTTDPA
FT                   RWAEVMRTADVFATKLEQWERWRETQLRDDPAVDETRLDLAQVAPAGRRLRTSWGLAAW
FT                   VSFALVAVLTVGFFLLGRP"
FT   regulatory      complement(497993..497998)
FT                   /locus_tag="MTES_0485"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(497998..498768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0486"
FT                   /product="short-chain alcohol dehydrogenase of unknown
FT                   specificity"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0486"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73450"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E8NB28"
FT                   /protein_id="BAJ73450.1"
FT                   /translation="MTRRAVVTGASSGIGEATARLLRSRGWDVVGVARRADRLAALESE
FT                   TGVVARAADLTDADDVAALTAWLDETGGVDALVQVAGGARGSDRVEDGDPEDWRWMFEA
FT                   NVLASQRLVASLLPSLRRAAGASGHADLLFVTSTAAQTAYPGGGGYNAAKAGEAMLVHA
FT                   LRQELNGEPLRVIEIAPGMVRTEEFTLNRLGGDQDAADKLYEGVEAPLVADDVADVIAY
FT                   ALDAPGHVNLDLVTVRPVAQSAQHLLARGPLRTR"
FT   regulatory      complement(498778..498783)
FT                   /locus_tag="MTES_0486"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      498903..498908
FT                   /gene="cysD"
FT                   /locus_tag="MTES_0487"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        498915..500237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysD"
FT                   /locus_tag="MTES_0487"
FT                   /product="O-acetylhomoserine sulfhydrylase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0487"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73451"
FT                   /db_xref="GOA:E8NBJ1"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR006235"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:E8NBJ1"
FT                   /protein_id="BAJ73451.1"
FT                   /translation="MSAPENWRFETKQIHTGAQPDPVTKARATPIYQTTSYVFDNADHA
FT                   ANLFALAEFGNIYTRIQNPTQDVVEQRVAGLEGGTGALLVASGQAAETFAVLNIAQAGD
FT                   HIVSSSSIYGGTYNLFKYTLAKLGIETTFVENQDDPEEWRAAVRPNTKLFFAETIGNPK
FT                   INVLDIRSVADIAHEAGVPLIVDNTIATPYLIRPFEHGADIIVHSATKFLGGHGTTIGG
FT                   VIVDGGTFAWSEHSDRFPGLTTPDPSYHGAVYTQAVGDGLAYIIKARVQLLRDLGASIS
FT                   PQSAWQLIQGIETLSLRVERHVQNAQEIAEWLESHPDVASVNYSGLPTSPWYAAANNYA
FT                   PKGVGAVLSFELKGGVEAGREFVNSLSLFSHLANIGDVRSLVIHPASTTHSQLTPEQQL
FT                   TAGVTPGLVRLSVGLENIADLKADLDQALAAARRLSEAARA"
FT   CDS_pept        complement(500414..500950)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0488"
FT                   /product="dehydrogenase with different specificities"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0488"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73452"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E8NBJ2"
FT                   /protein_id="BAJ73452.1"
FT                   /translation="MVREAGELDGIAVFAGSMLLKPAHLTSREQYDGLIAASLTTAFAA
FT                   VRAAGSHMRDGGSVVLVSSAAALAGLPNHDAIAVAKAGVIGLTLSAAASYAAHGLRVNA
FT                   VAPGLVQTRLTEKLTASDLSRKVSEAMHPLGRLGEPDDVARAVEFLLSPDNAWVTGQVL
FT                   GVDGGLGSLRPRQKV"
FT   regulatory      500871..500876
FT                   /locus_tag="MTES_0489"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        500879..501178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0489"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0489"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73453"
FT                   /db_xref="UniProtKB/TrEMBL:E8NBJ3"
FT                   /protein_id="BAJ73453.1"
FT                   /translation="MCRLEEHRPREHRDAVELARLAHHPVDGVEVGGIQNGIRLDDRGV
FT                   PGRGQDTVSRIAESRRGRTPDVAGGRDEEEGRHAAIMAPPDIGERGLDNLVSRW"
FT   CDS_pept        complement(501165..501566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0490"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73454"
FT                   /db_xref="InterPro:IPR025355"
FT                   /db_xref="UniProtKB/TrEMBL:E8NBJ4"
FT                   /protein_id="BAJ73454.1"
FT                   /translation="MPRMGTWSAEPFGNDSAADWAYELDEAKDWGVVSDALRVAAEAAP
FT                   SELDSDDAVLAIAAAEVVARGLGRVADSAESVEAFVARVSPPSPELVALAVSALAVAAS
FT                   DEGELADLWEGDPDWLAENEKLRAALTTG"
FT   regulatory      complement(501579..501584)
FT                   /locus_tag="MTES_0490"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      501627..501632
FT                   /gene="metX"
FT                   /locus_tag="MTES_0491"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        501637..502842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metX"
FT                   /locus_tag="MTES_0491"
FT                   /product="homoserine acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0491"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73455"
FT                   /db_xref="GOA:E8NBJ5"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR008220"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E8NBJ5"
FT                   /protein_id="BAJ73455.1"
FT                   /translation="MDWQISEDTVPSAPITEADARSLLGRPPATGAWRDGDPAGERRFA
FT                   TFGAFATENGESLPGFRLAYESWGELSPARDNAVLILHALTGDSHVRGAAGPGHPTAGW
FT                   WSDLVGPGAAIDTDRWFVVAPNMLGGCQGSTGPASIAPDGYEWASRFPYLTIRDQVRAQ
FT                   AQLADALGIDRWAAVIGGSMGGMHALEWTVGHPDRVERAAILSAPPITTADQIALNSVQ
FT                   LDTIRMDPRFAGGEYYDSGDGDGPHRGLALARRMALLNYRSPTELNQRFQRSWQSGVSP
FT                   LGRGGRFAVESYLDFHGNKFTRRFDANSYLTLVEAMNSHDVGRDRDGVEDALRRVTATT
FT                   LVLGIDSDRLFPIDGQHRIARGIPNTLDGDEAVVLASDFGHDGFLIETAAVATHLRRLF
FT                   AA"
FT   CDS_pept        complement(503149..504396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0492"
FT                   /product="arabinose efflux permease"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0492"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73456"
FT                   /db_xref="GOA:E8NBJ6"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E8NBJ6"
FT                   /protein_id="BAJ73456.1"
FT                   /translation="MRALLSLAIGSFGIGMTEFVVMGLLPNIARELVPTTWAASPDDAI
FT                   AQAGWLVSLYALGVVVGAPTIAGSVARFPRHRVMIVLAAALAFFTLLTVIAPTFELVAA
FT                   SRFLAGLPHGAYFGIGALVAADALGPGNRAKGVAFVLTGLTIANVVGVPLGTLLGQQVG
FT                   WRAAFAVVTGIFVLATICIALFVPKHPGSPGRRLRDELRVFRIGQVWFALGIGAVGFGG
FT                   FFAMYSYIAPMITEVAGQPEWAVSLVLVLVGVGMTVGNVVGGALADKDLRFWLFVGLTA
FT                   LGAASVGLALTAGWIVTLVVFAFLVAFCGAALSPGIQTRLMDVAEDNQSIAAALNHSAL
FT                   NIGNSLGAFLGGLAIAAGLGLVAPAWVGAVLALGGLVVAVVSYRVEDRSGRHPEHRMPA
FT                   AEAATTAITGSIPTQG"
FT   regulatory      complement(504404..504409)
FT                   /locus_tag="MTES_0492"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      504598..504603
FT                   /locus_tag="MTES_0493"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        504609..507533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0493"
FT                   /product="phage-related tail protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0493"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73457"
FT                   /db_xref="UniProtKB/TrEMBL:E8NBJ7"
FT                   /protein_id="BAJ73457.1"
FT                   /translation="MSLGNSTKTRRALPRVIAAMVAVGALVTVTACTNGQAEITPTRLL
FT                   QSVAVGVTTDAAIQSVTSTTIAIGSSPSETSSESATFTPADVADDIPVRIRTSYRTADS
FT                   SGTDLSDLKGYSGRVEIDVTVENLTVKPQQLTYDAAGQSRTREALVGAPLTIAASTVLG
FT                   GVAPSRVVIDSDTDSTVTNGVLSRSDDGDAVVQWASLLAPPSGRASSTLTLVADVDDFS
FT                   VPAFDIAVQPGISTDASMGGVLDAAFNDDPTSQLALQRRTIEVVAAVNDVLGRAGTTIT
FT                   EVRTNLESTADTLGVRTARELADSTTSLGTTMRGLTAQLTGLQSDLSSTVDSTNSAVLQ
FT                   QLGGALSAVDGMLGDTSAPPPPSTQTGTGCSTSSTIPGEANTVYGNIQRLAVELDNYAS
FT                   AADDCKGEVQNALRQTIGPDSPSADSCQNPSTTCALFSAQGEVTATLAQLVVDGRELVD
FT                   SLKPELMASVVTQFDQTSAAIEAVQAATKKVSDGLPDGSVPQSLGEVGSALDSLSGSLG
FT                   SLNAALSNVNQIAGAARDQLGSPDQSGSIREQAARLADKLCTLVDDDEEGGNNGGGNNG
FT                   GGNGGGDGSGGGGSDGGSNGGGDSDGGNGSGEGSGNGSGSGEGSGSGERSFSTPIFGGP
FT                   SLAEIDRLRAYITSEGCEGGSLRTPDGYSAPLLDRLTDDARAWNDVIEQTSTDGQLGTA
FT                   ISGLLDQTSAVRDAVGRIGSAASGGDQNLAELVTALSESTDALANQSTELDQRINALKK
FT                   QQDGLGPSIERAFADADAEAAKKVSALIEEQVRVISARGKTDAATIGAMFDRSVAGLTS
FT                   TSSEIAESGKKTVESQRDDLTAAGQAISQSVSAQTLSSLSTISSSIGAATRDTDGASSL
FT                   LQADLNKVLLDLGDRRVNGSGLLGSMVTSAAKVDTADVQLALASQQAQGYANVRSQDVA
FT                   GILLQQAQTQASLEAGGKLPPFHIEAPAGAATQTVYTFRIGDGK"
FT   regulatory      507516..507521
FT                   /locus_tag="MTES_0494"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        507530..508795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0494"
FT                   /product="ABC-type branched-chain amino acid transport
FT                   systems, periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0494"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73458"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E8NBJ8"
FT                   /protein_id="BAJ73458.1"
FT                   /translation="MKRRSVALIAAGAAVVLVAAGFTTWSLTRPTEAQAVGSIPVAISA
FT                   PVPDDLTIGVIVSLSSAPGEGAEWKDAANGAVVAARRLALGGHPVTVRAVDDKGTVDGA
FT                   RAAAQQLVDDGASGIVVATSGSHVSGAVEVARTAGVPAVLPYVTDGSLAGDGVWLTGAT
FT                   TDAISAALPTALKGASSVLLVDAGYGTPAGLSPAAVVPFSAGGDVEAFRAAVAAARGSR
FT                   PLDAVLVNGPATTQAGVVQLLQSEDADLPIVVTPEATSPAFSEALVSAGGTLSTELTTV
FT                   GAGWSDTVALSPDVDGRAMSAFLAGVRVLADDSSATTLFEDRSFASVAGLADSRSHDAT
FT                   VLVALAAASAGSTEPSAVTSALGALSAGPGDGIAGPALDGSRSTALVPAIAPLYSADQN
FT                   LGLRPLSTDTTAPLVWFAGQAD"
FT   regulatory      508805..508810
FT                   /locus_tag="MTES_0495"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        508815..513110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0495"
FT                   /product="DNA segregation ATPase FtsK/SpoIIIE"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0495"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73459"
FT                   /db_xref="GOA:E8NBJ9"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E8NBJ9"
FT                   /protein_id="BAJ73459.1"
FT                   /translation="MRLLIAIDEDEQVVDLARHRSQATLAELISAATGRDLAPETLVSV
FT                   DAQRHPASTELTEVLLLEGTRIALSEPRRPKPATDWTATLSGGLHAGPIVDVPRGRALI
FT                   AGRSPQADLMLPTTSASWEHFAAVREEDGLRIDDRGSTNGTLVDGTEAGDDGTVVEGPA
FT                   VVIAGGTSVLLRPSIEEAGAPEPGSLHNITPAATAPFNRPPRPGRPPEPDPITPPTRKD
FT                   VPPASKFSIITVAAPLVLAFVMVLMLGDARYAMFAALSPVLGVGVWFEQKRRHTKNVKE
FT                   EDERFTQALQTLRDDIASAGQAEKARRMDAIPDPATTLRRAAIPATTLWQRRASSSDLL
FT                   ALHAGIGDVPWRPAIDERSGTRLEDDVREILDSATIPSAPVEIDLTAGGVVGIVGDRDG
FT                   ALALARSLVVQAGVHVGPADLTVGVFCDAGRSPEWAWAGWLPHTRRQGTGTQERWMSDN
FT                   RERSTDLLRGLRDGIHDIPTASVLLVLDSDVLTEGRNAPARELLGHGRPDGTTTLSRDR
FT                   QGVQVSGIVIASSEEQLPAACTVVVRVAPDAAATVTRPGDLVTVDDVILAGIDIDTAAA
FT                   GARDVARFDDPELVVPGAALPGLVRLPPLLGLDEVNAAAVRDLWTNARGITAPIGMGEG
FT                   GTMELDLVHDGPHGLVGGTTGSGKSEFLRSLVAGLALRNDPTRLSFILIDFKGGAAFAA
FT                   CERLPHTIGTISNLDEQLADRALRSLEAEMRRRQRIFAAAGEGVDNLDAYLATKPAEPM
FT                   PRLLLVVDEFAMLAKDFPDVLSSLVSVAAVGRTLGVHMILATQRPAGVVNDDILANTNL
FT                   RVALRVQSRDDSNNVIGVPAASAIGRAQRGRAYIKRGQDDIAPVQTALVTGQSERAVVE
FT                   AVELQPVTFSGIAPAPRTTVVDESATDLDVVIDAIRAAADEAGIAAPRPVWPEALGSRV
FT                   PLAGFGDEAADAGVAAGVPAVGGVQGAEVFFALADEPDSQRQVAAGWNLTRGNLLAVGI
FT                   PGSGTSTALSSIALALAAESHPDDLDILVLDAGARDLAPLADLPHTVAYVGAGGGAREQ
FT                   QARFLRHLRGDLERRRADEGQRRRAIVLIDGLAALRDEFQDHEGQQLLDGLYRAYADGP
FT                   ELGLHFAVSTTRAKAVPSAIDEVTTQKWMFRLADPYDYTSAGLRPKDAPASVPGRCVLA
FT                   ETARQAHVATPAGGLTDAVARVKATYAGTAAKAPVVGRLPDQVGIADLGATAELGREPW
FT                   RLPIGIAEADLAPAFLEVYEGEHVLVAGPARSGKSTLLLAIAQALRTAPDATTPVAVWG
FT                   VCGRRSPLATADLDRVVVGADEIPALVASVRLERGPVVILVDDAESFEDTDQSLASLLT
FT                   MSQQHVLVIAAGRSADLRAQYSGWTKTLRKSRCGVLLQPDVDYDGDLLGVTLPRRAPVA
FT                   VTTGRGYACVAGAARFVQAAGPSVAVAAG"
FT   CDS_pept        complement(513253..515214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0496"
FT                   /product="serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0496"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73460"
FT                   /db_xref="GOA:E8NBK0"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:E8NBK0"
FT                   /protein_id="BAJ73460.1"
FT                   /translation="MEPEIGDALGASYRFVDRIGSGAAGEVWRVRDVRDESMRAAKVLR
FT                   REHAQDAELVERFIRERTVLTRLRHPHVVAVRDLVVEGERLAIVMDLVEGGSLRDALEE
FT                   RGTLPPAEAVALTAAVLDALAAAHAVGTVHRDIKPDNVLLSRDAAEDEGDPGAAVRVVD
FT                   FGIARVLDERRRSTTAIIGTPEYMSPELVTLGEAGPPSDVYAAGILLYELLSGRTPFAG
FT                   PGTDFTVAYRHVSAEAPRLDVPDEVWRVLHRLLGKAPTERPSAAEAAESLRRLKSAVAT
FT                   LPALAPVAAPEGFAEAERPATVLRGVTPSAPEPVDLPADEPAPDLGAAGQATVLRPMPR
FT                   REAPAPVAQEPAAKTTLWARMPRGRALWIAGAAVVAVAAVGAFFLLRPAAGEAAPAAAG
FT                   PVVTASQQDRALPTGLSVSRSVSYDPEKKIATVTIEYGAQNAPLTGPFLEVLPGAAAAD
FT                   ACPAVTWSDATVTRNQASVTGISVNCGWSVEGVTVPTQDAVTVTAQVSLALSGQEAVDG
FT                   WLKEAAAATTQAVSDAEVSGASYPVQRLRDIQVTTPARTVGGTALPVTLLPVWPSGPDP
FT                   VNPLFTSPSVGAPSAMLDAVAGGTAGVRFSDGCAGALTVSSDGLVVTALSVAPDCTVRA
FT                   RVGNFTDLVSPPFGITTR"
FT   regulatory      complement(515228..515233)
FT                   /locus_tag="MTES_0496"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(515324..515653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0497"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0497"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73461"
FT                   /db_xref="InterPro:IPR002767"
FT                   /db_xref="InterPro:IPR029756"
FT                   /db_xref="UniProtKB/TrEMBL:E8NBK1"
FT                   /protein_id="BAJ73461.1"
FT                   /translation="MLVAFSVAPSGTGSLSAENPDGSVHAAVAAAVAVVRASGLPHRTT
FT                   SMFTEVEGEWDEVFDVVKRATDAVLPYGSRVSLVLKADIRPGHTGEIDGKIERLERAID
FT                   DAASE"
FT   CDS_pept        complement(515664..516968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0498"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0498"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73462"
FT                   /db_xref="GOA:E8NBK2"
FT                   /db_xref="InterPro:IPR018584"
FT                   /db_xref="UniProtKB/TrEMBL:E8NBK2"
FT                   /protein_id="BAJ73462.1"
FT                   /translation="MLRRVVPLLIAFVAVHVTVAILGYQQPNEPMGDVYLVYEPWSRCA
FT                   LFGGVDVTSCTRSATWEWPGITEKWIYPQLAFLPMTFAWVFAWAITYTPAWALTVALAN
FT                   FVAFVILVGKGRSRGRVLGAWFWLAAILLIGPVGLYRIDGITVPFAILGSIWLVRRPFL
FT                   ASVLLSIAVWMKVWPAAILAAGLIVVRRRLALVWGAVAVSLATVIPVVALGGAPFVLGF
FT                   VGDQTSRGIQMEAPVGGLYMILASFYVPGSEVYYDGGVLTFQVTGPGVDPVIAIMTPLM
FT                   LLVMAGVAVVGARKLWAGATFVALFPPLALALVTAFIALNKVGSPQYYVWVFAPVILGL
FT                   MIDRRRWYGLAALTLVIAGLTQWMYPMVYDGLMATHPAPFPVFLLETRNVLALVLMVWA
FT                   IVRVVRVPVGRVTRPADLREFVTGRKTPAMAATAD"
FT   regulatory      complement(515664..515669)
FT                   /locus_tag="MTES_0497"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(516976..516981)
FT                   /locus_tag="MTES_0498"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(517044..517952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0499"
FT                   /product="predicted sugar kinase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0499"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73463"
FT                   /db_xref="GOA:E8NBK3"
FT                   /db_xref="InterPro:IPR000631"
FT                   /db_xref="InterPro:IPR017953"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:E8NBK3"
FT                   /protein_id="BAJ73463.1"
FT                   /translation="MLTSDLCVLWWPSSLAIMTAKEWTGEDASHALRRPTALDDKYSRG
FT                   VVGLRTGSARYPGAAMLGVEAAWRTGTGMVRYLGPERAQDLVLQRRPETVTADGRVQAW
FT                   VIGSGTDAAERDAAETAALRGILNGDLPVVVDAGALDLVVGAAAPVVVTPHARELDRLR
FT                   ADLGLSRADATDDAAREEAALETAAALGGVVLLKGAVTIVATGDGWVRRVGAGTPWLAT
FT                   AGTGDVLAGVLGAVTAGAVAADRRGLDDLAACAATAAWLHGTAGRVASGISGGEGGPIT
FT                   ALDVAEALPRVVAGVLSDSIG"
FT   regulatory      517934..517939
FT                   /locus_tag="MTES_0500"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        517945..519003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0500"
FT                   /product="NADH:flavin oxidoreductase, Old Yellow Enzyme
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0500"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73464"
FT                   /db_xref="GOA:E8NBK4"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:E8NBK4"
FT                   /protein_id="BAJ73464.1"
FT                   /translation="MSTLFTPLSVRGIETRNRLWVSPMCQYSATDGMPNDWHHVHLAQF
FT                   AAGGAGLVIAEATAVSPEGRISPDDVGLWNDPQAEAWAPVVAAIRARGSVAGVQLGHAG
FT                   RKASTTSPLTGGRGSVAPADGGWTTVAPSALAYDSFAAPVALDTAGIEKVVTDFADAAR
FT                   RAVAAGFEVIEVHAAHGYLLHQFLSPLTNHRDDAYGGSFENRVRLVVRVTEAVRAAAPD
FT                   AAVFVRFSATDAAEGGWDLADTVAAARLVAAAGADLIDVSSGGLVPEQHIVPGPGYQVD
FT                   YAATIRRETGLLVAAVGMIDDPTFGEQILADGRADAILSGREWLRDPHYALRAAAALGA
FT                   PVPAPAQYVRAY"
FT   CDS_pept        complement(519272..520327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0501"
FT                   /product="hemolysins"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0501"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73465"
FT                   /db_xref="GOA:E8NBK5"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="UniProtKB/TrEMBL:E8NBK5"
FT                   /protein_id="BAJ73465.1"
FT                   /translation="MSDWAGIAWLVVLLVANAFFVGAEFAVISARRSQVEPLADRGSRA
FT                   AKTALYAMEHATLMLATCQLGITICSLLILNVSEPAIHHLLAGPLGLTGLPEAAVDIAA
FT                   FIVALLVVSYLHVVFGEMVPKNLAFSLPDRAVLMLAPPLVAVSKAFYPIIVALNWTANH
FT                   VLRLFRVEPKDEAASTFTLDEVATIVNQSRREGVLDDSAGTVTAVVEFTEKKAADIAVP
FT                   MAQLVTLPERTTPGEIERAVAQHGYSRYVIVDEAGHPTGYVHLKDVLRAADGSDADMAR
FT                   PIPSKRIHHMVSVLETTDLEDALALMRRSGRHLAQVRDEAGDVRAVLFLEDVIEELVGE
FT                   VQDATARRRFA"
FT   CDS_pept        complement(520324..521667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0502"
FT                   /product="hemolysins"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0502"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73466"
FT                   /db_xref="GOA:E8NBK6"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:E8NBK6"
FT                   /protein_id="BAJ73466.1"
FT                   /translation="MDYVMLGVGLLLTVGTGLFVASEFALVNLDRADLEARREAGESRL
FT                   SLTIDALRITSTHLSSAQLGITLTTLLTGYTMEPAISNLLRPAFDSWGLPEALTVSVAS
FT                   VIGVGVATVLSMILGELVPKNFALAIPRQTAKLVIPFQVAFTAVFKPAIVLLNGSANGV
FT                   LRAMGVEPKEELSGARSAEELSSLVKRSASAGMLEKDTASLLDRSLTFARLSAADVMTP
FT                   RPSVHALAAGDPTDDVVQLARRTGHSRFPVYGESMDDIVGVVHLKAAIGVPREKRGEVP
FT                   VAALATEPLRVPETVHLDALVSELRSRGYQMAIVVDEYGGTAGIVTLEDLVEEIVGEVL
FT                   DEHDRSRAGVVRTAVSLTFPGDLRPDEALDRAGVRVPEGEAYDTVGGFIMAALERIPAV
FT                   GDTVETEDGVLTVNRMDGRRVDRVQYTANPVEENIGDLVRAAKGGDQR"
FT   regulatory      complement(520339..520344)
FT                   /locus_tag="MTES_0501"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(521676..521681)
FT                   /locus_tag="MTES_0502"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      521818..521823
FT                   /locus_tag="MTES_0503"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        521829..522860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0503"
FT                   /product="predicted glycosyl hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0503"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73467"
FT                   /db_xref="GOA:E8NBK7"
FT                   /db_xref="InterPro:IPR005198"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="UniProtKB/TrEMBL:E8NBK7"
FT                   /protein_id="BAJ73467.1"
FT                   /translation="MDATIPAQARAMAAESAVVRRFVHRHGPVAWAHAAAPGVPRARTW
FT                   HYWWHAHLLHAFSDAQDHRPDPRRARLLRELHRGVTLRTLGRWTTPFYDDVAWMTLALQ
FT                   RLDLGDRRLERLVRRLDDAIDPAVGALPWAVGSDLYNAPANSPAAIALAWTSRRGSAVD
FT                   LDAWVAATLDDPETGLVRDGIEHGVVRSELWTYNQGVAIGSALALAEAAPDADSRDAHL
FT                   ARAAALVDAVERWCAPDDGLFPAAGGGDGGLFAGILARYLAEAAVSFGDAPADDPRRAV
FT                   SESARRLVRINADALWRGRRADLFPADPRRTAHAEGDDLDLSVQLGAWITLEADVAASA
FT                   LTS"
FT   CDS_pept        complement(522850..524304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaB"
FT                   /locus_tag="MTES_0504"
FT                   /product="IMP dehydrogenase/GMP reductase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0504"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73468"
FT                   /db_xref="GOA:E8NBK8"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005990"
FT                   /db_xref="InterPro:IPR005991"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:E8NBK8"
FT                   /protein_id="BAJ73468.1"
FT                   /translation="MEFSGAQPDVDLTYSDVFLVPRHSEVRSRLDVDLAPGDGSGATLP
FT                   LVSANMNSVTGTRLAATLARRGGLGVLPQDLALPDLVDAVGRVKAQPVAWDAPLVLPPS
FT                   ATVADARLVLPPVPGRGIVVAEAREDGVIALTDFRGIVPAPRLATALPDATLGDIARTD
FT                   APLVEVARVGDPREIFALVGEADIVAVVDGDRVVGTLSARSALRDSVYRPAVDADGRLI
FT                   VAAAVGVNGDVAGKARALAAAGVDVLVVDTAHGHQAQMLRALREVAALDLGIPIAAGNV
FT                   VTAEGVRDLTDAGASILKVGVGPGAMCTTRMMTAVGRPQFSAVLETAEAARSVGAHVWA
FT                   DGGVRYPRDVALALAAGAASVMIGSWFAGTIESPGRLRTDEGGRVYKESWGMASTKAVQ
FT                   GRFGRLDPFERARKELFAEGISSSRIYLDPQRPGLEDLLDMITSGVRSSFTYAGAATVA
FT                   EFHERARVGLQSAAGYEEGKALPVSW"
FT   regulatory      complement(524313..524318)
FT                   /gene="guaB"
FT                   /locus_tag="MTES_0504"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      524427..524432
FT                   /gene="kgd"
FT                   /locus_tag="MTES_0505"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        524444..528121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kgd"
FT                   /locus_tag="MTES_0505"
FT                   /product="2-oxoglutarate dehydrogenase complex,
FT                   dehydrogenase (E1) component"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0505"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73469"
FT                   /db_xref="GOA:E8NBK9"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR011603"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR031717"
FT                   /db_xref="InterPro:IPR042179"
FT                   /db_xref="UniProtKB/TrEMBL:E8NBK9"
FT                   /protein_id="BAJ73469.1"
FT                   /translation="MSSQVTGVGTSNEGEFGANEWLVDELYEQFKVDKHSVDKAWWPIL
FT                   EAYHPVVDESAAAGSPPSAPAAEPKPVTAPIPVVGQTPVARTTTKPAKPQPIPAQAPTA
FT                   APSAGSESTEEDRVTVLKGMPKALASNMDDSLTVPTATSVRTIPAKLMIDNRIVINNHM
FT                   SRTRGGKVSFTHLIGWALIQALKEFPSQNVYYAEIDGKPSVVAPAHINLGIAIDMPKPD
FT                   GSRALLVPSIKRADTLTFGEFLASYEDLVRRARNNKLTPADFQGTTISLTNPGGIGTVH
FT                   SVPRLMRGQGAIIGAGALDYPAEFQGSSAKTLNELAIGKTITLTSTYDHRVIQGAGSGE
FT                   FLKKVHELLIGQRGFYDDIFAALRIPYAPIHWAADINVDVSERIDKSARVQELINSYRV
FT                   RGHLMADIDPLEYVQRTHPDLEIESHGLTFWDLDREFVTGGLGDRRVAKLRDILGVLRD
FT                   SYCRTIGVEYMHIQDPIQRKWFQSNVEVKYIKPGHDEQLRILSKLNQAEAFETFLQTKY
FT                   VGQKRFSLEGGESLIPLLDQILQGAASKGLDGAAIGMAHRGRLNVLTNIGGKTYGQVFR
FT                   EFEGAVAIGSKRGSGDVKYHLGTEGTFVGDNGEELPVYLAANPSHLETVDGVLEGIVRA
FT                   KQDRKPIGSFSWLPILVHGDAAFAGQGVVVETLQMSQLRGYRTGGTIHVVVNNQVGFTT
FT                   TPTDARTSVYATDVAKTIQAPVLHVNGDDPEAVVRAAELAFLYREEFHRDVVIDLVCYR
FT                   RRGHNEGDDPSMTQPLMTNLIEAKRSVRRLYTEALVGRGDITEDEYEQAKQDFQNRLEV
FT                   AFADTHEAETGTNPVVSTEAADEVPTGAPETTGVSREVVHHIGDAFVNKPDGFTVHNKL
FT                   QQLLEKRFDMSRNGGIDWAFGELLAFGSVLMEGTPVRLAGQDSRRGTFVQRHSVLHDRK
FT                   NGQEWLPLANLSENQGRFWVYDSLLSEYAAMAFEYGYSVERSDALVLWEAQFGDFANGA
FT                   QSVIDEFISSADQKWAQQSSVVLLLPHGYEGQGPDHSSARIERYLQMCAQDNMIVARPS
FT                   TPASYFHLLRRQAYQRPRRPLIVFTPKAMLRLRGATSPVEDFLEGRFEPVLDDDRGLDA
FT                   GAVTRVLLHAGKIHWDLRAELDKNPNPEIALVRLEQYYPAPIDELNRVLATYPNAELVW
FT                   VQDEPENQGAWPFIALEVDDKLGRPIRVISRAAAASTATGSPKVHANEHAEIMKAALAR
FT                   "
FT   CDS_pept        complement(528192..529493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0506"
FT                   /product="predicted esterase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0506"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73470"
FT                   /db_xref="GOA:E8NBL0"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E8NBL0"
FT                   /protein_id="BAJ73470.1"
FT                   /translation="MNRFLLSFELIDSPLLVICAVVAGVGALAVIVWKPRWIIGTLLIG
FT                   VAAGIAMYVVAHILEAQGLFQGPLPAHAATWATGGIVAVAVGVVGICRRPWGRRVVGVV
FT                   TVLAGLLTAALGVNTSYGVTHNLAAILGVQALDPASLPAPTATAGDPATLYQDWQPPAG
FT                   MPSQGSVSALTGDAKIPTGQYAARDGSLYLPPAAQVANPPALPLLVFMMGQPGSPDPTN
FT                   LAKALDAFAAKHNGLAPIAVVVDQLGAADRDPGCVDSAKFGAVSTYINELVPKWAEAKL
FT                   NIVKDHRYWTIGGFSNGGSCAAVYGAKYPQVWGQMLDIMGNEFPGSEHVEQTVTDVFGG
FT                   DAGAFQATKPSVIMGAAPAGSYTGHLAIFTWGSLDTTYGPGQKANADAAQAAGFTVVTY
FT                   VVEGAGHTGEALDASLAYSLPVLAPVLGLAPPAS"
FT   CDS_pept        complement(529490..532003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0507"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0507"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73471"
FT                   /db_xref="GOA:E8NBL1"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR024320"
FT                   /db_xref="UniProtKB/TrEMBL:E8NBL1"
FT                   /protein_id="BAJ73471.1"
FT                   /translation="MSDAPPSSPPRRSRLRVDPRAVAAALAGFLRANPVAVCVAILITA
FT                   SAAATGTLWGEDALIWGAGPLATFASGRWWTIATALFVPDSPVDAITSIVLALTVLAAA
FT                   ERLLGSRRTGILYLVIGVVGLLAGVGMHAAVWSVTDLRPVVAAEVPVLDPTTPIAGVVM
FT                   VASAFALTLWRRRLRLVGFALLALFALYAGDADSWYRIITAAIGLVVGAVLARGIERRS
FT                   WHRSSTRETRTLLALMVAVVGSGPLVALISGGGRGPLSLVVDAYTQYDDALLARCDTLT
FT                   EAVCNEQIALLMTRGLGPALLAIVPLVLMLIAAWGLRQGRRSALILAVLTLVASGITPL
FT                   VSLTNGRLRIDPWVDGSGAEYVLWALASVVIPLMLAGALVIARHRFPVRATRRAARTVA
FT                   IVIGVAFVAIGSGFFVTEELGRRAFDRDISVIDMLGLTLRRFFPPSYTTPGASGFPHHG
FT                   VALFAYQWTGVLFWAIVIAAILWLYRRVQRPDADDDTLYRTLLRRGSDTLGFLGTWAGN
FT                   RHWSSADRESAIAYRLVGDVALAVADPLTPPGGRPEALRGFTDFCLEHGWIPAFYSIHA
FT                   ETAADLSDLGWRQIPVGVETVMDLPGLTFAGKAWQKVRQPLTRAEREGYTAVWTRWHEL
FT                   TVSQASQVVAIDEEWVADRALPEMGFTLGSLEELRDRDVRLLLAVGPDDRIEAVTSWMP
FT                   SWTDGELTGWTLDFMRRRAEGPNGMMEFLIAKAALQLQEEGATVLSLSGAPLADDPDEP
FT                   ADGDPAPLRALLRWLAEVLEPAYGFASLFRFKGKFRPRYRQLSLAYRDPLQLPSIGAAV
FT                   GRAYLPDASRREIVALARTAWEGRR"
FT   regulatory      complement(529503..529508)
FT                   /locus_tag="MTES_0506"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(532042..533352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0508"
FT                   /product="predicted acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0508"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73472"
FT                   /db_xref="GOA:E8NBL2"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR022902"
FT                   /db_xref="InterPro:IPR025559"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="InterPro:IPR041380"
FT                   /db_xref="UniProtKB/TrEMBL:E8NBL2"
FT                   /protein_id="BAJ73472.1"
FT                   /translation="MPTTDTRTLALDATSAADLQATGLEYTLVSADDAAFEPFLRAVSR
FT                   GFLGEEPSADEVESARRALTPRRLTGVFDRAGIDPDSPVATVDSWPTELTVSPGRTIPL
FT                   WSISAVTVAPTHRRRGIARAMLTGELRTAAAAGFALAGLTVTEATIYGRWGFSPAVWAS
FT                   DVVVDTRRARWTGPVAPGRLDFVSPESLPERLSRVHERVRVERPGAVPGWEGRWRGVAG
FT                   LTPDAKDAKKVRAVSYRDTAGEERGILVYTLDSGPHGDFSPHVLTVRALFADGDEATAA
FT                   LWRFAIEHDLVGEVKASLQPTTPPVQWMIADRRAVTVTPTDHHWLRVLDVPAALSARRY
FT                   ARALDVVLRVEDPLGFADGAWNVRIDVDGSAVVERAPEDRAVDLEMTVGALGSLLLGGV
FT                   RVRDLAAAGLVRGPRESQAAVDAAFTPEVTPLLDIWY"
FT   regulatory      complement(533358..533363)
FT                   /locus_tag="MTES_0508"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(533386..533628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0509"
FT                   /product="predicted transmembrane transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0509"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73473"
FT                   /db_xref="GOA:E8NBL3"
FT                   /db_xref="InterPro:IPR027383"
FT                   /db_xref="UniProtKB/TrEMBL:E8NBL3"
FT                   /protein_id="BAJ73473.1"
FT                   /translation="MSDCGCDQARRDLEEYLRNEVCKTQHRDIREHLENCPGCQDEALV
FT                   ARTLTEVVARACKETAPEELRDQVLARLRSVQAAH"
FT   CDS_pept        complement(533625..534311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sigH"
FT                   /locus_tag="MTES_0510"
FT                   /product="DNA-directed RNA polymerase specialized sigma
FT                   subunit, sigma24 homolog"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0510"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73474"
FT                   /db_xref="GOA:E8NBL4"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014293"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:E8NBL4"
FT                   /protein_id="BAJ73474.1"
FT                   /translation="MTALLERSGVQPTIPMVVDTPDVDWRVMDDTADTLPPVAEPRAQF
FT                   EEQALPFMDQLYAAAMRMTRNPADAADLVQETFVKAYGSWATFTQGTNLKAWLYRILTN
FT                   TYINTYRKKQREPYQSAIDDLEDWQLGGAESTTATSARSAEAEAIDHMPASVVKDALQS
FT                   IPEDFRLAVYLADVEGFAYQEIADIMKTPIGTVMSRLHRGRRLLRDLLSDYAKERGFQA
FT                   ATGEKK"
FT   regulatory      complement(533632..533637)
FT                   /locus_tag="MTES_0509"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(534319..534324)
FT                   /gene="sigH"
FT                   /locus_tag="MTES_0510"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      534334..534339
FT                   /locus_tag="MTES_0511"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        534343..535692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0511"
FT                   /product="5-enolpyruvylshikimate-3-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0511"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73475"
FT                   /db_xref="GOA:E8NBL5"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR006264"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR023193"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/TrEMBL:E8NBL5"
FT                   /protein_id="BAJ73475.1"
FT                   /translation="MTRLGYSPSAATPRGAWNAPVADGAVDATVTVPGSKSLTNRELVL
FT                   AAIADGPGMLHAPLHSDDSVRMVEALRALGVGIEEVATDSPFGPDLLVTPPASFAGDTT
FT                   VDCGQAGTVMRFVAPLAGLARGDVAVTAHESALHRPMGAMISALRDVGVDIDDGGHWAL
FT                   PFTVRGHGHVRGGEVEIDASQSSQFVSGLLLAAPRFDVGLHLRHVGSRLPSIPHIDMTV
FT                   EALGHRGIHVERPSVGEWIVPAGPVRAKDVAIEPDLSNAAPFLAAAMVTGGTVSVTGWP
FT                   LHSTQPGALLADILSEMGARVSRRGGTLTVSAGDRIVGLELDLSATGELAPTLFGLAAF
FT                   ADGPTTLHGIGHIRGHETDRIAALVGNLRSLGGEAHELEDGIRIVPQPLRGGEWKAHHD
FT                   HRLATTGALIGLRVPGVEIDDIGTTAKTLPQFAGLWRTMLGLDEDADATR"
FT   regulatory      535696..535701
FT                   /locus_tag="MTES_0512"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        535708..536766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0512"
FT                   /product="predicted GTPase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0512"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73476"
FT                   /db_xref="GOA:E8NBL6"
FT                   /db_xref="InterPro:IPR004881"
FT                   /db_xref="InterPro:IPR010914"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030378"
FT                   /db_xref="UniProtKB/TrEMBL:E8NBL6"
FT                   /protein_id="BAJ73476.1"
FT                   /translation="MSWLDDPDDDDLEYDESSIRVRPNPKANRPRTKRRPAHADARIAR
FT                   VLGVDRGRYTVLLDEDEPTERRVLATRARELRKQPIVNGDRARVVGDLSGDEGTLARIV
FT                   GIEERTSLLRRSADDTDQVERVIVANADQMLIVVAAADPEPRERLVDRYLVAALDAGIR
FT                   PLLVVTKTDLADPTEFLSHFDGIDLRVFTSAQGAMPLDEIGEAIAGHSTVFVGHSGVGK
FT                   STLVNALTGSERAIGHVNTVTGRGRHTSSSAVSLRYRGPAGSGWVIDTPGVRSFGLGHV
FT                   DPAHVLGAFTDLAQAAEDCPRGCTHLPDAPDCAIAEAVASGRLGPGAEARLDSLHRLLT
FT                   TFQAIERSRLEG"
FT   regulatory      536752..536757
FT                   /gene="bcp"
FT                   /locus_tag="MTES_0513"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        536763..537233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bcp"
FT                   /locus_tag="MTES_0513"
FT                   /product="peroxiredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0513"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73477"
FT                   /db_xref="GOA:E8NBL7"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E8NBL7"
FT                   /protein_id="BAJ73477.1"
FT                   /translation="MTNLAKGDTAPDFTLLDQDEHPVSLSDFRGRRVIVYFYPAAQTPG
FT                   CTTQACDFRDSLSSLQGAGYTVLGVSRDTPEKLRAFRDSDGLTFPLLSDPDHTVHEAYG
FT                   AWGEKQNYGKTVTGVLRSTFVIDEDGTIVEAQYNVKATGHVARLRKALGLAA"
FT   CDS_pept        complement(537230..537652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0514"
FT                   /product="transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0514"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73478"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:E8N710"
FT                   /protein_id="BAJ73478.1"
FT                   /translation="MTLVTPGQAGDSPMLLPLLAELRVTRPVGRPRTRPDRVRGDKAYS
FT                   SRAIRAHLRSRGIEAVIPEPRDQQGHRKRRGSRGGRPVSYNPVDYRNRNVIERGFCRVK
FT                   QWRGLATRYDKLAIVYRAAVVLNAVIAWLRHLQDTP"
FT   regulatory      complement(537661..537666)
FT                   /locus_tag="MTES_0514"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(537729..538124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0515"
FT                   /product="transposase and inactivated derivatives"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0515"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73479"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="UniProtKB/TrEMBL:E8N709"
FT                   /protein_id="BAJ73479.1"
FT                   /translation="MSRFVLLSDDQFVLIADLLPGPTGRKGRPFADARTMVEGIVYRYR
FT                   TGIAWRDLPRTFGPWQTVWAWHRRLAADGTWDVVLDRLVSAADTAGAVDWSVSVDSTIA
FT                   RAHQHATNISRVTGGFVELHESATRAA"
FT   regulatory      complement(538133..538138)
FT                   /locus_tag="MTES_0515"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(538272..538658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0516"
FT                   /product="signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0516"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73480"
FT                   /db_xref="GOA:E8NBM0"
FT                   /db_xref="UniProtKB/TrEMBL:E8NBM0"
FT                   /protein_id="BAJ73480.1"
FT                   /translation="MPVRLSAALILGLEALGILALAGWQVVALIGGDTDSVVSSIALIV
FT                   LTVIGAAIVAAFGVATARGVSAGRSGGIVTQLLILSVALGAITGEWAAPAVALLIAVPA
FT                   VVGLVLLILAVRAAAPRRRDDDAN"
FT   regulatory      complement(538667..538672)
FT                   /locus_tag="MTES_0516"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      538859..538864
FT                   /locus_tag="MTES_0517"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        538873..539121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0517"
FT                   /product="regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0517"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73481"
FT                   /db_xref="GOA:E8NBM1"
FT                   /db_xref="InterPro:IPR003482"
FT                   /db_xref="InterPro:IPR034768"
FT                   /db_xref="UniProtKB/TrEMBL:E8NBM1"
FT                   /protein_id="BAJ73481.1"
FT                   /translation="MDWRDKAACLTVDPELFFPVGNTGPAVDQIEKAKSVCARCTVTEV
FT                   CLQYALESGQDSGVWGGLSEDERRALKRRAARARRAS"
FT   CDS_pept        complement(539300..540796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0518"
FT                   /product="signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0518"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73482"
FT                   /db_xref="GOA:E8NBM2"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011102"
FT                   /db_xref="InterPro:IPR011495"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR022066"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR038424"
FT                   /db_xref="UniProtKB/TrEMBL:E8NBM2"
FT                   /protein_id="BAJ73482.1"
FT                   /translation="MSTLSELVYAQGRASEADVEWLHRLAGDGQLLADLAFADIVIWVP
FT                   TPDDSFVAVAHTRPGGAATLFYRDIVGDRVRPQWRTQVRDAFQSGRIVDSASPDWFEET
FT                   PTRVRAVPIVRELSREGNAVTTVGVLTRHTNLGETRTPSRQQITFNDCADDLFGMIASA
FT                   EFPDLAAPTAPRRGAPRASDGLIRLDVDGITTFASPNALSAFNRMGFDDELEGESLAEV
FT                   TARILPAKRQDVDESLPVVVSGRAPWRADMEARGVQVSLRTIPLRDRGTRVGAIVLSRD
FT                   VTEIRHQEQELITKDATIREIHHRVKNNLQTVASLLRIQARRTHSDEARDALTQAMRRV
FT                   SAIAVVHDTLSEGLAQNVDFDDVFARVLKLVAEVAAAPNTRARTRTTGQFGTLPSQFAT
FT                   PLALALTELVTNAVEHGLAGQEGDVEIAAERSDEVLAVSVRDTGVGLPEGQVGRGLGTQ
FT                   IVRTLIQGELGGTIDWHTLMGSGTEVTIEIPLRYIGGSSV"
FT   regulatory      complement(540800..540805)
FT                   /locus_tag="MTES_0518"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      540935..540940
FT                   /locus_tag="MTES_0519"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        540953..541225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0519"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0519"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73483"
FT                   /db_xref="GOA:E8NBM3"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:E8NBM3"
FT                   /protein_id="BAJ73483.1"
FT                   /translation="MSSPASRYLDPDAVAERLGITRDEVLSLVERGEIRAIEVGDPARW
FT                   RLDAESVASYIDDRIEVARRSALWRQSQEASFPELWGEGQIRHPD"
FT   regulatory      541348..541353
FT                   /locus_tag="MTES_0520"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        541359..541793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0520"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0520"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73484"
FT                   /db_xref="UniProtKB/TrEMBL:E8NBM4"
FT                   /protein_id="BAJ73484.1"
FT                   /translation="MTVPLSIVDSPVGASPSYAEDFFAPQKTSAARLPRADVFTRNIVR
FT                   GVFEVLAGVREVEQLARWTSEEVYRSLVVRASLAKRARSARGVPVPRDIHEIRSVHLFS
FT                   PADGVYEATVTAAARARTRAVALRLEGIDGRWRVTALALL"
FT   CDS_pept        complement(541797..543023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aspC"
FT                   /locus_tag="MTES_0521"
FT                   /product="aspartate/tyrosine/aromatic aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0521"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73485"
FT                   /db_xref="GOA:E8NBM5"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:E8NBM5"
FT                   /protein_id="BAJ73485.1"
FT                   /translation="MSPLRPLDQSSKLKDVLYEIRGEALVEADRLEAEGHAILKLNTGN
FT                   PAIFGFEAPHQIVRDMIAAVPNAHGYSDSRGVLSARRAVVSRYEEEPGFPHLDPDDVYL
FT                   GNGVSELITMTMQALLDEGDEVLIPAPDYPLWTAMTSLGGGTPVHYLCDESREWQPDLE
FT                   DIRSKVTPRTKAIVVINPNNPTGAVYSREVLEGIADIAREHSLLVLADEIYDRILFDDA
FT                   VHIPMATVAPDLLVLTFNGLSKTYRVAGYRSGWLAITGPKSHAEGFLHGINLLASTRLC
FT                   PNVPAQFAVQAALSGVQSIDALIAPSGRLHEQRDAAWQGLEAIPGVSCVMPRGALYAFP
FT                   RFDPDVYEIPDDAKFVRDFLVAEHVLLVQGSGFNWPATDHVRIVTLPEARVISDAIERL
FT                   GNFLASWRP"
FT   regulatory      complement(543032..543037)
FT                   /gene="aspC"
FT                   /locus_tag="MTES_0521"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(543137..545941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secA"
FT                   /locus_tag="MTES_0522"
FT                   /product="preprotein translocase subunit SecA"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0522"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73486"
FT                   /db_xref="GOA:E8NBM6"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR020937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036266"
FT                   /db_xref="InterPro:IPR036670"
FT                   /db_xref="UniProtKB/TrEMBL:E8NBM6"
FT                   /protein_id="BAJ73486.1"
FT                   /translation="MANPLEKLLRAGEGRILRRLQGVVKATGALEEDYEHLTDEELRNE
FT                   TVELRARYEAGETLDQLMPEAFAAVREAAKRTLGQRPYDVQIMGGAALHLGNIAEMKTG
FT                   EGKTLTAALPAYLNAIAGKGVHVITVNDFLASYQSELMGRVYRALGMTTGTVVSGQTPE
FT                   VRREQYEADISYGTNNEFGFDYLRDNMAWRKEDLVQRGHFFAIVDEVDSILIDEARTPL
FT                   IISGPASGEANRWFAEFAKLARTLEAGVDYEVDEKKRTIGVLEPGIEKVEDYLGIDNLY
FT                   ESANTPLISFLNNSIKAIALFKRDTDYVVMNDEVMIVDEHTGRILVGRRYNEGIHQAIE
FT                   AKENVPVKAENQTLATVTLQNYFRLYDKLAGMTGTAETEAAEFMSTYKLGVVPIPTNKP
FT                   MIRKDQSDLVYKNETAKFAQVVEDIVERHEKGQPVLVGTTSVEKSEYLSRLLAKKGVKH
FT                   EVLNAKNHAREAEIVARAGRLGAVTVATNMAGRGTDIMLGGNAEFLAVQEMKAKNLDPV
FT                   ETPEAYEAEWDAVYQGMRDTVAEEAAKVVEAGGLYVLGTERHESRRIDNQLRGRSGRQG
FT                   DPGESRFYLSLTDDLMRLFQSGAAEAILARTNFPDDVAIESGLVSRAIKSAQSQVEARN
FT                   AEMRKNVLKYDDVLNRQREAIYADRRHMLQGDDIADRVQHFIEDAITAVIDDHTGSGHT
FT                   ESWDFDALWTELKTLYPVSVTIDEVVAEAGGNKGRITAEGLKREIISDARIAYQNREES
FT                   LGAPALRELERRVVLQVLDRRWREHLYEMDYLKDGIGLRAMAQRDPLIEYQREGYQMFQ
FT                   SMMGQIKEESVGFLYNLEVEVRKVEGEDSAQVEAKGLAPAPVEGQRLEYSAANDAGEVE
FT                   VRNDRGQVQQAATNRLRQAAAQAPAAEAAAPSGPRGAFGQRTEAPEQPVANNRADRRAA
FT                   GKKK"
FT   regulatory      complement(545949..545954)
FT                   /gene="secA"
FT                   /locus_tag="MTES_0522"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      546103..546108
FT                   /locus_tag="MTES_0523"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        546115..547434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0523"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0523"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73487"
FT                   /db_xref="UniProtKB/TrEMBL:E8NBM7"
FT                   /protein_id="BAJ73487.1"
FT                   /translation="MAGFWGRRKREEQDAADADLARRAELAIVAADERVRLTSDELDFA
FT                   RAELGDKATEDLAAALDSVKTHLAEAFQLHQLNHDEIPDTAEELRTRNARIIQLSKWAE
FT                   DLLEERTLVLQPKIDAVRRAPEILARVRADRERLAERVPHAREVVERLAHRYSDTALQQ
FT                   IGGNPDEIDQLLDFAVHTAGVSERRREAGQREQASVALEAATEAVRRAESLLDAVDTFE
FT                   IEALRAESTLAAVIDDSRGDLAEARRGPMTPIVTQAMVNLERALASLPPAGSRTDPFSS
FT                   LSVLRQANAELDLARERAARPVPSQEQVEHAIDDADRQLAVARGLITGHRGWIGADART
FT                   RFVEAERLRAGLPLGPVAEDDRETALATARRTGALAAEALQIAQRDIEQSRPSDWGDGG
FT                   GGGWGGGYGRGGGGGGGGNMVGGMLGGLVIGSLLGDIFDG"
FT   CDS_pept        complement(547499..548158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0524"
FT                   /product="ribosome-associated protein Y (PSrp-1)"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0524"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73488"
FT                   /db_xref="GOA:E8NBM8"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR032528"
FT                   /db_xref="InterPro:IPR034694"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="InterPro:IPR038416"
FT                   /db_xref="UniProtKB/TrEMBL:E8NBM8"
FT                   /protein_id="BAJ73488.1"
FT                   /translation="MDTNIVGVGVGITDRFRSVVEEKVSRIEHLAPRAQALEVKVTHRS
FT                   YRNGRMEDDTVELTLDGKGPVVRAEATDADKFAALDLAVDKISEQIRRAKDKRIDARNH
FT                   PRGAKFEKGTGELSGIDVQPASVDVLRAVATGEVPVQNDSDTEEDYSPVVIREKEFGAE
FT                   WMTAEEAVDRMELVGHDFFLFIDARTDHPSVVYRRKGWDYGVIALSTQAPPQAVAS"
FT   regulatory      complement(548166..548171)
FT                   /locus_tag="MTES_0524"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(548299..548970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0525"
FT                   /product="predicted amidophosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0525"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73489"
FT                   /db_xref="GOA:E8NBM9"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:E8NBM9"
FT                   /protein_id="BAJ73489.1"
FT                   /translation="MSSHAVPPKAVVAALHDALTFWLPIACAGCGLVDVGLCSGCRAAL
FT                   AASPHHRRTEAGLAVTSALEFSGVPARVLRALKEEGRTSLARALAPALASVIASVLAEA
FT                   VGDDAVVTTVPSSRAAYRRRGYRPVDLLVRRSGWRPVPLLRVARSPRDQRGLDRAARRA
FT                   NVGGVFVSRPVRGRDVVLIDDVVTTGATLDDAARAVRVAGAGRVIAVTLAHTPRHRDRG
FT                   A"
FT   regulatory      complement(548978..548983)
FT                   /locus_tag="MTES_0525"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(549068..550726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0526"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0526"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73490"
FT                   /db_xref="InterPro:IPR018910"
FT                   /db_xref="InterPro:IPR019606"
FT                   /db_xref="UniProtKB/TrEMBL:E8NBN0"
FT                   /protein_id="BAJ73490.1"
FT                   /translation="MRRALSLLSLTLVLVLSACTGLPTAGYVNPGRGPQTDDTQTFAFV
FT                   PDGPQDDASPAEIVEGFLRAGSGPADDWATAKLFLAPGTQWDPRARVTIDRLADRRAAA
FT                   SSDGATVTVSLSTVASVDANGAYSPSVDGTTESLGYSLTKVDDQWRISAAPDGVVLYEE
FT                   VFPTVYQSASVAYFDPTWTFIVPDVRWFPRPLVASRVATALVDGQPSAWLEGAVKSAFP
FT                   EDLSLVGRSVTLSSGGVAQVQLPRAALSLDTTTLNRMQTQLTRSLSTAGISQVQMTVEG
FT                   TPVAAEEVPVRVTRVDPPPAVVTADGTFGILSGDQVTTIPGLSDAVESLGPQSVELEAD
FT                   RSLAAVRTAQGTVASALADGRTFLLDDRPGLVAPSIDSSGLIWSVPSSSPAQLRAFTPE
FT                   GVPAEIGNAWPDASEITAFQISRDGTRVAAIVTVAGVREVWLAGIQRTTNEINLGPPHV
FT                   LSFTESGAFDLAWLDDATLGILTVDAGVSHLGELGVGGRGTIGAAPDGARTVAGGSTSV
FT                   RVLDDSGHLYSRRGSSWTLVADDIRVLAAQQGTTS"
FT   CDS_pept        complement(550723..552414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0527"
FT                   /product="signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0527"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73491"
FT                   /db_xref="GOA:E8NBN1"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E8NBN1"
FT                   /protein_id="BAJ73491.1"
FT                   /translation="MTGAVRTLASPRGWSTRDWRATRDRVITLWRRSLRFRTIVITVAL
FT                   TATTILVTCLAMALVIQNELFTARKDQVLLEAQRATASAQATLDAAVDSTDPAAAQTLM
FT                   NGIATRLSQQSSSDLIALYRIGPPSPLAPQPFISPTFESALVTPELRTQVQSSPDLQWW
FT                   QSVALPAENDREVPGILVGHQLRFPAQDGVDYYELYMGYDLASAAQTLSFVQVLLWVVG
FT                   LILVVLIGAIAWVVLRSVTTPIADAAETSAKLAAGDLGVRLPVRGEDELATLNRSFNAM
FT                   ADSIESQIKELADLSLVQQRFVSDVSHELRTPLTTIKLAADMINDQREEFDPVTGRAAE
FT                   LLHAQVQRFEVLLTDLLEISRYDAGSVQLELEPTSLASLAEDVIASMEQLAEKHGTDVR
FT                   LVAPGGYTPVDMDARRIRRIVRNLLGNAIEHGEGRPIVVSVDSDRDAVALGVRDFGLGM
FT                   RAEDVDRVFDRFWRADPSRVRTIGGTGLGLSIALGDARLHGGTLAVWSEPGRGSNFVLT
FT                   LPRDGRPLGSSPLPLVPDDEQGGTLEALGLTQPISLGRTTTTRGTT"
FT   regulatory      complement(550730..550735)
FT                   /locus_tag="MTES_0526"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(552420..552425)
FT                   /locus_tag="MTES_0527"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(552422..553102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtrA"
FT                   /locus_tag="MTES_0528"
FT                   /product="response regulator consisting of a CheY-like
FT                   receiver domain and a winged-helix DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0528"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73492"
FT                   /db_xref="GOA:E8NBN2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:E8NBN2"
FT                   /protein_id="BAJ73492.1"
FT                   /translation="MTSRILVVDDDTALAEMIGIVLRTEGFDTVFCADGAQAVDAWRTE
FT                   RPDLILLDLMLPGVDGIEICTRVRAESGVPIIMLTARTDTADVVKGLESGADDYIMKPF
FT                   NPKELVARIRTRLRPVQVPVDETLRIGDLVVDVAAHEVRRGDNPIALTPLEFELLVALA
FT                   EKPQQVFSREMLLEQVWGYHYKADTRLVNVHVQRLRAKIEADPDNPRIVTTVRGVGYRA
FT                   GAVA"
FT   regulatory      553094..553099
FT                   /locus_tag="MTES_0529"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        553106..553303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0529"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0529"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73493"
FT                   /db_xref="UniProtKB/TrEMBL:E8NBN3"
FT                   /protein_id="BAJ73493.1"
FT                   /translation="MYVFRLETRSGTGNGTPGEGAIPLRVVEMPGKGPSVPGVSGSESR
FT                   SVSVVCDTMKTLPTTEEASS"
FT   regulatory      complement(553115..553120)
FT                   /gene="mtrA"
FT                   /locus_tag="MTES_0528"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      553287..553292
FT                   /locus_tag="MTES_0530"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        553300..554868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0530"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73494"
FT                   /db_xref="GOA:E8NBN4"
FT                   /db_xref="InterPro:IPR018476"
FT                   /db_xref="UniProtKB/TrEMBL:E8NBN4"
FT                   /protein_id="BAJ73494.1"
FT                   /translation="MTAYPAWTPASRPGIVPLHPYGFGMILSRSFTALRHNPRVLLGFA
FT                   LVVQTVAYVILSVAVAGAAIASFSRLDTLREGSDDFNAVMAGSIAVTAVVALVLGVAAS
FT                   GLSVLVQGVVVAEVAHAVVAEKPTLKVVWRRVRPVFWRLIGYAALTFAAAFVVLAVLAA
FT                   IVVPLSIAILPVGVLLGILLGLACIPLYLWLATKLFLVPSVIILEGAGIRAGIARSWRL
FT                   TRGRFWSTFGVLVIISVAFSVVAQIISIPLSMGATLISTLIAPTGSAQPGAIVGYIVVQ
FT                   VIGQVGILLVQCIALVVQSTSAVLVYVDARMRVEGLDQDLASYVEARDAGADDLPDPYR
FT                   VGIGRSVAPVQRWGAPVPGGVPAGWGPPSAAPYGAAPAAPPYGPAPTTPPYGGAPTTPP
FT                   YGGAPSAAPYGAAPTGQPYGTAPAGQPYGSAPTTAPSGGVPAAAPPYAAAPPPPPAGAP
FT                   APAPAPAGAPAPAPAPAATPTPVAGDQSGLPATGGDTTSDEASDPPAPPSTTTWTAPGA
FT                   RPDDA"
FT   regulatory      554857..554862
FT                   /locus_tag="MTES_0531"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        554865..555536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0531"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0531"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73495"
FT                   /db_xref="GOA:E8NBN5"
FT                   /db_xref="InterPro:IPR025403"
FT                   /db_xref="UniProtKB/TrEMBL:E8NBN5"
FT                   /protein_id="BAJ73495.1"
FT                   /translation="MTPPLALTASALSALLPDADEAREWAERELSDPAYQAAEPTPIDR
FT                   LARAVVDFFGELPRNSANGEWGPPALIVLALILAVGIVIGILIWGRPRALARAQPPARA
FT                   LFDEDDGRSAEELRRDAEAAAARGEWDAAIVLRFRAFARGLTERGLVDPPPGATVHTFA
FT                   RAAAAALPALGAGLDNAASLFDDVRYLRRPGTEKSYRVVADLDADAVRTRPASAALAGA
FT                   S"
FT   regulatory      555521..555526
FT                   /locus_tag="MTES_0532"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        555533..556711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0532"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0532"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73496"
FT                   /db_xref="GOA:E8NBN6"
FT                   /db_xref="InterPro:IPR025646"
FT                   /db_xref="UniProtKB/TrEMBL:E8NBN6"
FT                   /protein_id="BAJ73496.1"
FT                   /translation="MTAISDAPVTAHPRRRAALGWIALAVGLLLIGLVGTTLVYGGWKE
FT                   KGLLDPESPAPDGARALVRILEQQGVTVTVARDRATAERALAGSDATLVMRDAPMLSDA
FT                   TLSSLAERARDVVLVEPRSRALDVLMNGSALGGFAADRAADPGCDLPAPEAAGTARTGE
FT                   LMVPGQGVDGCYRVDGDFGLLSWETSDGRTVTALDGTSTMTNAALPLDGNAALAIGTLA
FT                   RTGTVVWYVPSPSDADAGTAPQTLGDLTPPWVTPAILLLFLSGLVAAIWRGRRFGPLVT
FT                   ERLPVMVRANETTEGRARLYAAAGDAPHALDELRRAARGRLVRVMGLATHTPPEQVADA
FT                   VAERLGADRGAMRGILITDTPTTDRDLVAASDRLRDLETSVRAALSTERTTR"
FT   regulatory      556695..556700
FT                   /locus_tag="MTES_0533"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        556708..557766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0533"
FT                   /product="MoxR-like ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0533"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73497"
FT                   /db_xref="GOA:E8NBN7"
FT                   /db_xref="InterPro:IPR011703"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="UniProtKB/TrEMBL:E8NBN7"
FT                   /protein_id="BAJ73497.1"
FT                   /translation="MTDSPLDAPQPGVPPQPASPPSAAPAASAPVEPGSRDAALREAMN
FT                   RVRVEVGKAVVGQDGTVTGLLIALLSRGHVLLEGVPGVAKTLLVRSFSRALGLDTHRVQ
FT                   FTPDLMPGDVTGSLVYDARTGEFEFRAGPVFTHVLLADEINRTPPKTQAALLEAMEERQ
FT                   VSSDGVSRPLPDPFLVAATQNPVEHEGTYTLPEAQLDRFLMKLVVDLPGRDAEVDVLRR
FT                   HAGGFDPRRLDAAGLDPVVTADEILAAQRAAATVAVDDDLLGYIVDLARATRQSPSVLL
FT                   GVSPRATTGLLAAAKAWAWLGGYPAITPDHVQTMLVPVWRHRIRLRPEAEIEGVSVDAI
FT                   LTSVLQQTRVPI"
FT   CDS_pept        557766..559067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0534"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0534"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73498"
FT                   /db_xref="GOA:E8NBN8"
FT                   /db_xref="InterPro:IPR002881"
FT                   /db_xref="UniProtKB/TrEMBL:E8NBN8"
FT                   /protein_id="BAJ73498.1"
FT                   /translation="MFVTGRLALLVAVGVVPLVLLSTAGAPAWLVVGVWVLLCALAALV
FT                   DMLAAADPRAVEITRRLPERVLRDEPVAGELRVRNLGRRVLRARVRDAWQPTAGAPEER
FT                   SRFVVPPGERRGAPLPLLPRRRGEIRSGFVVVRASGPLGLAGRQAVVDAPGRIRVLPPF
FT                   TSRRHLPSRLARLRELDGNTSLMVRGQGTEFDSLREYVRGDDVRSIDWRATARAGTTML
FT                   RTWRPERDRHVVIVIDTGRTAAARVGDGARLDAAMEATLLLSALAARAGDHVHLVMFDR
FT                   VARARVTKVDGSQLLPALVDAMAPVEPQLIDTDWDAAFAQVRQLTVRPALVVLLTAHDD
FT                   PEAARGFLAALPAVAARSRLLVATATDGPGEEPERTDAASVYAAAAIERARHDADRVRA
FT                   AVVRAGGDAVSASADDLPPLVADRYLALKAAGRL"
FT   regulatory      559065..559070
FT                   /gene="fabH"
FT                   /locus_tag="MTES_0535"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        559082..560215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabH"
FT                   /locus_tag="MTES_0535"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] synthase III"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0535"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73499"
FT                   /db_xref="GOA:E8NBN9"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:E8NBN9"
FT                   /protein_id="BAJ73499.1"
FT                   /translation="MQPGTYVAAYPGGYPSSRQRVPSALGCAVYAQDAGELLPGNATTH
FT                   FDDVALVSVASVLPSRVTTSDDIEERLAPALQRLKLKPGLLRRVAGVNERRNWAEGESS
FT                   DEATIAAGKQALAEAGVDPSEIGLIINTSVTRKHLEPSVAVRLHHGLGLPSSAINFDVA
FT                   NACLGFINGMSLAAGMIQSGQVKYALIVNGEDADEIQVNTINRLVREDLDRDAFMQEFA
FT                   SLTLGSGAAAAVLGRASDHPEGHRIVGGVTRAATQFYDLCVGSVDGMFTDAKALLKGGL
FT                   DLVVSAWKEAKGEFSWTGMDRYITHQVSSVHTSAIVRAAKLDRDRVPVTYPHLGNVGPA
FT                   SIPITLADEQKTLRRGDRVLLMGVGSGLNTGMLELAW"
FT   regulatory      560200..560205
FT                   /locus_tag="MTES_0536"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        560212..562866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0536"
FT                   /product="acyl-CoA synthetase (AMP-forming)/AMP-acid ligase
FT                   II"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0536"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73500"
FT                   /db_xref="GOA:E8NBP0"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:E8NBP0"
FT                   /protein_id="BAJ73500.1"
FT                   /translation="MRVTDLNATLPPAGLPGLDPSLSRLVDVPGAAADAGATRTWHVLD
FT                   TGTALSERGIEPVGTIVAVHGNPTWSYLWRALVNTSLERAETGRTAWRVVAVDQLEMGF
FT                   SERSSLRRTLAQRIADLEALVGELGIRGRIVTIGHDWGGPVSLGWAVENRDRLAAVIAL
FT                   NTAVHHPDGAPLPFALRVATARGMLAAGTTGTTAFLDTTLALADLDPAVRSAFRAPYAT
FT                   VARRRGIGGFVADIPATAADESTPALRRMSAGLRELEVPALFLRGPKDPVFGEGHLDDL
FT                   TERLPHADVHRFEGAGHLIAEERPYADVVLDWLEEKGVATDAATPGSTDATAADLDATP
FT                   PAIATGHLWDALDARRDDDDTAVIDMTTTRDGAPLRVSWRQLSTRVDEIAAGLDAFGVR
FT                   AGDRVSLLVQPGPTLTAALYACLRIGAVVVVADRGLGIRGLSRAVRGAVPDVVIGELAG
FT                   LAAARALGWPGRRISATALPLATSRALGVEASLSDLARAGRGHTLPPVPAAEADAAVLF
FT                   TSGSTGPAKGVVYTHAQLTALRDTLAAHFGVTADTGLVTGFAPFALLGPALGTRSATPD
FT                   MDVSAPRTLTAEAVAAAVRASDARIVFLSPAAVANVVATSDALGDDDRAALERVETFLS
FT                   TGAPVSIDLLRRAQELMPNAVAHTPYGMTECLLVADVTLPEIEEAAGDRGVCVGRPLGT
FT                   GQVRISAIDADGRATGEPTTEAGVTGEIVISAPHLKRGYFRLYLTDREARRGLADRWHR
FT                   TGDVGHLDAEGRLWVEGRLPHVITTAEGPVTPVGIEQDAETVDTVSRAAAVGVGPVGRQ
FT                   VVVAVVEAGARRPGLASPELTDAVRAATAQPLAAVLVAPTLPTDIRHNSKIDRSRLAAW
FT                   AERLLAGEKPTAP"
FT   regulatory      562847..562852
FT                   /locus_tag="MTES_0537"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        562863..563822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0537"
FT                   /product="nucleoside-diphosphate-sugar epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0537"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73501"
FT                   /db_xref="GOA:E8NBP1"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E8NBP1"
FT                   /protein_id="BAJ73501.1"
FT                   /translation="MRVLATGASGFLGRAVVRALQDAGHEVRTLQRRASGVDSAEDRLG
FT                   SVTDPDAVASALDGIDGVVHLAAKVSLAGDPGQFHAVNVEGTRTLLDAAAAAGVSRVVH
FT                   VSSPSVAHAGHALAGVGAEPADPDAAHGEYARTKAEAERLALSRVGDGLALVAIRPHLV
FT                   WGPGDTQLIARVVDRARRGRLPLLNGGTALIDSTYVDNAASGIVAALDRVDAVSGRAYV
FT                   LTNGEPRPVGDLLAGICRASGVTPPRFSVPAGLAKAAGALVERVWAVRPGEDEPPMTRF
FT                   LAEQLSTAHWFDQTEIRRDLRWAPAVSLDEGLRRLARA"
FT   CDS_pept        complement(564084..566336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0538"
FT                   /product="catalase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0538"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73502"
FT                   /db_xref="GOA:E8NBP2"
FT                   /db_xref="InterPro:IPR000763"
FT                   /db_xref="InterPro:IPR002016"
FT                   /db_xref="InterPro:IPR010255"
FT                   /db_xref="InterPro:IPR019793"
FT                   /db_xref="InterPro:IPR019794"
FT                   /db_xref="UniProtKB/TrEMBL:E8NBP2"
FT                   /protein_id="BAJ73502.1"
FT                   /translation="MSDALNGCPVFHDGAAPDDNRLPVGEAPADSEPAGALPHPTQGSA
FT                   NRVWWPESLNVKILAKNNALRDPLDEGFDYRAAFEALDLDAVKKDLQEVMTTSQDWWPA
FT                   DFGHYGPLMIRMAWHSAGTYRVTDGRGGSGAGMQRFAPLNSWPDNVNLDKARRLLWPVK
FT                   KKYGQSISWADLMILAGNVALEDMGFPTFGFAGGRQDVWEPDDDVYWGPETTWLGDERY
FT                   TGNRELEKPLAAVQMGLIYVNPEGPNGNPDPQLSAHDIRETFGRMAMNDEETVALIAGG
FT                   HTFGKTHGAASDSHVGPNPEAGDIEDQGLGWKSSYGSGKGDDTISSGLEVTWTYHPTRW
FT                   DNEFFHILFAYEWELFESPAGAHQWRPKNGAGADMVPEAHSDGRREPRMLTSDLALRVD
FT                   PAYEKISRRFLEDPAAFQDAFARAWFKLTHRDMGPRERYLGPEVPSEVLVWQDPVPAVD
FT                   HPLIDQADAAALKQQILDSGLTVQQLVTTTWAAASTFRGSDKRGGVNGARIRLEPQRSW
FT                   TVNNPEQLASVLSVLEGVKAAFDAQGEKKVSIADLLVLAGNAGVEQAARAGGVEVEVPF
FT                   TPGRTDASQEHTEIESFRWLEPVADGFRNYASREARLPAEFLLLDKANLLTLTAPEMTV
FT                   LVGGLRAIGANWDGSDWGVFTDTPGALTNDVFANLLDLGTTWKPLDSGKHAFEGTKDGS
FT                   GEKVGIGTRVDLVFASNSELRALAEVYASDDAKEKFVRDFVAAWRKVTELDRFDLV"
FT   CDS_pept        complement(566333..566794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fur"
FT                   /locus_tag="MTES_0539"
FT                   /product="Fe2+/Zn2+ uptake regulation proteins"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0539"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73503"
FT                   /db_xref="GOA:E8NBP3"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E8NBP3"
FT                   /protein_id="BAJ73503.1"
FT                   /translation="MLDDRTDATADDLIRGAGLRVTATRVAVLEALRTRPHATADAVYD
FT                   GIRGSLPGTSKQSVYNALGDFVDAGVARRIEPAGHAGTFELRVGDNHHHVVCTVCGRID
FT                   DVDCVVGAAPCLHMPEGSGFTIQTAEVTFWGVCPDCRATSEAERPRGSR"
FT   regulatory      complement(566342..566347)
FT                   /locus_tag="MTES_0538"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(566798..566803)
FT                   /gene="fur"
FT                   /locus_tag="MTES_0539"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(566869..567864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0540"
FT                   /product="uncharacterized membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0540"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73504"
FT                   /db_xref="GOA:E8NBP4"
FT                   /db_xref="InterPro:IPR002798"
FT                   /db_xref="UniProtKB/TrEMBL:E8NBP4"
FT                   /protein_id="BAJ73504.1"
FT                   /translation="MDLDALTAARREEWARLDELGRTRRLSGDQVDELVTRYRAASADL
FT                   ADIKTSAGRTPQGDYVSILLARTRLRLTGVRENVLKQMPRFFLLQLPAALYRVRWTTLA
FT                   VAIGFIVVSTMVALWISGDPATVAALGSRSELQNYADEQFVSYYRENPNAIFAGSVWTN
FT                   NAWIAAQCVLFGVTGIWPLMAMMQNAIGVGQSAAIMIAFDRTDVFFQFILPHGLLELTA
FT                   IFVAGAAGLHIFWAWVAPGRRTRAAALAAEGRSLATVAVGLVFALALSGIVEGFVTPRE
FT                   WPWQVKIAIGAAALGVFLFYMLWVGGRAARSGETGDLTEYEAGTPTLTAG"
FT   regulatory      complement(567869..567874)
FT                   /locus_tag="MTES_0540"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      567872..567877
FT                   /locus_tag="MTES_0541"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        567881..568735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0541"
FT                   /product="predicted membrane protein/domain"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0541"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73505"
FT                   /db_xref="GOA:E8NBP5"
FT                   /db_xref="InterPro:IPR010432"
FT                   /db_xref="UniProtKB/TrEMBL:E8NBP5"
FT                   /protein_id="BAJ73505.1"
FT                   /translation="MASSAASPRSEVRTPAARGVTLIDIASEEILTGEAVALDVQPLGF
FT                   FLRALGCLIDMVVGVVLLIGGGLLLVTMAASGALPDSALRIGIITLIVLVMVVLPTTVE
FT                   TLSRGRSLGRLAVGGRIVRVDGGAAGFRAALIRALVGVLELWLTLGGIAAVVGMFTPRA
FT                   QRLGDLVAGTASERTRTRPLPPPAPGLPPGWESWAQVADVSRLPDRLAARVSQFVRGAE
FT                   LLDPAARVRIAGSLADAVAPFVSPRPPADPEAFVRAVASVRRDREYRALVIERERAASL
FT                   TGR"
FT   CDS_pept        complement(568742..568948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0542"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0542"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73506"
FT                   /db_xref="InterPro:IPR021888"
FT                   /db_xref="UniProtKB/TrEMBL:E8NBP6"
FT                   /protein_id="BAJ73506.1"
FT                   /translation="MRDRLCSKVGCAREAMSTLTYDYGDQMAALGPLGRVDDPHAHDLC
FT                   AIHADRLSVPRGWVVVRHETLRA"
FT   regulatory      complement(568956..568961)
FT                   /locus_tag="MTES_0542"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      569247..569252
FT                   /locus_tag="MTES_0543"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        569261..569608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0543"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0543"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73507"
FT                   /db_xref="UniProtKB/TrEMBL:E8NBP7"
FT                   /protein_id="BAJ73507.1"
FT                   /translation="MRPPLPPIDTRVERFDIAVGAAAEFLRSAWAELREVSFEIGIMPP
FT                   AATDGIPRWTVLREEKRIILYRIPIERLGHPHHDDDLHRRMMIEGAVFRAAAEYLDRDP
FT                   WDLGPERFRYF"
FT   CDS_pept        complement(569655..571052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0544"
FT                   /product="large extracellular alpha-helical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0544"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73508"
FT                   /db_xref="UniProtKB/TrEMBL:E8NBP8"
FT                   /protein_id="BAJ73508.1"
FT                   /translation="MSSDRRLVRWATTSARVVAGSVVAAAVVVGTVAGIAAPWPTLTAT
FT                   PVRIEATPAASDTVLACDGPLLALGRSAEQAGALSAAAPQAIVSGPADSAAVESALTGS
FT                   TGDGSGNATALRAQPRDGVAVPVAAAGSATATSEDLIGFSASACRPPLAESWLVAGATT
FT                   TGANDLVVLGNPGDVPATVQLSVYGAQGVSTPPGGSNIVVPAGEQRVVPLAGLLLGEES
FT                   PVVRVTATGAPVHASLQASLTRLLLPGGVDQVAPSAQADTHVVIPGVQVLTSGGSDAGT
FT                   VLRLLAPGAAATATVTLTPVGTAAPGEPRQVPLEAGKPTSLDLSGVGLGAYTVDVTADQ
FT                   PVVAGVWSTTGFGQGADFAWYSPAPQIAVSSAVAVASGAGAALVLSSDRGAGDATVTLT
FT                   PADGGTPLTIAVPDGGGVSTAVAAGVYTLEPSTPVRAAVTYASTGAVAGYPLWPADTAE
FT                   SAVTVLP"
FT   CDS_pept        complement(571049..573889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0545"
FT                   /product="predicted glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0545"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73509"
FT                   /db_xref="GOA:E8NBP9"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E8NBP9"
FT                   /protein_id="BAJ73509.1"
FT                   /translation="MPARVHAILVVRPEGRTPAAHHLTRTLAAIAAQSRPVDALTIVLC
FT                   GADPALTQLAASSGAEGVITASAGTPFAAATALATPRLTGDAVWLLAQDTAPEPDALVR
FT                   LAGALELSPSLAVAAPKLVRWDEPEEIVSLGISLNRYGRTVELAAGEFDQGQHDGDADV
FT                   LGADVRGLLIRRESWTALGGLDPALGGADEGVDLGVRARLAGDRVSLVPAARVAVAGDG
FT                   VAAMARGRRRARRRAFAERTAQLHRRLAYAPAAAVPLHWLSLLPLALWRTIVHLVGKVP
FT                   YRVLPEWGATILVMARVAAVARARRRIRAVRAVGWSRIAPLRVSRAEMRLRWEGDGAVV
FT                   DAPVRSELQFFVGGGAWAVLGALAVSAALFFPLLAWPVLGGGALAPLRATVAQLWQDAA
FT                   WGARPLGLDAIGPADPFSAIIAFIGTLSPGDPSRALVVLWVLALPLAVLGGWFAATRVT
FT                   ESPLLRIVAAVAWALAPTFLAALVEGRPAALLAHLLLPWLFYAASVAHRAWAPAGAASV
FT                   LLVLVLACAPSLAPAAVVLWSAALVVVALVAGRGVARVVWLVVPSIVVFAPLVWTQVRT
FT                   GNPWGLLADPGVPYAGDEVTADPLGRALLAAGFPSSDPGGWASVLNGPVWWVGLLIAPL
FT                   AVLALLAVLTPRWVTASALLIIAAVGLATAFAAVGVSVSFDHGTPVPLWPGAGLSLAWL
FT                   GVVGSAMVALDAGIGERVRVLRPIGALVTLVALVVAVGPALTASLDQAHPRSVLTNGPT
FT                   STLPAFVAAEGRGSTAIGTIVLDPRADGLRVDVVWGGSATVGGQSTVQATRTEARPADR
FT                   DLAALAADLTTPSSDDVVSRLAERGIAFVLLKSAPAGENDVIRGARLAAATSLDQRDAL
FT                   DGVGTTSRGDLWRVTADVQPRQPLTDTQAHLRNLVTLGSLGVLLVALLLAVPTTASRRV
FT                   ARRTPRIVGPTPGGSR"
FT   regulatory      complement(571056..571061)
FT                   /locus_tag="MTES_0544"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(573900..573905)
FT                   /locus_tag="MTES_0545"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(573973..574293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0546"
FT                   /product="WhiB family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0546"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73510"
FT                   /db_xref="GOA:E8NBQ0"
FT                   /db_xref="InterPro:IPR003482"
FT                   /db_xref="InterPro:IPR034768"
FT                   /db_xref="UniProtKB/TrEMBL:E8NBQ0"
FT                   /protein_id="BAJ73510.1"
FT                   /translation="MTSQYRSGVPDNWFVDPVDLGVPGVRRDIDAVEENTLAWQTDALC
FT                   AQTDPEAFFPEKGGSTRDAKRICTSCDVKSECLEYALQNDERFGIWGGLSERERRKLKR
FT                   RA"
FT   regulatory      complement(574298..574303)
FT                   /locus_tag="MTES_0546"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(574437..575591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0547"
FT                   /product="phosphomannose isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0547"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73511"
FT                   /db_xref="GOA:E8NBQ1"
FT                   /db_xref="InterPro:IPR001250"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR016305"
FT                   /db_xref="InterPro:IPR018050"
FT                   /db_xref="UniProtKB/TrEMBL:E8NBQ1"
FT                   /protein_id="BAJ73511.1"
FT                   /translation="MLVALSNTPRDYAWGSPTLLAELEGRVPTGAPEAEVWFGDHPGSP
FT                   ARVLDGSERTLDEWLPGVDGAPARLPYLLKLLAAGSPLSIQVHPSKEQAARGFADEEAE
FT                   GVPRDAGSRNYKDDNHKPEVIVALSETFTALAGLRDLDQTRRLVAGLGEAAGVTALRER
FT                   LAAAEPASALRDAIGWALAEATTAEIEQIVEGAASVSSPDFAAEAALVRHLREEYPGDP
FT                   GIVVALLMNLVELRRGEAIFVPAGVLHAYVAGLGVEIMAASDNVLRGGLTPKHIDVPEL
FT                   LGLVDFRPAAPPLLAPRADGDGVELFAPGIADFALAHVATSTEPAHVDLRGVSIAVGVA
FT                   GEATVTGASGTSLRLAPGQAALATADEGPLTVSGGEVFVAMPGE"
FT   regulatory      complement(575601..575606)
FT                   /locus_tag="MTES_0547"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      575637..575642
FT                   /locus_tag="MTES_0548"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        575654..577054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0548"
FT                   /product="lipid A core-O-antigen ligase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0548"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73512"
FT                   /db_xref="GOA:E8NBQ2"
FT                   /db_xref="UniProtKB/TrEMBL:E8NBQ2"
FT                   /protein_id="BAJ73512.1"
FT                   /translation="MAMYTNHPVSAPPSAPVRETTGHLLLRAWCVFVIALALGGVGLVN
FT                   AVGPTVSTVIVVATAVVSGVVWAVVRPPVAWRRLPWLAFGYVGWAFLSLLWSAWPAASV
FT                   LTLLLLGITTFQGLFVGAVLTWRDVVRAVASAAKWIVGLSLLFELAVSVFVRGPILPGF
FT                   VLPTSRMDPIVYWSRDNLFDGGRIQGVFGNANLLASVMLVAIIVFAIRFAAGAPRRLWL
FT                   LGWIAVAAFLFVRAGSATAVISAAFVALVLGTVLVMRTASRPGERTRWYALYAVIGLGG
FT                   AAALWFGRDAIFGLLGRGADLTGREGIWADVLARAAERPFTGWGFSTPWIASEPLIDGW
FT                   IVDHGQTVVQAHSVWIDVFFQLGGVGVLLFVLVYLAYLWRSWFFAVDRPRWDLRADRPY
FT                   SPLTLLPTLIGALLVVQGLTESGPLLLWGWMFVVLFGAKIKQAPLVGVGPAEQSIAIER
FT                   GEPQSAGS"
FT   regulatory      577043..577048
FT                   /locus_tag="MTES_0549"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        577051..578361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0549"
FT                   /product="lipid A core-O-antigen ligase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0549"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73513"
FT                   /db_xref="GOA:E8NBQ3"
FT                   /db_xref="UniProtKB/TrEMBL:E8NBQ3"
FT                   /protein_id="BAJ73513.1"
FT                   /translation="MTSALLASAGFARAFTLLVFATVFGSSAIRGVAGDVTLATIVLGL
FT                   CLLGVGVLGARRREIELVRLAPTTLVLFVAWAGASVLWSADPAASLGGWAELVAVSFLA
FT                   VVIGHVRDALQTVRALGDVLRWLLGASLALEILSGILLDVPIPFLGIQGDIAALGPVQG
FT                   LFGTRNVLGFVTVIALITFLVEYRTQSVRAGAAIASVVLAGALAALSGSPTVIAVAVAT
FT                   GAAALALTLVRRIPAQRRPLAQLILGVVVIATVATGYGARDALVALLDARADFSLRTDL
FT                   WSQLLTYVAYRPVEGFGWYGPWSPESFPFATLNFTLGEEHTSALDAYLDVLLQVGWAGL
FT                   ILFLTLGALALARGWLVASERRSVVHAWAPLTLVALLTFSLFESFTLSGAGLLLLVVCA
FT                   VRAGQSRSWRESLGLRMPPAPAPDTGSGVQGPPTAAG"
FT   regulatory      578400..578405
FT                   /locus_tag="MTES_0550"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        578411..580324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0550"
FT                   /product="predicted glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0550"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73514"
FT                   /db_xref="GOA:E8NBQ4"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR040492"
FT                   /db_xref="UniProtKB/TrEMBL:E8NBQ4"
FT                   /protein_id="BAJ73514.1"
FT                   /translation="MTYTLQNAVLPLDRDPDLLPLYVDPETWSTIDEEPVRVTNVAQLS
FT                   NVLDRHRARIVAGRRVSFGTYFNAFPASYWQHWTAVRHVRLTVRTSGDATILVYRSNGA
FT                   GTKQRIETREVRGESAETSFDLVLDQYSDGGWIWFDVAADRSDAMFEGAAWTTEEEPVR
FT                   PGKASIGITTYNKPDYCVNTLQALADAPDVLDVVDRVFLIDQGTDLVSDQTAYPEVASR
FT                   LGETLQVIRQPNLGGSGGFARAMTETLQRPESDFVQLLDDDVRIEPESIRRSVVFGRYA
FT                   SVPTIVGAHMFDLLDRPKLHAWAEVVDDAPFMWRALYQERLPHDFSVANLRQTPTLHMR
FT                   LDADYNGWWMCLIPTSILREIGLSLPAFIKWDDAEFCLRARDAGYPTVSMPGVALWHVS
FT                   WVGKDDSIDWQAYFHARNRIVSALLHSRSPQGGTLIRHSRRLDLKHLMMMQYYPVELRH
FT                   RALRDVLSGPAHMRRTLATAMPEARAIAKKHPETIVHKDSGVPLRSRRGRQVFRRLKRH
FT                   EFDSPSGMRLRVFTLRTLLSHWFHTPRPENVAQPEVEFGKADAHWWRVPSFDSALVSAA
FT                   DGSGQNIYTRDRAQYRRMLRESLRLHRRLQREWPRLSDQYRRALPDLVSEAQWRATFEE
FT                   QS"
FT   regulatory      580311..580316
FT                   /locus_tag="MTES_0551"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        580321..581283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0551"
FT                   /product="predicted glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0551"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73515"
FT                   /db_xref="GOA:E8NBQ5"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E8NBQ5"
FT                   /protein_id="BAJ73515.1"
FT                   /translation="MTAFDPATATIVVVTYNRTHLLTRLLESIERMDPAPGHLVVIDNA
FT                   STDDTTEVVEAFRDRLPTELVYRRLETNTGGSGGFSEGMRVAYELGSEWIWLMDDDVEV
FT                   VSDGLARMGHWTPRFRSIQGRRYDYDGSEFYWQYRVAESMAIPIPFAPAGFDDSGFKPM
FT                   NSGCFEGMFIHRDIVAKIGLPDPRFFIYWDDQLYGWLASRQTPSVIVNEFVLRRTREIK
FT                   QWDMGIRHMNASSDAYRYYIMRNRAYLQKYYRELGVYRPLPFTAGTALTFVKELIRLVV
FT                   VERKLRGTSHLFRGLRDGRRILRDASWTPMPPLERAPVT"
FT   CDS_pept        complement(581318..582058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0552"
FT                   /product="ABC-type polysaccharide/polyol phosphate
FT                   transport system, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0552"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73516"
FT                   /db_xref="GOA:E8NBQ6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E8NBQ6"
FT                   /protein_id="BAJ73516.1"
FT                   /translation="MTAPAIEAHGLGVRFRRNRRGSRTLKDLFGGASRRSRPDEFWALR
FT                   DVSFRVQPGESIGVVGRNGQGKSTLLKLVAGVLLPDEGDVVVEGGVAPLIEITGGFVGD
FT                   LTVRENVRLTAGLHGMPRAEVARRFDDMIAFAEIGDFVDTPYKHLSNGMKVRLAFSVVS
FT                   QLDEPILLVDEVLAVGDRSFREKCYRRIDELLAEGRTLFFVSHNEKDLRRFCTRGLYLD
FT                   GGRLAMDAPIAEVLDRYNEDYATR"
FT   CDS_pept        complement(582058..582849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0553"
FT                   /product="ABC-type polysaccharide/polyol phosphate export
FT                   systems, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0553"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73517"
FT                   /db_xref="GOA:E8NBQ7"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:E8NBQ7"
FT                   /protein_id="BAJ73517.1"
FT                   /translation="MTPAAVGAPGSVRRSLHSLWLLSSRDLRVRYSTSALGYLWSVLDP
FT                   LVMSGIYWFVFTQVFHRSVGEDPYIVFLITALLPWVWFNSAVTDFTKAFKKDARLVRST
FT                   SIPRWIWVNRIVVSKGVEFLFSIPVLVLFAVFGGAQVSWALLAFPLAVLLQTILLVGLG
FT                   LVVAPLCVMFGDLERTTRLVLRALFYASPIIYGVGNLPGVFADIAAFNPLAGIFTLYRV
FT                   GFFPDQWDTLTVVVGAAVSLGILGLGLLVFPRLERPVLKEL"
FT   regulatory      complement(582064..582069)
FT                   /locus_tag="MTES_0552"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(582856..582861)
FT                   /locus_tag="MTES_0553"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(582872..584911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0554"
FT                   /product="predicted acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0554"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73518"
FT                   /db_xref="GOA:E8NBQ8"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:E8NBQ8"
FT                   /protein_id="BAJ73518.1"
FT                   /translation="MRVTQASAGRPALAGRADEGRWAYRSDIDGLRAVAILLVVTYHVW
FT                   IGRVSGGVDVFLMLSAFFLTRGFVRRMDGPSPVRPVLHLIGIFRRLLPAAAVTLVGVLA
FT                   LAWTFFPPSTWRATWEQTWASLLYVQNWVLAADSVNYYARVETPSPLQHFWSMSVQGQA
FT                   FVLWVVLLAICQAVVRRFRLSPDRVVGGVFGAVFVLSLWYSIVRTDAAQQSAYFDTGAR
FT                   LWEFAAGSLLVIALPHLRLRPRLRAVLGWAGLAGLLVVGLVLDVQGGFPGYLALWPVLC
FT                   AAAVVVSGSGEEARGPARFLASRPLQLLGRDAYALYLVHWPLLITFLVLTGSDSAGFVG
FT                   GTLIIVLSLALARALTAVVDTPVRAWRKGDPSRSVPVAVLVAATAVVVLPLSAWQVSNE
FT                   VEARSIAARAAVTNPGAAVLRDPTLPEPPADAALLPLPTALEEEWMQLDRPCSGDRVPE
FT                   NGILNVSCWETPHTARAAHTIVVVGDSHSQQMTAALLPVAEENGWGVVMLAKGGCSMGL
FT                   DEPGMDDQCDEWREAAIEHVERIRPDAVLTVVTRSDWGELDEAVRPGIDRFLDRMGDAG
FT                   IEVLGVRDNPRFPFDMYSCVAESSDPVDCAVPRAGSLADDNPAAVLDRAGVQLVDLTPW
FT                   ICPDDVCVGVVGNVALYRDDNHLSRTYATTLAPSLAEQLPPSLG"
FT   CDS_pept        complement(584919..586067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glf"
FT                   /locus_tag="MTES_0555"
FT                   /product="UDP-galactopyranose mutase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0555"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73519"
FT                   /db_xref="GOA:E8NBQ9"
FT                   /db_xref="InterPro:IPR004379"
FT                   /db_xref="InterPro:IPR015899"
FT                   /db_xref="UniProtKB/TrEMBL:E8NBQ9"
FT                   /protein_id="BAJ73519.1"
FT                   /translation="MFAYMDLLVVGSGFFGLTIAERAAAAGRRVTVIDRRHHIGGNAYS
FT                   EDEPETGIEVHRYGAHLFHTSNPTVWEYVNRFTDFTSYVHRVYTTHKGVVFPLPINLGT
FT                   INQFFQAAYTPDQAKALVHELAGEFDAKDAANLEEKGIALIGRPLYEAFIRDYTAKQWQ
FT                   TDPKDLPAEVISRLPVRYTYDNRYFNDTWEGLPVDGYTAWLERMADHPNIEVKLSTDYF
FT                   DASQPLNKKATVGQVPVVYTGPVDRYFDYAEGELSWRTLDFEQEVLPIGDFQGTSVMNY
FT                   ADADVPYTRIHEFKHFHPERADRYPTDKTVVVREYSRFATRADEPYYPVNTADDRTGLL
FT                   AYRELAKGERDVHFGGRLGTYQYLDMHMAIGSALSMWNNQLA"
FT   regulatory      complement(586071..586076)
FT                   /gene="glf"
FT                   /locus_tag="MTES_0555"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      586187..586192
FT                   /locus_tag="MTES_0556"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        586202..588121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0556"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0556"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73520"
FT                   /db_xref="GOA:E8NBR0"
FT                   /db_xref="UniProtKB/TrEMBL:E8NBR0"
FT                   /protein_id="BAJ73520.1"
FT                   /translation="MGDWISAVPSYLVAVLVLILPGAAVVAAGWGIRSPQRLLLAPAVS
FT                   VTLAAAASTLGHFVGLRWNLLPLALATLVVVGIGLLLRRGTGADPAPTARRTLLTAALA
FT                   LVATAGVTTVMFARAFGAPDNIAQRFDNIVHLNAIALAVQNGDASGFQIGATSDIGFYP
FT                   NGWHAITTLVVELTGASVPVAVNGANLAFVSVLWPASIMALVGALFAQRRTAYITAAAL
FT                   SAGFGAFPALFFNWGVLYPNLVGYAMVPAALSTVITALDDRGPRALTRALLLAALLAGG
FT                   VFLGHPNAFLALLAFSAAAVIGTLSVRAFDARTRASMIGVGAAVVGFGLVMAVVWSIFR
FT                   TGAEHSGWAPWQNLAQSAGEGLLASPRGFTPTIVVVLLLAAGAVAVARRPRWVPVLAVF
FT                   GVAVVLFMVVSGLRIDSPVRQALTNPWYNDANRLAALLPLAAIPVATLGALAIVDVARG
FT                   WATRWSFPRWARRTASVVAILAVFSVVLGPNVRIALAQVHEAYAYTDNALILSGDEHAL
FT                   LERLDDETPDDALIIGSPRTGTSLALALADREVTQRHVFGSPSPELLFLNTHLRDIDSD
FT                   PAVCSTVDELGIDYVLDFGRRDVIDDPNGATAYDGIQDLVPSAHLVLVDSQGPEARLFR
FT                   IEGC"
FT   regulatory      588106..588111
FT                   /locus_tag="MTES_0557"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        588115..589320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0557"
FT                   /product="glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0557"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73521"
FT                   /db_xref="GOA:E8NBR1"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:E8NBR1"
FT                   /protein_id="BAJ73521.1"
FT                   /translation="MLTMSRETTVAVAYDCLFPYSTGGGERQYRAVADELGRGGLEVDY
FT                   LTAVQWDGPTPVEEHFRTRPITGRLSLYSPGGVRRIPAALRYAAALFRTLVRRRRRYTA
FT                   LIVSGLPIFNVFAARLALLGSGTRVVVDYLEVWHRRQWVEYSGLVTGTIAWVLQRAAIA
FT                   LTPLATCHSQLTATRLRTEGLRRPPLVSPGLIDDAVEVGTPGPAAEPPYVLYVGRHIPD
FT                   KQVEVIPAAVAAARESIPDLRLVILGTGPSSDAVRAEVQRVGGSDWTEFPGFVSDAELD
FT                   TLLHGALALVHPSRREGFGLVVVEANAHGTPVVLVAGDGNAATELIDEGVNGVVAATTR
FT                   PDDLARAIRTVADGGDDLRRSARAWYDTAVRTRTIRRTVEGIASALALPTRSSVKTKED
FT                   TP"
FT   regulatory      589304..589309
FT                   /locus_tag="MTES_0558"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        589317..590531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0558"
FT                   /product="glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0558"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73522"
FT                   /db_xref="GOA:E8NBR2"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E8NBR2"
FT                   /protein_id="BAJ73522.1"
FT                   /translation="MTTPARTDPVPTDEVELTILMPCLNEAETLEVCIRKAQGFLQRSG
FT                   IRGEVLISDNGSTDGSQAIAEGLGARVSHAPRRGYGAALINGIETARGRFVIMADADDS
FT                   YDFENLEPFVERLRAGADLVMGNRFRGGIAPGAMPPLHKYLGNPVLSFIGELFFRPGIR
FT                   DFHCGLRGFNRARIRDLDLQTTGMEFASEMVVRASLARYRIEEVPTTLKKDGRSRPPHL
FT                   RSWHDGWRHLRFLLLFAPRWLFVYPGLVAFFLGAIAVGVLSFGGVEIAGVGFDVTTMVY
FT                   ASALCVIGFQSLLFFWLTKLYATQEGFLPTSERYRRIVAKWSAERGLLIGVALFVLGIV
FT                   IGIVQVTLWGSLDFGQQNAAQAVRIAVPSALTIILGFQTVMMSFFSGVLTTPRREQRPE
FT                   AVIES"
FT   regulatory      590520..590525
FT                   /locus_tag="MTES_0559"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        590531..591655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0559"
FT                   /product="glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0559"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73523"
FT                   /db_xref="GOA:E8NBR3"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:E8NBR3"
FT                   /protein_id="BAJ73523.1"
FT                   /translation="MAASRILVDLLGFTGSRGGTETYARELLPRLEERLPHARFAALTG
FT                   RAGQTRVTTFFPGPVQIVPWVGADPATWALGAVAGTDALARRYRADLVWAPANFGPVFR
FT                   GVPRVVTVHDAIYDEVPGGLAERAQRSVTSLLMRRSARTADQVLTVSHAAADSIRAHLG
FT                   VAAGRISVVHNGSTEPRPQDDPAGILAPLALPVGRPIVLSVGNRMPHKNFRGLLEAVAS
FT                   LSPAERPVTVIAGSRLPDPLAADVERLGLEGDVVLPGWVSDAQLEALFQVADLYVCPSL
FT                   VEGFGLPVVDALRRSVPVVANDVPVLREVGGSAARYADATDATAFGDAIRSALAAPPSP
FT                   ATREAAQQWASRFTWDGAADGVAEVLDRALGERR"
FT   regulatory      591643..591648
FT                   /locus_tag="MTES_0560"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        591652..592920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0560"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0560"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73524"
FT                   /db_xref="GOA:E8NBR4"
FT                   /db_xref="UniProtKB/TrEMBL:E8NBR4"
FT                   /protein_id="BAJ73524.1"
FT                   /translation="MTDTAGPAPLRGRLLGFMVVPAIAAISPLLVLPLISRLAGDGGWA
FT                   SAIAGEAIGTFAAIAIGYGWTAVGPALISIAPDDERRARLYRDSIVVRLLLAAIVLPLL
FT                   AVVCWLVASPGSELLTVLMGVQGALIALSFTWYCAGVGDPRTIIFFDAVPRVVATALAA
FT                   GAILLTGIVELYPVAGILVTLGGTMLFSARLLRRHPGPWPPAREIPGLLRAGLPVAVND
FT                   AALSAYSSVPAPLVNVTALPSAAAGYASADKMFKLGSVLPFTLASAFQSWVSEGDALDR
FT                   RRRLRVALATHGAFGLLGAVVLTALGPWVSLVMFGESAAAGLDLVAAMGLVFLFLSVRT
FT                   SMTRHVLFPAGKARLVMRATLVATAIGVPAMVAMAIVIGPLGAALGYALTEGLATLLLW
FT                   RPCAAAMRDIATPPAREEQDRTV"
FT   regulatory      592902..592907
FT                   /locus_tag="MTES_0561"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        592917..593798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0561"
FT                   /product="predicted glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0561"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73525"
FT                   /db_xref="GOA:E8NBR5"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E8NBR5"
FT                   /protein_id="BAJ73525.1"
FT                   /translation="MTSSPRDAASRIGAVVLTWRDRVQTVECVTGLLASPAITRVVVVD
FT                   NEADGTIRDAFAPDDRIEFVELSANTGFAVGVNAGMKVLLADDAIDLLLVMNNDATLPS
FT                   SDIELLRAALDTDASLGVVGPRIVTPDGQRFSAGGIVNRLTWGIRQPRPAEQPDFLTWA
FT                   CVLVRRSTLETAGLLDERFFMYWEDVEYGFRLRSQGIGFAEVTDAVLTHAVSSSHSRAG
FT                   SRILAYSSQAFRHFLALHGGATTVTGLARLSAKVLLTLARGDRRGAAYVRAGWRLGSPA
FT                   PDPAYPAVNALP"
FT   regulatory      593803..593808
FT                   /locus_tag="MTES_0562"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        593815..594696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0562"
FT                   /product="glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0562"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73526"
FT                   /db_xref="GOA:E8NBR6"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E8NBR6"
FT                   /protein_id="BAJ73526.1"
FT                   /translation="MTIGFVVTTLGRLEPLRALLTSLEHQLQDGDHVVLVAQGAQEDVA
FT                   TLAAEFSARGVPVTATTSARGASLGRNTGVAALPAGDAVVTFPNDNTTYPDGTVAALHA
FT                   AVDDPAFLAGGFTSWDERGPKTTLPAAGTPLDKYNVWSVIEMGILIRRSLFDAVRGFDE
FT                   NMGPGSASPWQVAEGTDLLLRAMAHEPRLLHEFRWLPADVHVDGISTGFGLDTAERRRK
FT                   LRAYGRGTGRAFAVHGYPLWWRLAFTAAGLLYGVRNPQPITLGDGWPMFVGRLEGTLGR
FT                   TFGQARMVSATR"
FT   regulatory      594714..594719
FT                   /locus_tag="MTES_0563"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        594728..595669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0563"
FT                   /product="nucleoside-diphosphate-sugar epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0563"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73527"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E8NBR7"
FT                   /protein_id="BAJ73527.1"
FT                   /translation="MSSRVLITGGAGFIGSHLSERLLDEGNEVICVDNFFTGSRRNVEH
FT                   LFDNPRFELMRHDVTFPLYVEVDQIYNLACPASPVHYQHDPVQTTKTSVMGAINMLGLA
FT                   KRLRVPILQASTSEVYGDPAVHPQTEDYWGNVNPIGTRSCYDEGKRAAETLFFDYRRQH
FT                   DLSIKVIRIFNTYGPRMHPNDGRVVSNFIVQALRGEPITIYGDGSQTRSFCFVDDLVDG
FT                   MVRLMNTGQEVTGPINVGNPGEFTMLELANAVLEITGSTSTIEHRPLPQDDPKQRQPNI
FT                   DLARRELGWEPTIALRPGLERTIEYFRSVLAD"
FT   regulatory      595660..595665
FT                   /locus_tag="MTES_0564"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        595674..596807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0564"
FT                   /product="nucleoside-diphosphate-sugar epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0564"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73528"
FT                   /db_xref="GOA:E8NBR8"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E8NBR8"
FT                   /protein_id="BAJ73528.1"
FT                   /translation="MAHVLITGGAGFIGSRLAARLVRAGHRVRVLDALLAQVHGPDPDT
FT                   TSPLLRAVSGVAEVRRGTVTSVEDLRAALVDVDIVIHLAAETGTGQSMYEIDRYVEANI
FT                   GGTAKLMDLLTNEPHAVRRVVVASSRSIYGEGAYRTATGAVVYPPHRTDAAMASGDFAV
FT                   RGDDGEELELIPTPEDAALHPSSVYGITKQVQESLIMTVAPTIGVEAVSLRYQNVYGPG
FT                   QSLTNPYTGILSIFSTLIRQGQGIDVFEDGRESRDFVYIDDVVEATFLAATSPAAAGGV
FT                   FNVGSGIATTVLDVVAALSTAFGVPVETSITGRYRLGDIRHNVADTRRLSSVLGFHPEV
FT                   SFTEGVRRFVDWVIDEPVGGDTYRQSLEEMAARRLLK"
FT   regulatory      596876..596881
FT                   /locus_tag="MTES_0565"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        596887..597756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0565"
FT                   /product="dTDP-glucose pyrophosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0565"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73529"
FT                   /db_xref="GOA:E8NBR9"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005907"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E8NBR9"
FT                   /protein_id="BAJ73529.1"
FT                   /translation="MKGIILAGGSGTRLHPITLGVSKQLIPVYDKPMVYYPLSTLMLAG
FT                   IRDVLIITTPHDAPFFERLLGDGSQFGIDLSFAQQPSPDGLAQAFTIGADFIGDDKVAL
FT                   VLGDNLLYGPGLGTQLKRFTDVDGAAVFAYWVGEPTAYGVVEFDADGRAVSLEEKPTHP
FT                   KSNYAVPGLYFYDNDVVEIARGLEPSARGEYEITDINRAYLEAGKLQVEVLPRGTAWLD
FT                   TGTFDQMTDAADYVRTIERRTGLRIGVPEEVGWRQGFLSDEALRERAKTLVKSGYGAYL
FT                   LEILERGH"
FT   regulatory      597743..597748
FT                   /gene="rfbB"
FT                   /locus_tag="MTES_0566"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        597756..598754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfbB"
FT                   /locus_tag="MTES_0566"
FT                   /product="dTDP-D-glucose 4,6-dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0566"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73530"
FT                   /db_xref="GOA:E8NBS0"
FT                   /db_xref="InterPro:IPR005888"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E8NBS0"
FT                   /protein_id="BAJ73530.1"
FT                   /translation="MARLLVTGGAGFIGSNFVHHVVAHTEHTVTVLDKLTYAGNRASLA
FT                   GLPEDRVRLVVGDIADAAVVDPLVAEADAVVHYAAESHNDNSLHDPRPFLDTNIIGTYT
FT                   LLEAARRHDVRFHHISTDEVYGDLELDDPARFTESTPYNPSSPYSSTKAGSDLLVRAWV
FT                   RSFGVRATISNCSNNYGPYQHVEKFIPRQITNVLRGIRPKLYGTGENVRDWIHADDHSS
FT                   AVLTILDKGEIGQTYLIGADGEKDNKTVVELILQLSGQPVDAYDLVTDRPGHDLRYAID
FT                   STKLRTELGWAPTYGDFESGLAATIDWYRDNESWWAPTKDGVEAFYASKGQ"
FT   regulatory      598743..598748
FT                   /locus_tag="MTES_0567"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        598759..600168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0567"
FT                   /product="dTDP-4-dehydrorhamnose reductase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0567"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73531"
FT                   /db_xref="GOA:E8NBS1"
FT                   /db_xref="InterPro:IPR000888"
FT                   /db_xref="InterPro:IPR005913"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR029903"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E8NBS1"
FT                   /protein_id="BAJ73531.1"
FT                   /translation="MTIEFGKALSARTTPIPGLILLDLPVHGDTRGWFKENWQREKMLA
FT                   AGIDLPDFGPVQNNISFNDAAGTTRGIHAEPWDKYVSVATGRIFGAWVDLREGDTFGAV
FT                   FTAELDASTAIFVPRGVGNSYQTLEPDTAYTYLVNDHWSPDATYTFLNLADETAAIAWP
FT                   IPLDSVEISAKDLQHPRLADVVPMAPAKILVTGADGQLGRALRAEFGEHPWIEYASRAD
FT                   LDLTSSDLDAARRWRDYRAIINAAAYTKVDAAETAEGRVEAWKANVTAVAALSRVATAH
FT                   GVTLVHISSDYVFDGTKDAPYTASDPLSPLGVYAQTKAAGDAIVSVVPRHYIVRTSWVV
FT                   GEGKNFVRSMVDLAERGIDPRVVNDQIGRLTFASDIAASIRRLLESGAAYGVHNVTSVG
FT                   EPAAWHEVAREVFRLTGHDPDRVVGVSTDEYHAASTARISPRPRNSVLETSILDVTWQE
FT                   RLAEYLAAARS"
FT   regulatory      600227..600232
FT                   /locus_tag="MTES_0568"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        600241..601152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0568"
FT                   /product="ABC-type polysaccharide/polyol phosphate export
FT                   systems, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0568"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73532"
FT                   /db_xref="GOA:E8NBS2"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:E8NBS2"
FT                   /protein_id="BAJ73532.1"
FT                   /translation="MSRANEEATLRLQRLAATPLKPVGAISGSGAWWGAVRAIFSHREM
FT                   LGLLVRRDLKARYKDSTLGFFWSLIRPLIQLAVYFVVMGQFLGAAKSIPDFAVYVFAGL
FT                   SAIGLFTEIVVGGTGSVLTNAGLVKKVYLPREVFPLSSVGSALFNFCIQLIVLIGATFL
FT                   VAKPPFHLQLVYAVPSILLIVLYGTAFALLFSAVNVYLRDVQYLVEVITMLLFWASPIV
FT                   YSWQMAKTLIPSPVVLDVYTNNPLTLAVLGFQRAFWVAGDTAEWPSDLLLRMGIAGVIG
FT                   LVLLLVCHRVFIRLQGNFAQEL"
FT   regulatory      601142..601147
FT                   /locus_tag="MTES_0569"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        601158..602387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0569"
FT                   /product="ABC-type polysaccharide/polyol phosphate
FT                   transport system, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0569"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73533"
FT                   /db_xref="GOA:E8NBS3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029439"
FT                   /db_xref="UniProtKB/TrEMBL:E8NBS3"
FT                   /protein_id="BAJ73533.1"
FT                   /translation="MPTPPVLPADNAPRPEVARIRGVSKKFTIRKDSSIKERVVTLGRA
FT                   GRRHKKEFWALRDVDLDIYAGETIGLIGHNGSGKSTLLKVIGGIVDPTSGTVEERGRLA
FT                   ALLELGAGFHPDLTGRENVFLNASVLGLSREETEAQFDDIVAFASIGDFIDTQVKFYSS
FT                   GMYVRLAFAVAVHTDPDVLLVDEVLAVGDEAFQRKCMDRIRDFQKEGRTIILVTHSLDQ
FT                   VVELCGRAVLLHQGEVLFDGAPSTAVARFRDLLEERRVAERDAADPGAPRPQGSVDSVR
FT                   AVVVGRGPGEPLQPGDDLEIQLTLSSTHLDKWGCRIQIDDHMGHKMFVTGTDWLKTPVD
FT                   PMTGSAEVSFVLKDPPLAGGKYFINATLIDAHGNDLHNIMQATSFNVEFDPRATGYMRI
FT                   DVEGSAIPGR"
FT   CDS_pept        complement(602487..603350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0570"
FT                   /product="nucleoside-diphosphate-sugar epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0570"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73534"
FT                   /db_xref="GOA:E8NC86"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E8NC86"
FT                   /protein_id="BAJ73534.1"
FT                   /translation="MNRIVVITGAGGYVGRHVTRAVAELGYEAVAVVRQRREGDLAAEA
FT                   RIVEADVLDPSFDIATVAPVERIAAVIHLAWQDGFVHNAPSHLERLSDHYRFLAGLVTA
FT                   GVSRIAALGSMHEIGYWEGAVTAETPTNPVTLYGIAKDALRRSATLTIGDRAEFVWLRA
FT                   YYILGDDRRNRSIFAKLLEAADRGDTVFPFTSGRTLYDFIDVAELGRQIAVAATVEGLT
FT                   GIVNVASGEPESLANRVERFIAENGLDIALQYGAFPDRPYDSPGIWGDAATITELMARS
FT                   PFDQRS"
FT   regulatory      complement(603356..603361)
FT                   /locus_tag="MTES_0570"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(603367..604602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0571"
FT                   /product="predicted acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0571"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73535"
FT                   /db_xref="GOA:E8NC87"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:E8NC87"
FT                   /protein_id="BAJ73535.1"
FT                   /translation="MIAVRSLGEAFDPRHNSIGFLRWAMAFMVIFSHAGPVAGIFGGVD
FT                   IGAQWGAETSLGGVAVTGFFFLSGMLITRSMVRSRSPFRYLWHRVARIYPAWFLILVVT
FT                   AFLLAPLAWHHSQGTFQGFLSFPDNSPWDYVANNFTLVLNQWAIAGTGGSTHAVQVGYN
FT                   TWNGSAWTLMYEFACYLGILALGIIGALRARIVGALVAGGLLLLSTFQALHIGDLGSAI
FT                   QTFSNPQVLQLVAPFAFGTLVQLYIEKVPFDDRLGIAMLVIAALCWWRGGWFLFGQYAF
FT                   AYGLIWFGTRVKALSRWDRHADLSYGIYIAGWPVMFLAAEYGLPERAGAFVYLLVVIVV
FT                   VHVYAYLSYMLIEKPALDLKNWMPRWLARIRGVDPVAPGGGGTGILVRARFVPLVLLLI
FT                   ATAALVVIGVVR"
FT   CDS_pept        complement(604599..605723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0572"
FT                   /product="predicted glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0572"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73536"
FT                   /db_xref="GOA:E8NC88"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E8NC88"
FT                   /protein_id="BAJ73536.1"
FT                   /translation="MTAATPRILLAVTFYNGRDFARRTFESIAHLDREGFELDVLVLDD
FT                   CSPEPGFSEYLAELAAEFGAVFYRSPRNQGIPRNVNLGLATAQRLGYDYVIISNSDVIY
FT                   SRNSVKVLLDVVSASPAAASVTAWSTNVDPYSLPNGTELYVETPEVADLIGEALSDEFA
FT                   AEALEIPAGISFAMIVPVSVLPTVGLMDPVFGRGYGEESDWSARATSAGYQHLLAQGAF
FT                   VYHAGRGSTLAAGVISQSDIADWSNQHIVNHRSPMFRWSVDGFLRSGVLEKAQVRAVAA
FT                   LILAAAARGGYAVIDPTMDWDDQDPSVVTVAIRSQAYEMCTAHWNGFTVEIDTDSLDVL
FT                   ASIRNFFSGAEPVYTNIPAATWEGAEEFGYPLGV"
FT   CDS_pept        complement(605720..605986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0573"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0573"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73537"
FT                   /db_xref="UniProtKB/TrEMBL:E8NC89"
FT                   /protein_id="BAJ73537.1"
FT                   /translation="MGKNQELTAEAVDAVSLERALQDAEIANRRVIELTRGLLEREEQI
FT                   AKLQLEIVSLKQLLDPRRKMEHVFRKNHALYVVARRARRMMGQ"
FT   regulatory      complement(605733..605738)
FT                   /locus_tag="MTES_0572"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(605996..606001)
FT                   /locus_tag="MTES_0573"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(606196..608877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0574"
FT                   /product="uncharacterized protein potentially"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0574"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73538"
FT                   /db_xref="InterPro:IPR013207"
FT                   /db_xref="UniProtKB/TrEMBL:E8NC90"
FT                   /protein_id="BAJ73538.1"
FT                   /translation="MTFAPARARFSWALAALASLALVLGILPVLAPAVAPAATAANASD
FT                   FQDGFLISDDNFFDAGSMTAADIQNFLNSKVTSCRGDEGMPCLKDYVAQSTPSLGADSY
FT                   CRAFGGGTMSAAQLIAAVSQACGISPKVILVMLQKEQALVTDPAPSPYQYRAALGQGCP
FT                   DGAACDPNFAGFFYQVYGAARQFQIYVKNPRWYSYQLGWNNILYQATPPDNDRVCGTKR
FT                   VNIQNDATRALYIYTPYTPNQAALNNLYGTGDFCSAYGNRNFWRLYTDWFGSPTASPVS
FT                   GEYARVWASLGGAGGLLGSPTSTEQCFGTYCQQSFRNGTIFWFPGRGVFGVPSVIESMW
FT                   RNLGFIDGAVGRPTGVVVCQSDMTCTQSFDGGVMAADPTGGNLVGRHVESVWSSSGGIA
FT                   LGAARGPEVCSNGSQCAQMFAHGALFSGGSATAVTEPIFSAWVQAGASGGSLGFPRSDA
FT                   SCVSAGCTQRFGGGLIASSGRDSAQVVPEPIATKYLRAGGPAGVGGPAGPQTCDSSGAC
FT                   SQRFGSARIDTSSKGTFITMKWFFDAWSAAGFEKGRLGRPLADMACIPATCYQRFTGGT
FT                   LSGSPSGGVLAVYGAYRDLWSKNGGPGGSLGLPTGSESCNGVNCAQSFQKGVIGWTPKY
FT                   GAVAVTGRYLTAWQAQGAGDGRLGGPRSAPSCSGGVCTQAFQTGVLTTAPSGALVAVAG
FT                   EYQSVWNRAGGAKGQLGRPMSDESCNGRSCSQVFQNGVIVWTPGSRAVIVSGWFLAPWQ
FT                   AAGSENGRLGAPTAAMVCLPVTCYQAFQGGTLTGSPSAGILPVYGAYRDVWMSAGGPAG
FT                   TLGLPTRAESCFGSYCRLPFERGTIIWRQSVGALAIAPPVFAPWDAAGGVTGRYGLPLA
FT                   PAVKSGGKVTQSFERGTVSAGG"
FT   CDS_pept        complement(608874..609356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0575"
FT                   /product="Fe-S oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0575"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73539"
FT                   /db_xref="UniProtKB/TrEMBL:E8NC91"
FT                   /protein_id="BAJ73539.1"
FT                   /translation="MLRGALVTVALVATLTACASRPGASTTATPTAEPTTTASASPSPS
FT                   ATPSPEATDEVQPEPVATSSGPASVTIVNYGADGRNISASGLVSGPIEEGGVCTLTATS
FT                   ATGAILTGSIDAVATPAAVNCGIIDIAAPAGEWKLVLEYRSARTSAASEPVTVSQP"
FT   regulatory      complement(608889..608894)
FT                   /locus_tag="MTES_0574"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(609486..611960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0576"
FT                   /product="uncharacterized protein potentially"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0576"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73540"
FT                   /db_xref="UniProtKB/TrEMBL:E8NC92"
FT                   /protein_id="BAJ73540.1"
FT                   /translation="MASRVFTGIAALAVVLASLTSATGAAALEPRPTVPSPAPTARVQA
FT                   APSGDADATGELVELSDLPGSTGSTFFVRDEAGEATAVTADAVEKVGAVAGDRVEIADG
FT                   ELSVLSEVDAAAAGLAHSVDVVLVTVRMPAADGRPAYEARPSASVDTVRSWLSYASDHL
FT                   RQASNGRVASLALGAQAEITTAGTCQLDLAGSSGDLTVWNEAARAIAPGRSAASYENSG
FT                   GRHLLVVFPEDCAEAWQGSVGIANVGGGLSYGGNIALLDVGQGQRQAFLHEFGHNLSLR
FT                   HANNYACLPLQRHWEGNDGCGFSKYADIYDPMGVVVDGDYDSPLFNAAHRDALGGYPQG
FT                   SLVTVEQDASTSVTLRAASSTTGTLAVKVRDSNGWDYYLDLRNGRGSYDGGAYYTRGRG
FT                   CDITWVCTRDYGVRITQQQSADTTSYAVASSQDDGDGYALVKGDWFSSSEGSSCDIWLS
FT                   VDDMSTDGAGRPTSATVTVRTGDKAPACGTSPDGVHPWFQAKYKELGGASGPLGKPVAP
FT                   MVCQSSACWQEFAGGVLTSDGTQIVMLSTAYVTTWLANGGPDGALGLVAGPESCFGTYC
FT                   ATPFAGGAITWVPGQGVTAVPVHPWFQAKWKELGGITGAIGTPTEAMRCQSSACWQQFT
FT                   GGVLTSDGRQIVRLSSDYVSTWTAWGGPDGDLGLVAGGESCFGSYCQASFVGGVIVWVP
FT                   NSGVYPVAKKWFYPAWMERGGATGALGLPSDAMKCQSAACYQVFQNGTLTSSTSGILSL
FT                   SSAYVSMWIGGGGPDGQLGLLTGPEVCSGSFCQVPFQRGLMVWQPRTGVRILTGSEADE
FT                   WRRTHPVAAPVR"
FT   regulatory      complement(611969..611974)
FT                   /locus_tag="MTES_0576"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      612005..612010
FT                   /locus_tag="MTES_0577"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        612019..612624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0577"
FT                   /product="histidinol phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0577"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73541"
FT                   /db_xref="GOA:E8NC93"
FT                   /db_xref="InterPro:IPR004446"
FT                   /db_xref="InterPro:IPR006543"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR013954"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:E8NC93"
FT                   /protein_id="BAJ73541.1"
FT                   /translation="MNSRLFALVDERVGRSWTLFLDRDGVVNTRIMGGYVRTWDEFHFE
FT                   PGVLDALAVLARWAPRIVLVTNQQGIGKGLMTEADLAELHERMRHDIVEAGGRLDGIRY
FT                   CPHLDADDCPCRKPRPGMAQDDLAEHPEMDGALSVMVGDTPGDVEMGRRLAAANGGGAT
FT                   VRIAPEADPAADLTYPSLATFAAALAPLVAASPGHSAE"
FT   CDS_pept        complement(612609..613190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0578"
FT                   /product="phosphoheptose isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0578"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73542"
FT                   /db_xref="GOA:E8NC94"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR035461"
FT                   /db_xref="UniProtKB/TrEMBL:E8NC94"
FT                   /protein_id="BAJ73542.1"
FT                   /translation="MGVLQENLLENAQRMAALAEDAAFGAAFDRAADAMITSLRQGGTL
FT                   LACGNGGSMTNAQHFAEELTGRFRGNRPPLRAMAISDPSHLTCVANDYGYEYVFSKFVE
FT                   AFARPGDVLLALSTSGKSPNVLRAAEAMKAAGGIVVASSATAESPLGQVADVTIALGAS
FT                   RWADRVQESELVVIHSLMQAIEDGFGYSAE"
FT   regulatory      complement(613196..613201)
FT                   /locus_tag="MTES_0578"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(613219..614703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0579"
FT                   /product="ADP-heptose synthase, biproductal sugar
FT                   kinase/adenylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0579"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73543"
FT                   /db_xref="GOA:E8NC95"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011913"
FT                   /db_xref="InterPro:IPR011914"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023030"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:E8NC95"
FT                   /protein_id="BAJ73543.1"
FT                   /translation="MSALPPITPQHILGFEGARVVVIGDAMLDRYVAGAVDRISPEAPI
FT                   PVLRVRQDRSVAGGAANAAMNIAALGVQTTLVAAWADDEAGRELERLLSGTGVVTSPIR
FT                   RGAAATIEKLRVVAGMQQIVRVDREDLTPLDAEGADAAFAAVRAAVGEAPSRTAIVVSD
FT                   YAKGMLSEDLVARVIDLASELGIPVVVDPKSTDIRKYRGATIVKPNFAEALQMSGLRAD
FT                   APDDETLDLIAERLLIGGIGSLAISLSAVGVEVIETSARTRIPTRARLVADVSGAGDSM
FT                   IAGISAGLAAGLSTLQAVQVGNMAAGIACGRPGTAVVSSADLLNELLVESSPEDRPGTI
FT                   EDWDELAQLVAVEKDAGKTVVFANGVFDLLHAGHVALLREARSLGDVLVVGVNSDESTA
FT                   RLKGPTRPLQPQADRMSVLEAVRYVDFVTVFGEDTPRELIRAIRPDVIVKGSDYRPDQV
FT                   VGGEDAKAWGGRVHIVNLLDGVSTTRLSQGQQVRRG"
FT   regulatory      complement(614710..614715)
FT                   /locus_tag="MTES_0579"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(614766..616004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0580"
FT                   /product="ADP-heptose:LPS heptosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0580"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73544"
FT                   /db_xref="GOA:E8NC96"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="UniProtKB/TrEMBL:E8NC96"
FT                   /protein_id="BAJ73544.1"
FT                   /translation="MRSLLRRAVWQINAIRHRDPLSPAVFARLFGARRRRPWDPTVRPR
FT                   RIVVLRSDEIGDTSTTLALFAAIRAHWPEATVHFVLKPGPATMFHATPTVDRVIEWMPV
FT                   TEGSALKRQILTARQGLRRFGLRGYDLAILPRWDFDDTPVRYLAVASRARSVVGFAPVP
FT                   EREPEWFGPQDKLLTDVISRGTTPRLTVGQLRRVAEYLGLPWEDHRLPPVGRGLFDDAD
FT                   LRAATAKASLGDTDGIVVGLGIGARDAKRQWPVEDLAEVMQNLAAERPVAVQILGGGVD
FT                   TARARELVSLLEARGIRAVDLAGKLSLSESAAAISRCDVFLGNDSGLQHISSSLEVPTV
FT                   VVTCHPASGSPWSDNAPERFGPWSARSAMLQPSHPADGCVDECVAREPHCIRAVRPDEV
FT                   TAAVEGLLREPTD"
FT   regulatory      complement(616012..616017)
FT                   /locus_tag="MTES_0580"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(616049..618301)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0581"
FT                   /product="uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0581"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73545"
FT                   /db_xref="UniProtKB/TrEMBL:E8NC97"
FT                   /protein_id="BAJ73545.1"
FT                   /translation="MRLGRLRESVRRSRELPVVGPVVRAADRIWWARTIGRSELVDAEY
FT                   YGTQLGFPRVPRSIAIAHYVAWGFRRGMSLNPLFDDIVAGGQLPEVFRVPALYAYLLSE
FT                   RETVRVHPWWDAEEYGRKHGGPGLEHAWTHRDAEIELTAAGHLRRATVDEMRRRALAAA
FT                   RTWRRHRASRGVKSTPGDVGLIRPIQARDRRYDRKLAQAAARAAHDRVIVPLVGVDASQ
FT                   WVSAHLLADVVPELGLSGERSRVTWPAMLHRAAAALDVDVSAVLDSRAEFTDDEIDALV
FT                   DTARAHVVALPVHRAFDGTVLGVGAAETGGAAAWGILAEHPVEDLDALDAVVDVPLVHG
FT                   LSMALPHAVLRETLERDAPTSATAFARALRSRTGAKALTGIRPVLEEPTLVFAEPRPSQ
FT                   KGSDRDRGVAADLVTAAGFDVLSWRTGEGRTVEPVRRWRRPTPDAERWAIKICAPAGRR
FT                   GAVWGDMHFARGLAAALRRRGHTVVIDAFDARARRTADLDDVSVVVRGPYRIDPVGPGV
FT                   SLQWIISHPDDLTRGELAQFDRVFAASERWSARTRERWGIDVQPLLEATDTDLFHPRGV
FT                   DRTDEIVFVGTARGIARPSVVVPLRAGLPVRVYGPDWRPFIPHSAIAAQTIAHAELPRR
FT                   YESASIVLNDQWPAMRRQGFIAMRPFDVVAVGGRVISEDVDGIEEIFGGAVIAYRDERH
FT                   LLELLEADPDEIFPDRVRLGQIAERVRAEHSFDARAAILDEAARSARSARSARTGR"
FT   regulatory      complement(618308..618313)
FT                   /locus_tag="MTES_0581"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(618325..619074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0582"
FT                   /product="glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0582"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73546"
FT                   /db_xref="GOA:E8NC98"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E8NC98"
FT                   /protein_id="BAJ73546.1"
FT                   /translation="MRVVHIAPGDGGRCVAANAGVRALETEYVVLHDDDDRWHPAFLER
FT                   TVAWLDAHAAHAAVSAATEIVYEENRGGTWVEVGRAPFWAGMSRISLGEMMSVNRAVPI
FT                   SVVYRRRLHEEIGWYDETLDAVEDWDLYLRMLRDHEIGFLAGEPLAFWTQRPDSVGLDA
FT                   NSMFGLAAEHARDDAVVRDRALAEWVHREGPGLPLYLASLQTQLAAHVDEAVDRLRAEL
FT                   REDVRREIDAHQPLLSRVRRLRSRLRR"
FT   regulatory      618947..618952
FT                   /locus_tag="MTES_0583"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        618958..619305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0583"
FT                   /product="argininosuccinate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0583"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73547"
FT                   /db_xref="GOA:E8NC99"
FT                   /db_xref="UniProtKB/TrEMBL:E8NC99"
FT                   /protein_id="BAJ73547.1"
FT                   /translation="MPPVVVVVQHHVLGLEGPHTRIRRDAPSAVAGGDVDDAHAIAECR
FT                   LVDEGIDLGRVTAVVDDDDLPVVGPLRGDVAERPTEERRAVAGADDDPGACRHAFEHRG
FT                   GRSRRVLVESA"
FT   regulatory      complement(619078..619083)
FT                   /locus_tag="MTES_0582"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(619302..620405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0584"
FT                   /product="glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0584"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73548"
FT                   /db_xref="GOA:E8NCA0"
FT                   /db_xref="UniProtKB/TrEMBL:E8NCA0"
FT                   /protein_id="BAJ73548.1"
FT                   /translation="MTVTLRVVLDQLVAPTSRDLAEASASLAQALIDTAPRGCDVASIV
FT                   PSPGLPEDAGVTGLSAETRLSMRRRELAASWQLGVAPGVGKGLIHSPTALAPLVRHDRV
FT                   NETHQIVVTLWDLRAWETPDELPRAEALASRALLSRVAKHADAVVVPTHAMAERLGELA
FT                   KAKLVSKIRVIGGAPAAGMRVPSDAVGRLRALDLPTSMLALAGGSATSDGLADAFAAVT
FT                   AAHWEGDVVVLDVPEGEEPAVVELAVAAGIPEARVHARGSLDQWDRAAVLSHASAFVSG
FT                   CARTDWPWRAVDALAVGVPIVAVDTPVHREVLADAVALAPADDLGAALTRALGEDGARL
FT                   RVLAGDRAKGFAWEPCADRIWALHAEL"
FT   CDS_pept        complement(620402..621865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0585"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0585"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73549"
FT                   /db_xref="GOA:E8NCA1"
FT                   /db_xref="InterPro:IPR004474"
FT                   /db_xref="UniProtKB/TrEMBL:E8NCA1"
FT                   /protein_id="BAJ73549.1"
FT                   /translation="MTLAPPRASGRSSLVEQRPLRNPDLGSTSVMTRRGWWLIVANLLL
FT                   PGSAQVLAGNRRLGRFGLGATLALWVMIVLIALGALLAPSTVFAIATGSSIPDFLSWFR
FT                   WVPLTLVQGVLIGYAVLWIVLTIDTLRLVRLVRTGPLARFGIAIVSIGLTSTLVAGAGW
FT                   AVQTAGTTRDAFAEIFAQSAPVVPPSDGYYNILLLGADSGEGRDSMRFDSISVVSINAA
FT                   SGAVTITGIPRDMPNFPFAPGPMQDKYPNGHEGKFDPTCGWGSGINQLRTEVEVCQDGN
FT                   ALYPDAVAHGSEPGIEATKDAAEGILGIQIPYYVLLDMKGFANLVDALGGVDITVDERL
FT                   PKGGPAYDGQPVDDWAFGWIEPGAQHMDGDTAQWYARSRYTTSDFDRMRRQRQLQEAIL
FT                   AQFTPQNVLTHFQEVAAAGTNIVETDLPQGLIAPTLVDLALKAKDQPVSTIELTPDGGV
FT                   DEFDPDYAQVQQMVHDKLHPPTETETPAP"
FT   regulatory      complement(620417..620422)
FT                   /locus_tag="MTES_0584"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(621862..622377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0586"
FT                   /product="phosphoribosylcarboxyaminoimidazole (NCAIR)
FT                   mutase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0586"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73550"
FT                   /db_xref="GOA:E8NCA2"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR024694"
FT                   /db_xref="InterPro:IPR033747"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="UniProtKB/TrEMBL:E8NCA2"
FT                   /protein_id="BAJ73550.1"
FT                   /translation="MTRPLHSSETPVVGVVMGSDSDWRVMNAASEVLTEFGIPHEVEVV
FT                   SAHRTPDKLVRYGREARARGLRAIIAGAGGAAHLPGMLASVTALPVIGVPVQLATLDGL
FT                   DSLLSIVQMPAGIPVATVSINGAKNAGLLAARVLGAADPEIGDRVEAYARDLEIQVEEK
FT                   NRRLKESL"
FT   regulatory      complement(621871..621876)
FT                   /locus_tag="MTES_0585"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(622437..623594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purK"
FT                   /locus_tag="MTES_0587"
FT                   /product="phosphoribosylaminoimidazole carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0587"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73551"
FT                   /db_xref="GOA:E8NCA3"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005875"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR040686"
FT                   /db_xref="UniProtKB/TrEMBL:E8NCA3"
FT                   /protein_id="BAJ73551.1"
FT                   /translation="MDPDEGSGMALRVGVIGGGQLARMMIAPAVELGIEIRVLAEDEGM
FT                   SAALAASAVGDYRDAETVLAFARDVDVITFDHEHVPQDVLAALVDAGVPVHPGPAPLAV
FT                   AQDKLVMRTRMAELGLPQPDWAAVADAAELQAFLDAHGGRAVVKTPRGGYDGKGVRVVS
FT                   ASTEADDWFAALAEDGNGGALLVEELVDFTRELAQQVARRPSGEVRAYPVVETVQRGGV
FT                   CTEVVAPAPRADARVQRVAADIGVAVADGLGVTGMLAVELFETSDQRILINELAMRPHN
FT                   SGHWTQDGAVTSQFEQHLRAVLDLPLGSTDATAPWAVMINVLGGPAEGTLEERFPAALE
FT                   AHPAAKVHTYGKAPRPGRKVGHVNVTGEDLDDVVYEARAAAAFFD"
FT   regulatory      complement(623604..623609)
FT                   /gene="purK"
FT                   /locus_tag="MTES_0587"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(623787..624341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0588"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0588"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73552"
FT                   /db_xref="GOA:E8NCA4"
FT                   /db_xref="InterPro:IPR005182"
FT                   /db_xref="UniProtKB/TrEMBL:E8NCA4"
FT                   /protein_id="BAJ73552.1"
FT                   /translation="MTQPTSYGGRPRTPAPGAAAPELRIARIRSHARRLVWSALVLIAV
FT                   AGATTYFYDNLPAPFENWMLVSAAAAVVLLLVVLPYIVWLSHSWTITTRRVIERSGFFG
FT                   SRRQEISHVRGYSIQMRRGVLQRLWGAGTLTLSNGVEPPLRMKNVPQAVLLHETLVDQV
FT                   EVNQILAHRDSQAFGSGSVDV"
FT   regulatory      complement(624345..624350)
FT                   /locus_tag="MTES_0588"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(624399..625187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0589"
FT                   /product="biotin-(acetyl-CoA carboxylase) ligase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0589"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73553"
FT                   /db_xref="GOA:E8NCA5"
FT                   /db_xref="InterPro:IPR003142"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004408"
FT                   /db_xref="UniProtKB/TrEMBL:E8NCA5"
FT                   /protein_id="BAJ73553.1"
FT                   /translation="MGMPIPEAGYPRTAAVSPRVQVVETTDSTNADVVAAVAADPAGWP
FT                   HLSLLVTRDQRAGRGRLDRSWTAPAGTAIAVSVVVDASTVPPALRGWIPLAAGAAMTRA
FT                   VGAQLAGHSGTTELKWPNDVLVDGGKICGILAEAVPGTFDTVVVGAGVNTRMSRADLPV
FT                   TTATSFAAIGAECDEDRLIADYVTGLSELLTALSGGREERVHSDIEKLCATVGRDVTVS
FT                   LPDGTTLSGRATRLDETGRLVVEAGTIVEAVSAGDVVHVR"
FT   regulatory      complement(625197..625202)
FT                   /locus_tag="MTES_0589"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      625328..625333
FT                   /gene="pccB"
FT                   /locus_tag="MTES_0590"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        625341..626930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pccB"
FT                   /locus_tag="MTES_0590"
FT                   /product="acetyl-CoA carboxylase, carboxyltransferase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0590"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73554"
FT                   /db_xref="GOA:E8NCA6"
FT                   /db_xref="InterPro:IPR000438"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:E8NCA6"
FT                   /protein_id="BAJ73554.1"
FT                   /translation="MTDQPDLFTTAGKIADLRTRFQEAVVDAEASARDKQHAKGKLTAR
FT                   ERIEMLVDPGSFVELDEYVRHRTTAFGMDKARPYGDSVVTGTGTIHGRTVAVYAQDFST
FT                   FGGSLGEVAGDKIIKVMELALRSGIPIIGILDSGGARIQEGVVALGKYGEIFRLNTAAS
FT                   GVIPQISLIMGPAAGGAVYSPALTDFVIMVDKTSQMFVTGPDVIKTVTGEDVGMEELGG
FT                   ALTHNSRSGVAHYLADDEDDAIDYARTLIGYLPDNNLAEIPVYETPFEFETTDADRSLN
FT                   TIIPDSPNQPYDIHTVIAGIVDAGDFLEVQPLFAPNIVIGFGRIEGRTVGIIANQPSQM
FT                   AGTLNIDAGEKASRFVRFCDAFSVPIVTLVDVPGYLPGTDQEWTGVIRRGAKLLYAYAE
FT                   ATVPLVTVILRKAYGGAYIVMGSKQLGADINLAWPTAEIAVMGGQGAVNILYRGEIKRA
FT                   EEAGEDVAAVRTRLANEYTYNVASPFLAAERGELDGIIEPAQTRVSIAKALRALRNKRA
FT                   SLPAKKHGNIPL"
FT   regulatory      626911..626916
FT                   /locus_tag="MTES_0591"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        626927..627175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0591"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0591"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73555"
FT                   /db_xref="InterPro:IPR032716"
FT                   /db_xref="UniProtKB/TrEMBL:E8NCA7"
FT                   /protein_id="BAJ73555.1"
FT                   /translation="MSDARPRTDSDPALPPVVAEVVRGTPTEEELAAAVVVVSEAYARE
FT                   VADATVPETASRSRWELSARGLRTQLDRAAGWHSFTA"
FT   CDS_pept        complement(627406..628443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0592"
FT                   /product="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0592"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73556"
FT                   /db_xref="GOA:E8NCA8"
FT                   /db_xref="UniProtKB/TrEMBL:E8NCA8"
FT                   /protein_id="BAJ73556.1"
FT                   /translation="MTVRAMLSVIALAFTAYLAARGLLWTSPETVERGWLIIAALVLYL
FT                   PVTWLWILLPGSRPQATPVATPGERSSLPGWAAALALVASAVVPNAAFLAVTPDGRTQP
FT                   FVTWVIGGIGALMTIVMVRHRPIIAWIGMAALAVSASAWLGPVSALSLGLVGSLVWVSV
FT                   AQLMSIALQRTARDAAQLSELQQAASAWQAAQSGRQRERRIHVQRALAVAGPVLARVIE
FT                   TGGNLRPSERTAARLAEHSLRDELRSPRLLDQGVRAEIDAARRRGSAVSLFDEGGLDGL
FT                   DAAELQTVRAELAEILRGAVSDRLIIRTSPHNGVAVTVVGRSTGQGAGGDDDEVDLWRE
FT                   IRRPR"
FT   CDS_pept        complement(628440..629735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0593"
FT                   /product="signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0593"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73557"
FT                   /db_xref="GOA:E8NCA9"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E8NCA9"
FT                   /protein_id="BAJ73557.1"
FT                   /translation="MTPPKPGPMPDTLRSEAQRTVLEEAWGRIPHSRESRDDPGSFTQK
FT                   RIERVLTIFVGPASLALGAQALIAALGRADERDGWHLPLAVGVFVPLAAMIVACAVGRF
FT                   ARVFAGIFAVVFMVALALWPVATAGGPPPSPLENPWIFYLINVATVAAVVAFPMSLQIV
FT                   WTVAAPVLFGVVRLIQAGGRSEFSVPVALDVSFALILGSVLVTLTWMYRSIAAHVDETR
FT                   AQAVSSYAEAAATAATENERVAVAALMHDSVLGALLAAERASTPRERTLAVSMAREALT
FT                   RLANAEKDALEGSDAPVDAAGLADEIETAARELGVELAVRRRIDEGTPRVPGRVARALS
FT                   LAAMQAVANAVQHAEARGLSVEVSGYADPGGIAVRVRDAGDGFDLEAIPADRLGIRGSI
FT                   IARVTAVGGRSDIESGSSGTTVTLEWESGDRW"
FT   regulatory      complement(628455..628460)
FT                   /locus_tag="MTES_0592"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(629704..630369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0594"
FT                   /product="response regulator containing a CheY-like
FT                   receiver domain and an HTH DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0594"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73558"
FT                   /db_xref="GOA:E8NCB0"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:E8NCB0"
FT                   /protein_id="BAJ73558.1"
FT                   /translation="MTRVALIDDHESVRLGLEAALAQTAATEVVFSGANVAAYLDWRRV
FT                   AVQSPADVVVLDLTLGDGTTVSENVDRVVRDGSSVIIHSVADRPAAVREALAAGAAGIV
FT                   SKSSPTHEVLGAIGTVARGELLDNVEWASAVEGDRAFADAQLSAREREVLRLYAAGLPL
FT                   KAVADRLGVAYSTAKENITRVRVKYVEVGRPAPTKVDLLRRAMEDGILHDAPEAGTDA"
FT   regulatory      complement(629749..629754)
FT                   /locus_tag="MTES_0593"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(630377..630382)
FT                   /locus_tag="MTES_0594"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(630431..631684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0595"
FT                   /product="SAM-dependent methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0595"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73559"
FT                   /db_xref="GOA:E8NCB1"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030391"
FT                   /db_xref="UniProtKB/TrEMBL:E8NCB1"
FT                   /protein_id="BAJ73559.1"
FT                   /translation="MHDGDLIDLDITGIAHGGVFVGRHEGRVVFVPDTLPGERVRARLT
FT                   DTRKKSFWRADAIEVLDAAPERQRHVWAAADIDVAPEGRPGGAEFGHIALAHQRRLKER
FT                   VIREALERVGRLDLPVDVRPAGSPDDPETPDGTGWRTRLSLHVDEAGRVGAYAARSHRV
FT                   VETPDAPLATAEVARVAAAARSAVPGRLDLVQPSDGRVRVLPRPDGSRSRPTPEVVEER
FT                   VGERTFRVDAGGFWQVHRLAARTLTSLVADELTAVGGVDPEGLHLDLYGGVGLFAATLA
FT                   QLGGSSTRVVSVESDPRATEHAGENLAEWIGARAETARADRFVAKLAADASERERERLA
FT                   RGVVLLDPPRAGAGREVVEGIAALSPATVAYVACDPVALSRDLAIFAEHGYVARDGIHG
FT                   VDLFPHTHHVEAVVVLQR"
FT   regulatory      complement(631693..631698)
FT                   /locus_tag="MTES_0595"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      631837..631842
FT                   /locus_tag="MTES_0596"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        631851..632498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0596"
FT                   /product="nucleotide-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0596"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73560"
FT                   /db_xref="GOA:E8NCB2"
FT                   /db_xref="InterPro:IPR003697"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:E8NCB2"
FT                   /protein_id="BAJ73560.1"
FT                   /translation="MRVCLASTSPARLMLLRQAGIEPEARAPRVDEEAVVAETEAAEGR
FT                   RLPAPEHVLLLARRKAADVALRLSEEDPAFDGVVIGGDSMFELGDEILGKPYTPEAATA
FT                   RWRGMRGRTGVLHSGHSVFRLSPGVAPTEAHAVAEASVTFAADVDDDEIAAYVASGEPL
FT                   LVAGAFTVDGLGGAFIERVEGDPSTVVGMSLSTVRRLVRELGVSWTDLWNRS"
FT   regulatory      632562..632567
FT                   /gene="accC"
FT                   /locus_tag="MTES_0597"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        632576..634342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accC"
FT                   /locus_tag="MTES_0597"
FT                   /product="acetyl/propionyl-CoA carboxylase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0597"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73561"
FT                   /db_xref="GOA:E8NCB3"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:E8NCB3"
FT                   /protein_id="BAJ73561.1"
FT                   /translation="MPKIAKVLVANRGEIAVRVIRAARDSGKASVAVYADQDRDALHTR
FT                   LADEAYALDGATSADTYLSIEKILSVARRSGADAVHPGYGFLAENADFARAVIAAGLVW
FT                   IGPSPDAIEALGDKVTARHVAEKVGAPLAPGTPGPVSGADEVIAFAEEVGLPIAIKAAY
FT                   GGGGRGLKVARELDEVAEMFESATREAVAAFGRGECFVEKYLDKPRHVETQCLADAAGN
FT                   VVVVSTRDCSLQRRHQKLVEEAPAPFLSDEQNAVLYSASKAILKEVGYVGAGTCEFLIG
FT                   ADGTISFLEVNTRLQVEHPVSEEVTGLDLVREQFRLAEGEELGYDDPAPTGHSIEFRIN
FT                   GEDPGRNFLPQPGPIHVFKTFGGPGIRLDSGVTAGDSVSGAFDSLLAKIIVTGRDRAEA
FT                   LERSRRALDEFEVAGMPTVLPFHRKVVRDPAFTAEDGSFGVFTRWIETEFVNDIPAWDG
FT                   ELEAPAAETGRHTVVVEVGGKRLEVSLPDRISAAAPQVGRPAVAPPSRRSHAASPTAGA
FT                   TGDAVKSPMQATIVKVAVEEGQQVVKGDLVVVLEAMKMEQPIQAHKDGTVAGIDATAGT
FT                   TVSAGHQLLLIS"
FT   CDS_pept        complement(634689..636149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpdA"
FT                   /locus_tag="MTES_0598"
FT                   /product="pyruvate/2-oxoglutarate dehydrogenase complex,
FT                   dihydrolipoamide dehydrogenase (E3) component"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0598"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73562"
FT                   /db_xref="GOA:E8NCB4"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E8NCB4"
FT                   /protein_id="BAJ73562.1"
FT                   /translation="MDAMVQSFERKQSVAIVGGGPGGYEAALSAAQLGADVTLVERAGV
FT                   GGSAVITDVVPSKTLIATADAAVAIRNASELGVQLFARDDHGKPLTPEVAINLAAVNQR
FT                   LLSLARQQSDDMRASLLEAGVRIISGHGRLDGPGAVVVSTEAGGTDFDRIEAETLVVSV
FT                   GASPRELPSAKPDGQRILTWTQLYNMKSVPTHLIVVGSGVTGAEFASAYMNLGAKVTLV
FT                   SSRDQVLPGEDQDAAAVLERVFQRGGMTLLSKARADSVVNTGDEVVVTLADGRTITGSH
FT                   CLMAVGSIPNTAGIGLAEAGVQMTPSGHIRVNRVARTSVPNIYAAGDCTNFFPLASVAS
FT                   MQGRQAIFHALGDIVIPLETRRITANIFTAPEIATVGFSEQDVVDGKIAGVVKKLPLSA
FT                   NPRAKMQGITDGFVKLIARKGSGTVMGGVIVGPKASELIYPLAIAVERRLTVDQVARVF
FT                   AVYPSLTSSITDAARAMHIVDRDDPGED"
FT   regulatory      complement(636153..636158)
FT                   /gene="lpdA"
FT                   /locus_tag="MTES_0598"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      636218..636223
FT                   /gene="deoD"
FT                   /locus_tag="MTES_0599"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        636228..637061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="deoD"
FT                   /locus_tag="MTES_0599"
FT                   /product="purine nucleoside phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0599"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73563"
FT                   /db_xref="GOA:E8NCB5"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR011268"
FT                   /db_xref="InterPro:IPR011269"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:E8NCB5"
FT                   /protein_id="BAJ73563.1"
FT                   /translation="MSNSTSHPLDDPAVDPFEVAQAAANDIARLSGVEHHDIAVTLGSG
FT                   WGRAAELIGEETASFPATEVVGFSKPALEGHAGTLRSVRTPGGKNVLVIGARTHYYEGH
FT                   GVRRVVHSVRTAAATGATTMILTNGAGGIRETWKPGQPVLISDHINLTADSPLEGATFI
FT                   DLTDLYSKRLRDIARGIDPTLDEGVYTQFRGPHYETPAEVQMAKAIGGHIVGMSTSLEA
FT                   IAARQAGMEILGFSLITNLAAGIQKTPLSHEEVLEAGREAEPVISALLARVVHAL"
FT   regulatory      637044..637049
FT                   /gene="cpsG"
FT                   /locus_tag="MTES_0600"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        637058..638731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cpsG"
FT                   /locus_tag="MTES_0600"
FT                   /product="phosphomannomutase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0600"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73564"
FT                   /db_xref="GOA:E8NCB6"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:E8NCB6"
FT                   /protein_id="BAJ73564.1"
FT                   /translation="MSEYLTAARAWLAQDPDPVTREELADLISRVEEGDAAAADDLADR
FT                   FSTRLAFGTAGLRGTLGAGPNRMNRVLVAQAAAGFAAYLRERSPGGTPTVVVGYDGRRN
FT                   SDVFARDSVEIFAGAGLHAILLPRLLPTPVLAFAVRHLGADAGVMVTASHNPPDDNGYK
FT                   VYLGGADDGAQIVSPADAEIAAHIQRIADEGDITVVPRSVGYANAPEAVVEAYVAATAA
FT                   VAPAAAGAEGLRWVYTAMHGVGWETVSRVLESAGYPQPVVVEAQIQPDGRFPTVAFPNP
FT                   EEPGAMDLAFETARAADAELVIANDPDADRLAVAIPDAETEGGWRRLSGNEIGLLLGWR
FT                   AARAAASAGTGGTLACSLVSSPGLQAVAENYGLDFRATLTGFKWISRAPGIVFGFEEAL
FT                   GYLVNPEVVRDKDGISAAVALLGMATDARAQGRTVADLLGEFRETFGAFASDQISVRVT
FT                   DVSEIAGIMASLRAQPPAAVGEVAVSRIDDLLLGVDGLPPGDVLRLWLEDGSRLIVRPS
FT                   GTEPKLKLYLDVQAGSAKKANRRLAALRAGAEELLGSVRR"
FT   CDS_pept        complement(638810..641152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0601"
FT                   /product="ATP-dependent transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0601"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73565"
FT                   /db_xref="GOA:E8NCB7"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:E8NCB7"
FT                   /protein_id="BAJ73565.1"
FT                   /translation="MTGPSRSGRSSLLTSIVRDLARPTVFLENRPDGVTRCGPRKTDRH
FT                   PLAGVDDVTALMDVLAHDTALVVDDLDLLPYPVLAPLIDAFHATPTVFLAAMSPRHVVA
FT                   SASAERWATLRPMFDQSAALAIPLPPLSLRETAELGDTLRTARYGADRADDAWQMALHH
FT                   LSGGSPALVREIVEAAATRGRLHAFLPIDPQSDALPGAVVASVTKMLAPLDVRDRRMLA
FT                   ALAELGPVPHGHLGSIVPTDVLARLHDGGLLSAGADASTAAVSGVISRMVVDSSDLGDL
FT                   GDERRALARELLLLSCHASRLTPGEEKFCARWADVTDNASLETALARILPRAALAFARS
FT                   SSPREALTVAERVLAADFDATAFSALILARVALGEYPEAERLLAQFPVPATKEEREGAL
FT                   HLHVSVLLATGAGIDAALDRLRNLAAWAPDDEAWRLRVEYSVNALSLSSGSAPQLPDDV
FT                   AVLAPHADDETFSLAEACQAAVEASRGHSARVHELLRRRQQTHGMDVESNFTVFRLHAF
FT                   SLMMLGEDLDLVQRATRRRLLVARWEDRQDDVALLALMDASIQLIRGQPADALLSLGLI
FT                   DVSPPESVRIWCEVVRAAALVLNGDLVHAAAAIERIDAVSVDWGRGGFGAVRDTVCALF
FT                   DAASRRPFEAASRAERVFEHAQRTMPILIPVLLRLQLQSGTPAEDVLDRAEALAAQFDI
FT                   APLRAFVDELRALTRRGVARLEVLTAREREVVQLAAAGFSNAEIAARLNLSVRTVESHL
FT                   HHARTRLGMGRYERFSSAPASLTAGSR"
FT   regulatory      complement(641162..641167)
FT                   /locus_tag="MTES_0601"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      641489..641494
FT                   /locus_tag="MTES_0602"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        641500..642801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0602"
FT                   /product="DNA segregation ATPase FtsK/SpoIIIE"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0602"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73566"
FT                   /db_xref="GOA:E8NCB8"
FT                   /db_xref="UniProtKB/TrEMBL:E8NCB8"
FT                   /protein_id="BAJ73566.1"
FT                   /translation="MTTRSSTSAARAWRTTRAAGAVAVAAALLIPATSAQAAAVVSQGT
FT                   GRLVETSLLGTNVLDNALALRGAQAVNPDASGDVTVDQPLDASAIAGLIGLSAGSTNLF
FT                   GDNGIIQLGAVGQYAQARDDGSSSAFSGAVSAAPSLIGVGTVTPSSVGSPSANQSATFR
FT                   LGSASAPVGLQVDLGVLAASAQQAADGTQTGQYVLSDAGFAVDGTVVSGALAIVNPALN
FT                   TLIALANTSGAGLTNPFASGKIQLTLDDLTSAAGVASVNDLPPGTDLLSYVPQAVANKI
FT                   ISQVNGVLDAASALAANLRSNIFTAPAGIALQAAVNTAKATIVPVLNGISSTVVTPLGN
FT                   ALTQLAQMQVNVQSTGSDGSFTQTALRLGLGPSGSLASVNLANATVGPNAGQLAVPVAG
FT                   PESLALAGGFVGVGAIVMARIALRRRTRPASIRS"
FT   regulatory      642794..642799
FT                   /locus_tag="MTES_0603"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        642806..643000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0603"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0603"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73567"
FT                   /db_xref="GOA:E8NCB9"
FT                   /db_xref="UniProtKB/TrEMBL:E8NCB9"
FT                   /protein_id="BAJ73567.1"
FT                   /translation="MYRNGAMGGGAAILAVTGSTAPTATLVVVGAGAALLGALFAWRSV
FT                   WLRGHGDEATASGEARRNP"
FT   regulatory      642978..642983
FT                   /locus_tag="MTES_0604"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        642997..644361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0604"
FT                   /product="glycosyltransferase, probably"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0604"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73568"
FT                   /db_xref="GOA:E8NCC0"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E8NCC0"
FT                   /protein_id="BAJ73568.1"
FT                   /translation="MNPLDILFSLSFVFLVMFLTYTTLIVVPFARRRRARGGDPRAFEW
FT                   HAFIPCRDEATVIADTLRRMRERFPDVHVWIIDDASTDGTGDIVSTIAAGDPFVHAVIR
FT                   RLPDARTGKGAALNAAYAQLTHWRVAQGEGGAEDDRTIVIVLDADGSLAPNALRQASGP
FT                   TAFGAADVGAVQVAVRMSNRDDPAPLPGRGRLAQAWARYLVRMQDIEFRTTIAAMQVLR
FT                   MRTVSVGLGGNGQFTRLSALRAASSAQGEPWGDALLEDYEVGLRIMLAGYRTVYAHDTW
FT                   VSQEALPSARRLLTQRTRWCQGGLQCARYLPRIYSSRNFTNAGALEAAYFLAIPYIQLA
FT                   GSVLWPSVAAAMLVSGALAPGGILGWISSSMWIVPLWVLTGILPFSLWPLVYVLREERH
FT                   PLWRAAVWGLGYWLYMYQSYVCVIRAFGRMLTGRRGWTKTRRNAEAGRLLLAVES"
FT   regulatory      644346..644351
FT                   /locus_tag="MTES_0605"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        644358..645089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0605"
FT                   /product="HD superfamily phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0605"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73569"
FT                   /db_xref="GOA:E8NCC1"
FT                   /db_xref="InterPro:IPR019127"
FT                   /db_xref="InterPro:IPR026392"
FT                   /db_xref="UniProtKB/TrEMBL:E8NCC1"
FT                   /protein_id="BAJ73569.1"
FT                   /translation="MSIAVAAPRTGRAHRTVLAALLLTTAALLIVAEADTRRAEAQLAR
FT                   AVVAALTPGRAVASGSIVYFGIGTPEVTGLSITTLCSTTVLVVPLVLVAVAVLGVTRAR
FT                   SPRVGLGLIVGVAIAVTSNMIRFGSAAWAYSEYGRDGFDLVHRYLGSLFVIAGFIAAIL
FT                   LVLRIALRESPRRAIPDATLRRRGRARAEDAPRTTRRGRSTASSTARSAAPATDPPADL
FT                   AAPLRRDRHRTGTRPGRKDRR"
FT   regulatory      645074..645079
FT                   /locus_tag="MTES_0606"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        645086..646231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0606"
FT                   /product="UDP-N-acetylglucosamine 2-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0606"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73570"
FT                   /db_xref="GOA:E8NCC2"
FT                   /db_xref="InterPro:IPR003331"
FT                   /db_xref="InterPro:IPR029767"
FT                   /db_xref="UniProtKB/TrEMBL:E8NCC2"
FT                   /protein_id="BAJ73570.1"
FT                   /translation="MSRPWIDVVYGTRPEAVKCAPLVAELRRRESARTTVTVTGQHRQM
FT                   ADEVNASFGITPDVDLDVFRRGSSLAETSSAIFAALAHRWAEAAPDAVVVQGDTASAAL
FT                   AAVAAYYAGARVIHLEAGLRSGDLRSPFPEEGNRRLIAPLASLHLAPTDSAAANLRAEG
FT                   VAPDDIVVTGNTGIDALHWQRTHPQRFDDPAMEEVVNGWDRLVLVTVHRRESWGGPLAR
FT                   VVAAVAETVTARPDVVAVLPMHPNPRVRREVLAAVGDTDRVILCEPLPYAQFGRLLARA
FT                   HCVVTDSGGVQEEAPALGVPALVVRDTTERGEGVEAGVARLIGTRREVVAAELATLLDD
FT                   PAAHARMSRARELYGDGRAAPRAADAIESLLSVARADVLAG"
FT   CDS_pept        complement(646308..648236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0607"
FT                   /product="transcriptional antiterminator"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0607"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73571"
FT                   /db_xref="GOA:E8NCC3"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR011608"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036634"
FT                   /db_xref="UniProtKB/TrEMBL:E8NCC3"
FT                   /protein_id="BAJ73571.1"
FT                   /translation="MTTKARQDRLLALLLRDGEWSTAASLADALGVTPRSVRSYVTAIN
FT                   ARVGDGTAVESGPLGYRAGSEAAVALRASGGADAGTPRDRLHTLVRRLLDSADGIDVFE
FT                   TADALHVSAATLEADLSRVRGLLGGTELTLERSASLARLRGTEVAQRRLLSKLAHDEMD
FT                   AGHFDLDALRRTLGERSVGARAFGPFKAELVAELGALGYFVNEIGIGDVVMHIAIAADR
FT                   TTRDRALGSTGADVSDATAAVAELLDRLTLKHIGVQLGQGDLRHLATLVLTRIVAPGAP
FT                   AADDVRARLSPEVEAAVRAVVEAAASQFLVDIVHEDFILRLALHVQNLLHRSREQAWSR
FT                   NPLTRSLKSTYPMIFEVAVYIATGLQDSLGIPILDDEIAYVAMHVGGRLERSRRADQLL
FT                   TATIVCPGYYELHELLRSSVDRSLGQAIEVVGVETRIDPVWEGIDTDLVLTTIDPPRTG
FT                   DRFVRIQPFLTDADVERVQAAAGRVRRGRRLARLRAELERYFSPDAFVRGLDGAEGEAG
FT                   VIRDLGALLTHQGVIDDDYVTRAVEREAISSTAFTDALAVPHAMGMTATQTRIAIGIAD
FT                   PSIAWGEGRVQVVALVAFSETDREAFQTVFEQFVEVFSERDSVQRIVRRGTDFAAFLDE
FT                   LVAVIDG"
FT   regulatory      complement(648243..648248)
FT                   /locus_tag="MTES_0607"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      648402..648407
FT                   /locus_tag="MTES_0608"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        648417..648764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0608"
FT                   /product="phosphotransferase system cellobiose-specific
FT                   component IIB"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0608"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73572"
FT                   /db_xref="GOA:E8NCC4"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR013012"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:E8NCC4"
FT                   /protein_id="BAJ73572.1"
FT                   /translation="MRILVVCGAGASSTFVAQRVRRAAHERGLDYSASAGTIRSLPIDL
FT                   DSCDVVLVGPHLETDLDGIERDAATRGVRVVLLPADVFTDLDGSRTLALVQGALVQGAL
FT                   GARPLPTLEKE"
FT   regulatory      648756..648761
FT                   /locus_tag="MTES_0609"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        648767..649042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0609"
FT                   /product="phosphotransferase system, HPr-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0609"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73573"
FT                   /db_xref="GOA:E8NCC5"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="UniProtKB/TrEMBL:E8NCC5"
FT                   /protein_id="BAJ73573.1"
FT                   /translation="MPRLTRTVRIGSSHGLHARPAKLFAQAAKESGIPVTIAKDAGSPV
FT                   NAASILGIIALGLEYGDYVTLTADGDTAEATIDRLSELLTTDHDAA"
FT   regulatory      649053..649058
FT                   /gene="ptsI"
FT                   /locus_tag="MTES_0610"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        649069..650766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptsI"
FT                   /locus_tag="MTES_0610"
FT                   /product="phosphoenolpyruvate-protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0610"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73574"
FT                   /db_xref="GOA:E8NCC6"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR006318"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR024692"
FT                   /db_xref="InterPro:IPR036618"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:E8NCC6"
FT                   /protein_id="BAJ73574.1"
FT                   /translation="MTELRGVGIGLGVAQGPIARMAEPLPAPKDAKSERSVEDETARVR
FT                   EAIGAVARELEARGAQAGGAARDVLEAQAMIAEDPTLEAEVDSRLAAGKTGEFAVHDAF
FT                   ASFREQLVALGGYLGERAADLDDVAQRVIARLRGVAAPGIPDPGHPFVLVAKDLAPADT
FT                   ALLDLEKVLALVTTEGGPTSHTAILAREKSIVAVVGAAGAKDLVDGQSVIVDAAAGVVT
FT                   VDPTDDEKARALTRAASRAAAASAPITDGALADGTKVPLLANLGKPGGAAEAVELGAEG
FT                   VGLFRTEFLFLSSSSAPTVEEQRAAYIELLSAFPGKKVVVRVLDAGADKPLPFLNDAHE
FT                   ENPALGLRGLRALRASEDILREQLTALAEADAETRKSEAGPADLWVMAPMVSTVEETRY
FT                   FTDIAKDYGLKTTGVMVEVPSSALLADRILQIADFASIGTNDLTQYTLAADRLLGSVAS
FT                   FQDPWHPAVLRLIREVGAAGQAHGKPVGICGEAAADPLLAVVLVGLGATTLSMAPTALA
FT                   DVRATLLSHTLDDARRIAEAALSADDAASAREAAQAASSTREAVSPAS"
FT   regulatory      650855..650860
FT                   /locus_tag="MTES_0611"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        650869..652536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0611"
FT                   /product="phosphotransferase system, mannitol-specific IIBC
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0611"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73575"
FT                   /db_xref="GOA:E8NCC7"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR013014"
FT                   /db_xref="InterPro:IPR029503"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:E8NCC7"
FT                   /protein_id="BAJ73575.1"
FT                   /translation="MTTTSPAKKPGGARIAVQRFGTFLSGMIMPNIAAFIAWGFITMLF
FT                   IPAGFFGANSPFGPAWHWSPVADIIGGGGDAAAIGWPGAMTALTEGDNGTYQGYVGLVS
FT                   VMITYLLPLLIANTGGRIVYGARGGVVGTIAVMGVIVGTNIPMFLGAMIMGPLAAWITK
FT                   QMDKLWDGKIRPGFEMLVNNFSAGILGMILAIVGFFAFGPVFLGVSAFLGGIVGFLVQF
FT                   NLLPVLSIIVEPAKVLFLNNAINHGVFTPLGIEQAAESGKSILFLIEANPGPGLGLLLA
FT                   FTFFGIGAAKASAPGAIIIQFFGGIHEIYFPYALAKPMTILALIAGGASGVAVNMIFGG
FT                   GLAFPAAPGSIIAVTAAAAGGGVANVLVVYLSVIVAAVVTFLVAGIILRASRKRDQEAE
FT                   SDSFAAAIDQTAANKGKESATLGALRTRAAGTTGSGTTDAAESDIDGALGGLEGGVATK
FT                   QLNTIVFACDAGMGSSAMGASVLRNKIKKAGIEGVTVTNQAIANLDGSADLIITQNQLT
FT                   DRAKAQSPDALHVSVDNFMNSPKYDEVVEMVRTQHEAK"
FT   regulatory      652626..652631
FT                   /gene="mtlD"
FT                   /locus_tag="MTES_0612"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        652640..653077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtlD"
FT                   /locus_tag="MTES_0612"
FT                   /product="mannitol/fructose-specific phosphotransferase
FT                   system, IIA domain"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0612"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73576"
FT                   /db_xref="GOA:E8NCC8"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:E8NCC8"
FT                   /protein_id="BAJ73576.1"
FT                   /translation="MSNVLRIESVRIHPGSATREEAMKEAADLLQAAGSVTPDYFAAMQ
FT                   AREETVSTYMGNELAIPHGTNETKQAILASGLSVVRYDGGVDWGGEPVSFVVGIAGKGD
FT                   EHLEILSQIAILFSEEDDVARLKAASSPEELFEALSGSVNA"
FT   CDS_pept        653074..654225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtlD"
FT                   /locus_tag="MTES_0613"
FT                   /product="mannitol-1-phosphate/altronate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0613"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73577"
FT                   /db_xref="GOA:E8NCC9"
FT                   /db_xref="InterPro:IPR000669"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013118"
FT                   /db_xref="InterPro:IPR013131"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR023028"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E8NCC9"
FT                   /protein_id="BAJ73577.1"
FT                   /translation="MKAVHFGAGNIGRGFVGLLLHEGGYDLVFSDVSAALVEAINAASS
FT                   YTVHEVGEGGVDKEVTGFRAIDSSVDAEALVDEIATAEVVTTAVGPTILKFVAPHIVAG
FT                   LALRDPSLAPLQIMACENAIGATDQLREHVVELAGESWDALASRAVFANTAVDRIVPAQ
FT                   SGGGVDVTVEPFYEWAIERAPFGDTPPHIPGAHFVDDLEPYIERKLFTVNTGHATTAYF
FT                   GAQAGIERISDALADPAIAAKVEATLEETSALLVEKHELDADVQGEYRATILRRFRNPA
FT                   LPDTVGRVGRQPLRKLSRHERFVGPAAEAIERGLPVDALVAAMAAALEFQDAEDAQAVD
FT                   LQRMLRELDAEAFTAEVTGLDAEHPLFGRIVEIVAARQAALTA"
FT   regulatory      654482..654487
FT                   /locus_tag="MTES_0614"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        654497..655273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0614"
FT                   /product="predicted hydrolase or acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0614"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73578"
FT                   /db_xref="GOA:E8NCD0"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR029059"
FT                   /db_xref="UniProtKB/TrEMBL:E8NCD0"
FT                   /protein_id="BAJ73578.1"
FT                   /translation="MTDSTPSAAPAPAPRRRRRWVRWTLGGLGALVVLLVGGILIYSQV
FT                   GVMGAEPAPLAAAEANPGLTITDDGAGIVLSPTAGATGQGLVFIPGAKVQAEGYIATFA
FT                   DTVVDDGVTVVITKPWLNLAFFDPRPLSTFTDLAPDVSAWAVGGHSLGGVRACQLATDA
FT                   DALVLFASYCANDLSASGLPVLSLSGSEDGLSTPQKIADAKAQLPANATFVEIPGASHA
FT                   SFGAYGPQPGDGTPTADPTDVDRVIAEELAGFLPRP"
FT   regulatory      655493..655498
FT                   /locus_tag="MTES_0615"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        655504..656349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0615"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0615"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73579"
FT                   /db_xref="UniProtKB/TrEMBL:E8NCD1"
FT                   /protein_id="BAJ73579.1"
FT                   /translation="MASLALPDDDLDVVWTTRRLHAAGWSRRSLARAVADGTLVRVRQG
FT                   RFVAAGANGDIVAAARVGGRLDCISLLALRGVFVHQRPDLHVQQDPLASRRPPAPPGVV
FT                   YHWRASSASKSRLGVDVVEALAQAIRCQPPRSAVATLDSAWHLGLVDEADIDEVFTRVP
FT                   RRFQVLRRLLDPRAEAGTESIVRLVLRQLGCRIDLQVRIDGVGRVDLLVDGWLIVECDS
FT                   EKFHSTWHVHKKDRRRDMAALERGYATLRLLAEDILYHPDRVRAALERILKHGAPGRNS
FT                   "
FT   CDS_pept        complement(656709..657839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="add"
FT                   /locus_tag="MTES_0616"
FT                   /product="adenosine deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0616"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73580"
FT                   /db_xref="GOA:E8NCD2"
FT                   /db_xref="InterPro:IPR001365"
FT                   /db_xref="InterPro:IPR006330"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:E8NCD2"
FT                   /protein_id="BAJ73580.1"
FT                   /translation="MASGKKDTVASEDFRIGRTKIADLPKVSLHDHLDGGLRPQTVLEL
FT                   ADEIGLDLPADDAKGLEAWFSDHIDGGSLEDYLEKFSVTVGVMQTRDALVRTAKEFVED
FT                   LAADGVVYGEVRWAPEQHLTRGLSLDDVVDAVQEGIEQGEDAADARGHDIRVGQLLTAL
FT                   RHNDTARDIAELAVSWRGRGVVGFDIAGPEDGFLPSRHREAFDYLAEQFFPTTVHAGEG
FT                   AGLASIRSALIDGRALRLGHGVRIANDLDVVSREGEEVQVTFGDLARWVRDREITLELS
FT                   PTSNLQSGAVTAWGDTMDAHPFDLLYQLDFSVTVNVDNRLMSATTLTRELGLLAQAFEY
FT                   DLDDLEAFQLNAAAGAFLPVEEREELIEIISEGFGR"
FT   CDS_pept        complement(657839..659173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="deoA"
FT                   /locus_tag="MTES_0617"
FT                   /product="thymidine phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0617"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73581"
FT                   /db_xref="GOA:E8NCD3"
FT                   /db_xref="InterPro:IPR000053"
FT                   /db_xref="InterPro:IPR000312"
FT                   /db_xref="InterPro:IPR013102"
FT                   /db_xref="InterPro:IPR017459"
FT                   /db_xref="InterPro:IPR017872"
FT                   /db_xref="InterPro:IPR018090"
FT                   /db_xref="InterPro:IPR035902"
FT                   /db_xref="InterPro:IPR036320"
FT                   /db_xref="InterPro:IPR036566"
FT                   /db_xref="UniProtKB/TrEMBL:E8NCD3"
FT                   /protein_id="BAJ73581.1"
FT                   /translation="MTLRQAQGPHRQAQGPVPEAYDAVDIIRAQRDGRAITEGEIRWLV
FT                   DAYTRGYVMDAQMSAFTMAVLLNGLGRDQIRVLTDAMIASGERMDFSSLGKVTVDKHST
FT                   GGVGDKITLPLAPLVAAFGVAVPQLSGRGLGHTGGTLDKLESIPGWRAALSNDEIMAQL
FT                   RDVGAVICAAGTGLAPADKKLYALRDVTGTVEAIPLIASSIMSKKIAEGTDSLVLDVKF
FT                   GSGAFMQDIDRARELAETMVALGTDSGVNTTALLTDMNTPLGLAIGNANEVRESVEVLA
FT                   GGGPADVVELTVALAREMLTLAGQPDADVEAALTDGRAMDVWKRMIRAQDGDPDAALPT
FT                   PRETHTVVAERSGVVTRVEALPFGIGAWRLGAGRARAEDAVVHAAGIDLHVTVGQSVTA
FT                   GQPLFTLSADEESRFERALGAVEGALEIGDTAPAASPLVRERITA"
FT   regulatory      complement(657850..657855)
FT                   /gene="add"
FT                   /locus_tag="MTES_0616"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(659170..659571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0618"
FT                   /product="cytidine deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0618"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73582"
FT                   /db_xref="GOA:E8NCD4"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR006262"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:E8NCD4"
FT                   /protein_id="BAJ73582.1"
FT                   /translation="MTDIDWDELRSAATDAMHRAYAPYSRFKVGAAALVADGRIVSGCN
FT                   VENASYGVTLCAECGLVSDLHMSGGGQLVAFVCVDGEGRTLMPCGRCRQLLFEHAIPGM
FT                   LLETVSGIRTIDEVLPDAFGPRDLEEAAR"
FT   regulatory      complement(659181..659186)
FT                   /gene="deoA"
FT                   /locus_tag="MTES_0617"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(659584..659589)
FT                   /locus_tag="MTES_0618"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(659615..660913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0619"
FT                   /product="uncharacterized ABC-type transport system,
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0619"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73583"
FT                   /db_xref="GOA:E8NCD5"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:E8NCD5"
FT                   /protein_id="BAJ73583.1"
FT                   /translation="MSTTAAHREAASSPAALDTTVVISWKAPIVYAVITVLAAVLFVVA
FT                   RQDGDAVFRISSPGEFIQLPEVVLGGVVTGIVCTVLMVLITVAAVLLVRARRRPPIWLA
FT                   VIFALVFMVGFLTWAAAGATTAVIPLTGLLAGGLSLSVPLIFGAMAGVISERVGVVNIA
FT                   IEGQLLAGAFTSAVVATATGNPFVGLLAAAVSGVLVSFVLAAFAIKYLVDQVIVGVVLN
FT                   VLVVGLTSFLFSQLLSPNAATLNSPPRFPRLPIPVLADIPIIGPMLFNQTIIVYLMYIT
FT                   VVLVYVGLFHTRWGLRLRAVGEHPQAADTVGINIAKTRFWNVSLGGAIAGLGGAFFTLG
FT                   SVGAFNKEMTAGAGYIALAAVIFGHWDPIRATLAALLFGFASNLQNTLGVIGSPVPSEF
FT                   MLMLPYVVTIFAVAGLVGKVRGPAAAGKPYIKG"
FT   CDS_pept        complement(660910..662262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0620"
FT                   /product="ABC-type uncharacterized transport system,
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0620"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73584"
FT                   /db_xref="GOA:E8NCD6"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:E8NCD6"
FT                   /protein_id="BAJ73584.1"
FT                   /translation="MSDPHSPQDPSVSRADVAAAAQADVALEGNAVVDSGVGARVVVPT
FT                   PAPDEGRWQRALREIATGNAIISVLAVILALLVGAIMIAATDENVQAAAGYFFARPLDT
FT                   LSAIWQSVSGAYSSFFQGAIYNFRRPEFANGIKPLTDTLTFATPLIVAGLGVALAFRVG
FT                   MFNIGGRGQMLVAAAASGWVAFAFDLPWGIHLLVALVAGVAAGAVWSGIAGVLKARTGA
FT                   HEVIVTIMLNYVAFYLVYYMLRTPGLLQAPGSSNPTTPPMKETAVLPDLLGPGYNLHFG
FT                   FILSILAVVLVWWILERSSLGFRFRAVGLNPNAARVAGINVKSMYVYAMLISGALIGLA
FT                   GVDQVLGTVTTGFSSGIDAGIGFDAITVALLGRSTPVGVLVAGILFGAFKAGGFSMQAA
FT                   NGVPIDIVVVVQSLIVLFIAAPPLVRAIFRLPAPGVRQPKARTLKKKEAAK"
FT   regulatory      complement(660922..660927)
FT                   /locus_tag="MTES_0619"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(662259..663779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0621"
FT                   /product="ABC-type uncharacterized transport systems,
FT                   ATPase components"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0621"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73585"
FT                   /db_xref="GOA:E8NCD7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E8NCD7"
FT                   /protein_id="BAJ73585.1"
FT                   /translation="MKLELRGITKTFGSLVANDHIDLTVEAGEIHCLLGENGAGKSTLM
FT                   NVLYGLYQADGGEILLDDAVQHFSGPGDAMRAGIGMVHQHFMLIPVFTVAENVMLGHEP
FT                   TRFGGRLDLASARARVREISDRFGFDVDPDALVDDLPVGVQQRVEIIKALSRDAKVLVF
FT                   DEPTAVLTPQETDELMAIMRQLKEAGTSIVFITHKLREVREVADRITVIRLGKVVGEAD
FT                   PRASNAELASLMVGRAVELTVQKEAPTLGEVGLSVSGLTVSDAIGQLVVNDVSFEVRRG
FT                   EVLAIAGVQGNGQTELTEALLGLQDRVQGSIVLDGTELNGATVRGVLDAGVGFVPEDRK
FT                   EDGLVGEFSIAENLMLDRADGAPFVKGGAIQLSTLADFAREKVAEFDVRTPSIETAVGK
FT                   LSGGNQQKVVLARELSRDLRLFVAAQPTRGVDVGSIEFIHKRVIETRDAGVPVIVVSTE
FT                   LDEVTALADRIMVMYRGRVVGIVPGNTSRDVLGLMMAGEAPQNEGVAA"
FT   regulatory      complement(662270..662275)
FT                   /locus_tag="MTES_0620"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(663788..663793)
FT                   /locus_tag="MTES_0621"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(663960..665060)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0622"
FT                   /product="uncharacterized ABC-type transport system,
FT                   periplasmic component/surface lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0622"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73586"
FT                   /db_xref="GOA:E8NCD8"
FT                   /db_xref="InterPro:IPR003760"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E8NCD8"
FT                   /protein_id="BAJ73586.1"
FT                   /translation="MKTTKKAVFSGLAMIGTAVLLAGCGAAPESNGSSAAAGASDYLPC
FT                   MVSDSGGFDDKSFNQLGKEGLDEAATQLGSKKPIEVQSQSETDFASNLSSLVDQGCNTI
FT                   ITVGFLLAPAALESAKANPDLQYVSIDDMVDQDFDGKTDAPNIKPIIFDTAQAAYLAGY
FT                   LAAGTTKTGVVGTFGGMNIPTVTIFMDGFAQGVEKYNADNGASVRVVGWDRAAKDGSFT
FT                   GGFEANDTARQTAQAIIDQNVDVLLPVGGPIYQSAAVAIQDAGRDIALVGVDADVYETD
FT                   PAIGDLLLTSILKGIDVGTKDAIVAAGEGSFDTTPFVGTLANDGVGLAPYHKWEDRVPA
FT                   ELTTKIDALKADIVSGKITVESYLAG"
FT   regulatory      complement(665069..665074)
FT                   /locus_tag="MTES_0622"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(665258..666373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="manC"
FT                   /locus_tag="MTES_0623"
FT                   /product="mannose-1-phosphate guanylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0623"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73587"
FT                   /db_xref="GOA:E8NCD9"
FT                   /db_xref="InterPro:IPR001538"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E8NCD9"
FT                   /protein_id="BAJ73587.1"
FT                   /translation="MADPAIDDFYAVIPAGGIGSRLWPLSRADAPKFLHDLTGSGQTLL
FT                   RDTWDRLAPLSGEGRIAVVTGRAHRAAVERELPGVPDHNVFLESEPRDSSAAIGLAAAI
FT                   LVRREPDVIIGSFAADHVIRQTRQFEFAVRQAVAVAREGYICTIGIQPSEPSVGFGYIK
FT                   QAGELIVDGAPEAYMVERFVEKPDLETAKQYFEDRAYLWNAGMFITRADVLLAELAVNE
FT                   PELHAALLELADAWDDRDRRGPAVDRLWPSLKKIAIDYSVAEPAAEKGRLAVIPGHFDW
FT                   DDVGDFASLSKLNSHGRNELAILGEGARVLADASSGIVVTQTKRVISLIGVRDIVVVDT
FT                   PDALLVTTAENAQRVKGVVDALKLTGRGDVL"
FT   regulatory      complement(666381..666386)
FT                   /gene="manC"
FT                   /locus_tag="MTES_0623"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      666584..666589
FT                   /locus_tag="MTES_0624"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        666597..667031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0624"
FT                   /product="succinate dehydrogenase/fumarate reductase,
FT                   cytochrome b subunit"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0624"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73588"
FT                   /db_xref="GOA:E8NCE0"
FT                   /db_xref="InterPro:IPR000701"
FT                   /db_xref="InterPro:IPR014314"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="InterPro:IPR039023"
FT                   /db_xref="UniProtKB/TrEMBL:E8NCE0"
FT                   /protein_id="BAJ73588.1"
FT                   /translation="MSAPARATPSVKETTSKRPRGTLYRGREGMWSWVLHRITGVAIFF
FT                   FLLVHILDTALIRVSPEAYDAVIGTYKNPIMGLGEVALVGAIAYHAFNGLRIILVDFWP
FT                   WATRHQRQLWWGVLGLWVVTMLGFTPRHLINVFSAVTGSH"
FT   regulatory      667021..667026
FT                   /gene="sdhD"
FT                   /locus_tag="MTES_0625"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        667031..667489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhD"
FT                   /locus_tag="MTES_0625"
FT                   /product="succinate dehydrogenase, hydrophobic anchor
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0625"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73589"
FT                   /db_xref="GOA:E8NCE1"
FT                   /db_xref="InterPro:IPR000701"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:E8NCE1"
FT                   /protein_id="BAJ73589.1"
FT                   /translation="MSVAQEASTIPAPRTPSVRKKGSNLEKWGWIYMRASGVLLLVLIF
FT                   GHLFVNLMLGDGIHQIDFAFVAGKLASPFWQWWDVLMLWLALIHGANGMRTIVNDYVTN
FT                   AAVRKVLVWSLWLSAGLLILLGTLVVFTFDPCLGVTESSTLWDACQAA"
FT   regulatory      667522..667527
FT                   /gene="sdhA"
FT                   /locus_tag="MTES_0626"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        667536..669365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhA"
FT                   /locus_tag="MTES_0626"
FT                   /product="succinate dehydrogenase/fumarate reductase,
FT                   flavoprotein subunit"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0626"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73590"
FT                   /db_xref="GOA:E8NCE2"
FT                   /db_xref="InterPro:IPR003952"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR011281"
FT                   /db_xref="InterPro:IPR014006"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:E8NCE2"
FT                   /protein_id="BAJ73590.1"
FT                   /translation="MSTQTSSDSVVKDGVHYHQFDVVIVGAGGAGMRAAIEAGPGAKTA
FT                   VISKLYPTRSHTGAAQGGMAAALANVEEDSWEWHTFDTIKGGDYLVDQDAAEILAKEAI
FT                   DAVIDLENMGLPFNRTPEGKIDQRRFGGHTADHGKTPVRRACYAADRTGHMILQTLFQN
FT                   CVKLGINFFNEFYVLDLVTVKDAAGKTQVAGVVAYDLATGELHVFQSKAVIFATGGFGK
FT                   IFKTTSNAHTLTGDGVGIVWRKGLPLEDMEFFQFHPTGLAGLGILLTEGARGEGAILRN
FT                   ASGERFMERYAPTIKDLAPRDIVARCMVQEVAEGRGAGPHRDYVLLDCTHLGAEVLETK
FT                   LPDITEFARTYLGVDPVVEPVPVMPTAHYAMGGIPTNIKAEVLADNDTVVPGLYAAGEC
FT                   ACVSVHGSNRLGTNSLLDINVFGKRAGRNAVEYVKTADFVPLPEDPAAEVRGLIEGLRN
FT                   NSGTERIAVLRKTLQDEMDKGAQVFRTHESLAHVMDVIADLRERYKNIHVDDKGKRFNT
FT                   DLLEAVELGFLLDLAEVVVYSAQNREESRGGHMRDDFPTRDDENYMQHTMAYLSGDPHS
FT                   SHPADHIELGWKPVVFTKNEAGELRYPPLERKY"
FT   regulatory      669352..669357
FT                   /gene="sdhB"
FT                   /locus_tag="MTES_0627"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        669367..670152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhB"
FT                   /locus_tag="MTES_0627"
FT                   /product="succinate dehydrogenase/fumarate reductase, Fe-S
FT                   protein subunit"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0627"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73591"
FT                   /db_xref="GOA:E8NCE3"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:E8NCE3"
FT                   /protein_id="BAJ73591.1"
FT                   /translation="MASTVLDTTDVSDEVEQTPEDTGIQSFLVTFNIRRFDPEVDDEPR
FT                   WVDYDVELYSTDRVLDALHKIKWETDGSLSFRRSCAHGICGSDAMRINGRNRLACKTLI
FT                   KDLDISQPIYVEAIKGLPLEKDLIVDMEPFFASYREVQPFLISNSKPEPGKERVQSIVD
FT                   REVFDDTTKCILCAACTSSCPVFWTDGQYFGPAAIVNAHRFIFDSRDDAGDVRLDILND
FT                   KEGVWRCRTTFNCTEACPRGIEVTKAIAEVKQAVLRGGR"
FT   regulatory      670245..670250
FT                   /locus_tag="MTES_0628"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        670259..671458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0628"
FT                   /product="predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0628"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73592"
FT                   /db_xref="GOA:E8NCE4"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="UniProtKB/TrEMBL:E8NCE4"
FT                   /protein_id="BAJ73592.1"
FT                   /translation="MTESRRDPRPLPAAGEDERTLRERFDAAQTAVRERLDEPLARAAK
FT                   VVQWFPIRVWRHFLQHNGFLLAAGMSYQGLFAVFSALYLSFAAVGIWLGGSKAAIDGLI
FT                   GIINSYIPGLISKNGLVQPDKVEAVAQESGKLLGITGAIAAIVVIWTAIGFVTFTRRAV
FT                   RDTFGLPFDMRNYVLLKARDFVASLLFGLALLVGALLGSITTGAVDLVFGILGWDRETP
FT                   GWTIGARAVSALVAFGVNTVALASLFRFLTGTTLTWRRAWPGALVGAGGMVVLQIGAGF
FT                   LLVYTPTNPLLGTFAALIGFLLWFRFIGIVILVSAAWIAVAAGDRDLPLRSPEDRLAME
FT                   QAALVIAAQVGVREAEKAAADARWPWRWRARRRVAAARKNLDRAKAALPAPRRTTLLPD
FT                   "
FT   regulatory      671482..671487
FT                   /locus_tag="MTES_0629"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        671496..672344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0629"
FT                   /product="exonuclease III"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0629"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73593"
FT                   /db_xref="GOA:E8NCE5"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:E8NCE5"
FT                   /protein_id="BAJ73593.1"
FT                   /translation="MARSVRIVSINVNGIRAAVRKGMVEWLEASGADIVTLQEVRATAE
FT                   QLAEALPGWRIVNDEALQKGRAGVAIISRLPGVETRTHLGPEPLDASGRWIETDFDIDG
FT                   ETVTIVSAYVHSGEVDTPKQDAKWLFLDAMEQRLATLKAERELALVTGDLNVGHRELDI
FT                   KNWRGNRKNAGFLPRERAYFDRFFGPAGEQVEGVDGSVGTGLGWVDVGRRRMGEVEGPY
FT                   TFWSMRGKAFDTDSGWRIDYHVATPALAERVTDYRVDRAPSYDTRWSDHSPVIVDYTLG
FT                   R"
FT   regulatory      672543..672548
FT                   /gene="trpS"
FT                   /locus_tag="MTES_0630"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        672555..673559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpS"
FT                   /locus_tag="MTES_0630"
FT                   /product="tryptophanyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0630"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73594"
FT                   /db_xref="GOA:E8NCE6"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024109"
FT                   /db_xref="UniProtKB/TrEMBL:E8NCE6"
FT                   /protein_id="BAJ73594.1"
FT                   /translation="MTQQRLYSGMQPSADSLQIGNYIGALLQWRQLQDEYDAFFSVVDL
FT                   HALTQPGDPAERREKTRRTAAQYIAAGIEPSRSTLYVQSHVPAHAELQWVLSTLTGFGE
FT                   AGRMTQFKDKSARYGTDATNVGLFTYPVLMAADILLYQTDVVPVGDDQKQHIELTRDLA
FT                   ERFNQRFGETFTMPKPMIQRETARIYDLQNPTSKMSKSAESDAGVLWMLDEPKVSAKKI
FT                   MRAVTDSEGSVRFDRDEKPGVSNLLVIYSALTGREITAIEDEYAGRGYGDFKKGLAEVV
FT                   VNEFEPVRERALELIADPAELDRVLATNAERAASVAEKTLSDVYDRIGLLRRG"
FT   regulatory      673612..673617
FT                   /gene="mutM2"
FT                   /locus_tag="MTES_0631"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        673623..674486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutM2"
FT                   /locus_tag="MTES_0631"
FT                   /product="formamidopyrimidine-DNA glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0631"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73595"
FT                   /db_xref="GOA:E8NCE7"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/TrEMBL:E8NCE7"
FT                   /protein_id="BAJ73595.1"
FT                   /translation="MPEMPEVEGLVEFLRGRVTGLQVSKATVSAINALKTYDPPLTALV
FT                   GSAVTAVDRHGKFVDVSTDAGVHLIFHLAKAGWLRWYDALPSTIIKPGKTPIALRVGFD
FT                   DGSGFDLTEAGTKKSLAVYAVRSPDEVPGIARLGPDPLSEGFDRATFGALLTGRRTQIK
FT                   GVLRDQSIIAGVGNAYSDEILHAAKMSPYALAATLTDDEVDRLFRAMVETLTEAIDEAR
FT                   GKPPAELKDAKRRGMRVHGRRGEACPVCGDEVRSVYFADNSLEYCPTCQTGGKLLADRR
FT                   LSRLLK"
FT   regulatory      674787..674792
FT                   /gene="ribD"
FT                   /locus_tag="MTES_0632"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        674799..675830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribD"
FT                   /locus_tag="MTES_0632"
FT                   /product="pyrimidine reductase, riboflavin biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0632"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73596"
FT                   /db_xref="GOA:E8NCE8"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR004794"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:E8NCE8"
FT                   /protein_id="BAJ73596.1"
FT                   /translation="MASAVEIDAMRRALQLARRGPRGLNPQVGAVILSPAGEILAEGYH
FT                   RGAGTAHAEVDALSQLAPGAARGATAVVTLEPCNHTGRTGPCAVALIEAGVARVVFALD
FT                   DPTDAASGGAERLRAAGVDVEQGPEEESAEALVHDWVALTRTGRPHVVVKWAQSLDGRA
FT                   AADDGTSQWITGPAARRDVHARRATADAIVAGTGTVRADDPALTARDEDGSLLPAQPLP
FT                   VIIGESETAPDAAVRRHPREPLFFATHDLSAVLADLGERGIQRVFVEGGPTLASAFVRA
FT                   DLADELLVYVAPVLIGGSRLALGDVGVPTIADARRLAVASVQNLGDDLLIVAHPTTRTR
FT                   GEH"
FT   regulatory      675818..675823
FT                   /locus_tag="MTES_0633"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        675830..676486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0633"
FT                   /product="riboflavin synthase alpha chain"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0633"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73597"
FT                   /db_xref="InterPro:IPR001783"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR026017"
FT                   /db_xref="UniProtKB/TrEMBL:E8NCE9"
FT                   /protein_id="BAJ73597.1"
FT                   /translation="MFTGIVEEMGAITAVEPSGDGVRVTVRAPLSVSDAGHGDSISVSG
FT                   VCLTVVDQGEDWFTADVMKQTLDMSTLADVAPGRAVNLERATAAHGRLGGHIVQGHIDG
FT                   TGVVREVRPGAQWSVVRIGIPNHLAPLVVDKGSIAIDGVSLTVSAVSDPAETEQWLEVS
FT                   LIPETLAATTLGGAEAGTPVNLETDILARHVQRMLAFRVSENPAADAASTERGSE"
FT   regulatory      676469..676474
FT                   /gene="ribA"
FT                   /locus_tag="MTES_0634"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        676483..677751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribA"
FT                   /locus_tag="MTES_0634"
FT                   /product="3,4-dihydroxy-2-butanone 4-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0634"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73598"
FT                   /db_xref="GOA:E8NCF0"
FT                   /db_xref="InterPro:IPR000422"
FT                   /db_xref="InterPro:IPR000926"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR032677"
FT                   /db_xref="InterPro:IPR036144"
FT                   /db_xref="UniProtKB/TrEMBL:E8NCF0"
FT                   /protein_id="BAJ73598.1"
FT                   /translation="MSLSPIPEALEALRAGRPILVADDENRENEGDVILSAQLATPEAL
FT                   AWTVRWSSGYVCAPMPAEWADRLDLPPMVAVNEDARGTAYTVSVDAASGVTTGISAADR
FT                   ARTLNVLADPESVPTSVIRPGHILPLRAVDGGVRERAGHTEAAVDLMKLAGLEPVAAIA
FT                   EVVAEDGSMMRLPGLFELGERDGIPVITIEQLIEYLNETDPLPASAPARRRVSLRAESN
FT                   VPTTHGTFRFLAYKDRVTGTDHIAVVSGELGTTAPLVRVHSECLTGEAFGSLKCECGPQ
FT                   LEAALDRIDKDGGIVIYMRGHEGRGIGLINKLRAYNLQERGLDTVDANLALGLPADARD
FT                   YAAAAGILADLGVEQVRLLTNNTDKVKQLRGFGLDVVEQVPLLVGVGPNNHQYLETKRD
FT                   RMGHIIAEDDLRDALAHMKEESA"
FT   regulatory      677734..677739
FT                   /gene="ribH"
FT                   /locus_tag="MTES_0635"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        677751..678224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribH"
FT                   /locus_tag="MTES_0635"
FT                   /product="riboflavin synthase beta-chain"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0635"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73599"
FT                   /db_xref="GOA:E8NCF1"
FT                   /db_xref="InterPro:IPR002180"
FT                   /db_xref="InterPro:IPR034964"
FT                   /db_xref="InterPro:IPR036467"
FT                   /db_xref="UniProtKB/TrEMBL:E8NCF1"
FT                   /protein_id="BAJ73599.1"
FT                   /translation="MAGSGAPETGGVDASGLNIVVIAGTWHEVITDGLIAGAKRVLDAT
FT                   GAAYRVVRVPGSFELPVAARAAFEGGADAVVALGVIIRGGTPHFEFVSSAATDGLTRVA
FT                   LDAGKPVGFGVLTLDDEQQGLDRAGLEGSKEDKGEEAADAAIRTALVLRELRG"
FT   CDS_pept        678367..678720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0636"
FT                   /product="uncharacterized Fe-S protein PflX, homolog of
FT                   pyruvate formate lyase activating proteins"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0636"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73600"
FT                   /db_xref="GOA:E8NCF2"
FT                   /db_xref="UniProtKB/TrEMBL:E8NCF2"
FT                   /protein_id="BAJ73600.1"
FT                   /translation="MEILRHAVVLVHLVGFAILFGAWVVEAVGRRVRVTPLMNYALVIS
FT                   LVSGLALAAPWGLDHDLNYTKIGVKLVVLLGIGALLGIGSARQKRGADLAPAVFWLVGI
FT                   LTLLNAALAVLWR"
FT   regulatory      678879..678884
FT                   /locus_tag="MTES_0637"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        678890..680341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0637"
FT                   /product="permease of the major facilitator superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0637"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73601"
FT                   /db_xref="GOA:E8NCF3"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E8NCF3"
FT                   /protein_id="BAJ73601.1"
FT                   /translation="MTSSSPTAPSASAPANPRSRVITASLIGTTIEFYDFYAYATAAVL
FT                   VFPILFFPTGNDTTSLLLSFSVFGAAMVARPLGAIVFGHFGDRFGRKATLVASLLTMGV
FT                   ATFLIGLLPTFNEIGVWAAILLLVMRLAQGFALGGEWSGAALVATENAPKGKRALFGTF
FT                   PQLGAPIGFIIANGVFLIINFALPHPDGTAQRSAEFLAWGWRVPFLFSAVMVIIGLWVR
FT                   LKLVESESFSKAEKTGVIKKFPLGEAIRRNGKQLILGTFIMLATYVLFYLMTSFTLSYG
FT                   TKPPLAAAQAAAEKAGTPFDAAAYVPGLGYSYTDFVIMQIIGVVFFGVFTMLSGPVADR
FT                   LGRKRLLLGVTVAIILFGLTFSFFLMPNADPGFTRILVQAFLIIGFVLMGTTFGPMGAV
FT                   LPELFPTNVRYTGSAISYNVSSILGAALAPIVAVALWAAGDGNPWLVGVYLSAMGVLTL
FT                   IAVVLSPETKDVDYDENIAAGATAP"
FT   regulatory      680566..680571
FT                   /locus_tag="MTES_0638"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        680578..682443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0638"
FT                   /product="ABC-type multidrug transport system, ATPase and
FT                   permease components"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0638"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73602"
FT                   /db_xref="GOA:E8NCF4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:E8NCF4"
FT                   /protein_id="BAJ73602.1"
FT                   /translation="MSSPAPARGRRGRRTPEGPRASFRQLLPFLLEHKRTLVVVAVLSV
FT                   LGAAATLAQPLLVGQVIARVQNSVPLGALVWLLVAFVVLSSVISGFQHYLLQRTGTAVV
FT                   YSSRKRLIARILRLPVSEFDARRTGDLVSRVGTDTTLLYAVLTQGFADAVGNALILVGA
FT                   VIAMAFIDPLLLGLIIVVVGASLAVVVLLSTRIRSASADQQAKVGELSSGVERAVGSIR
FT                   TIRAAGATERETAAVTQTATAAYDAGVRIARVSALIVPIAFVALQVSLLVVLGVGGYRV
FT                   ASGAIDVASLVTFVIFLFLLVQPLASAIGAITSVNQALGALGRIQEVLDLPLESDDDQP
FT                   RAAAPIPDAAALEFRDVRFRYPDHVVKAREAAAREARSVLADVHLEAAEVPAETDREVL
FT                   RGVSFAVPRGARVALVGPSGAGKSTILSLIERFYDPTEGQILLDGVDARDLPRDELRSR
FT                   FGYVEQDAPTLAGTIAENLRLASPSASDADCERVLREVNLGDVLERSPLGVDAPVGEDG
FT                   VMLSGGERQRLAIARALLAAPPVLLLDESTSSLDGVNEQRMREAIDAVATDRTLLVIAH
FT                   RLSTVVDSDLIVVLENGRVVGQGTHSELVASTPLYRDLAKHQLLV"
FT   CDS_pept        complement(682547..684430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pckG"
FT                   /locus_tag="MTES_0639"
FT                   /product="phosphoenolpyruvate carboxykinase (GTP)"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0639"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73603"
FT                   /db_xref="GOA:E8NCF5"
FT                   /db_xref="InterPro:IPR008209"
FT                   /db_xref="InterPro:IPR008210"
FT                   /db_xref="InterPro:IPR013035"
FT                   /db_xref="InterPro:IPR018091"
FT                   /db_xref="InterPro:IPR035077"
FT                   /db_xref="InterPro:IPR035078"
FT                   /db_xref="UniProtKB/TrEMBL:E8NCF5"
FT                   /protein_id="BAJ73603.1"
FT                   /translation="MALADIFARPAGRPAATTAVARPGYGARPEVDGPGMPGLLAWVDQ
FT                   VAALAQPDRIHWVDGSAAENDALLREMVDEGKLIKLNPEWRPGSYLARSHPGDVARLES
FT                   RTYIASESEEDAGPTNNWIAPAEIRETLNGVFEGSMRGRTMYVVPFSMGAVGGPLSHIG
FT                   VQITDSAYAVASIGVMTRVGTAVTEQIAAGAPWVKTVHSVGAPLAPGQADVAWPCNDEK
FT                   YIVHFPDTLEVWSYGSGYGGNAILAKKCFALRIASVIGRDEGWLAEHMLLIRVIDPKGK
FT                   AYHVAAAFPSACGKTNLAMLRPTIPGWRVETLGDDITWIRPGEDGRMWAINPEAGFFGV
FT                   APGTGESTNVTAIETLWGNTIFTNVALRPDGDVWWEGLTDEAPPHLTDWEGNAWTPASG
FT                   RPAAHPNSRFTVGAAQCPQIAEDWEAPEGVPLDVILFGGRRATNVPLVVEATDWSHGVF
FT                   LGSTVSSEKTAAQEGTVGELRRDPFAMLPFCGYNMGDYFGHWLKVGQKLRFDRAPRIFQ
FT                   VNWFRKGDDGRFLWPGFGDNARVIDWIIRRVDGQVEAVDSPIGRLPRVEDLDLSGLDLP
FT                   AADLEELFAIDRDSWLAEADLTEEFFDTFGSHLPAALRAELAALRYRLQRA"
FT   regulatory      complement(684436..684441)
FT                   /gene="pckG"
FT                   /locus_tag="MTES_0639"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      684533..684538
FT                   /gene="hipB"
FT                   /locus_tag="MTES_0640"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        684547..685986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hipB"
FT                   /locus_tag="MTES_0640"
FT                   /product="predicted transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0640"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73604"
FT                   /db_xref="GOA:E8NCF6"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:E8NCF6"
FT                   /protein_id="BAJ73604.1"
FT                   /translation="MASSLELTTLGHRIRHHRLARGLTLDELGALVGVAGSQLSLIENG
FT                   KREPKLSLLQEIARATETEVTELLSTEPPNRRAALEIELERAQSSPFFQQLGIPPVKVT
FT                   KGTTDETIEAVLGLHRELQRRERETIASPEEARRANTEMRLRMRAVDNHLPDIEKLAEK
FT                   QLKAAGHGTGALTHRTVSIMAEQLGFELIYVSDLPHSARSVTDLENGRIYLPPASIPGG
FT                   HGLRSMALQAMAHRLLGHRPPTDYADFLQQRLEINYYAACCLMPETSSVAFLAQAKKDR
FT                   NLAVEDFRDAFGVTHEAAAMRMTNLMTAHLGIRLHFLRVDGDGAISRVYENDGLPLPTD
FT                   VTGSVEGQIVCKKFSARSAFAEHNRTTEHYQYTDTPAGTFWCSTQTGTTSDGDFSITVG
FT                   VPFDDARWFRGRETSTRGVSRCPDESCCRRPESDAAARWQGKAWPSARVHRHMFSPLPR
FT                   GMFPGVDDAEVFAFLDRHADG"
FT   regulatory      686386..686391
FT                   /locus_tag="MTES_0641"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        686401..687537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0641"
FT                   /product="ABC-type nitrate/sulfonate/bicarbonate transport
FT                   systems, periplasmic components"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0641"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73605"
FT                   /db_xref="GOA:E8NCF7"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="InterPro:IPR027939"
FT                   /db_xref="UniProtKB/TrEMBL:E8NCF7"
FT                   /protein_id="BAJ73605.1"
FT                   /translation="MSHLRTVLSPAPSSPTPRGPSTRASRRRRRVATTAAGVLTLALVV
FT                   SGCASPASSSGSASSSSFGTASVALSWIKNYEFAGYYFAEDDGDYTDAGFDKVDLIAGG
FT                   GNTNSWDLVLGGQAQIGLASDLTGITGAINDGAGLKIIGAQFVKNPVGFVSLAKNPIRT
FT                   VADLKGKRIGVDAGGKLAVEAVLKANDLPADTVEFVSVPNGVDPLMNGEVDALIGFLTN
FT                   YPIAVKNAGGDVVTMSFADANYAQFGDAVVVSDKELAENREELKAIMKASIEGWNSALS
FT                   KGTDAIADIAMKHGGADNGLDRQLQVDSASVLPSFMLTPDTVKNGIFTLTPDLIDQAVS
FT                   SLAAAGITADPSMFDTSLLQEVYAENPDLIPGFTVPAS"
FT   regulatory      687578..687583
FT                   /locus_tag="MTES_0642"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        687593..688390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0642"
FT                   /product="ABC-type nitrate/sulfonate/bicarbonate transport
FT                   system, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0642"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73606"
FT                   /db_xref="GOA:E8NCF8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E8NCF8"
FT                   /protein_id="BAJ73606.1"
FT                   /translation="MIPTPVRGVLFGAAGLGVLLVAWHIVAVTVYQRANGSPGPVPPPL
FT                   PVFARALDGLFGGAYAEGLAATAGAAVTGYAVAVVIALGLGILVMIAPPLGPFASQLGV
FT                   VAACAPAAAIAPIVVLLSPSGSRAVSVVLALLAVEFPLVIGVLLGLRSAAPAQIDLVHA
FT                   YGGGAWTAIRKVRVISAIPALLAALKLAAPAAFLGAMTGEFFTVGVDEGAGRLLISQQY
FT                   VGDYTGMWAIALLATVVSALGYGAIALLGRVLAPWTAHTGSIR"
FT   regulatory      688377..688382
FT                   /locus_tag="MTES_0643"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        688387..689217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0643"
FT                   /product="ABC-type nitrate/sulfonate/bicarbonate transport
FT                   system, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0643"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73607"
FT                   /db_xref="GOA:E8NCF9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E8NCF9"
FT                   /protein_id="BAJ73607.1"
FT                   /translation="MIRLPAWVWTTLCTLGTAALLLVGWQLAITFSGLSPYLAKTPVDV
FT                   WRYLFVDGVGNPAEAAERRAALVPMIGVTLGHSAIGLLLGITAGFIGAVALTVSRALRS
FT                   IFLPLALLLQTVPLIAMAPVIYAVFGSGILTAAVVAAVVTFFPLLMNIGAGLSSSTPET
FT                   VDLVHAYGGGRWTLLRFVQLPASLPSLFAGLKLAAPATVSAATLYEFLFSFEGLGANLL
FT                   TSKSYSDYGLLWTLVVITVLLSLAAYGLVVLAETLLLAGRFPPRASTPAQKGLA"
FT   regulatory      689202..689207
FT                   /locus_tag="MTES_0644"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        689214..689972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0644"
FT                   /product="ABC-type nitrate/sulfonate/bicarbonate transport
FT                   system, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0644"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73608"
FT                   /db_xref="GOA:E8NCG0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E8NCG0"
FT                   /protein_id="BAJ73608.1"
FT                   /translation="MTASGVHIRALTRHFATRGGPVVAVDGVDLDTPRGSFLSLLGPSG
FT                   CGKSTVLRMLAGLDTPTSGSATVNDLTPAALRRTHAYGIAFQDHALLPWRTVERNIALP
FT                   FEIAGLPVDREWVRELLHLVRLEQFAKARPWQLSGGMRQRVAIARALALRPSALFLDDP
FT                   FGALDDVTRQRLNIELQRLWSEQQATTVMVTHGVQEAVFLSDQVAVMSPRPGRIKEVID
FT                   IDLPRPRTLEMTSTPEFHAYVDRATELLFH"
FT   regulatory      689980..689985
FT                   /locus_tag="MTES_0645"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        689994..690596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0645"
FT                   /product="GTP cyclohydrolase I"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0645"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73609"
FT                   /db_xref="GOA:E8NCG1"
FT                   /db_xref="InterPro:IPR001474"
FT                   /db_xref="InterPro:IPR020602"
FT                   /db_xref="UniProtKB/TrEMBL:E8NCG1"
FT                   /protein_id="BAJ73609.1"
FT                   /translation="MTELTAVAATHITPDLDAAEEGIRMYMRAIGLDTEHPTLIDTPRR
FT                   VAHAGLDLFSGMAGDPHRALGGGEPIEGVYPGPVAVHDIPYSSMCEHHLLPFQGTVSVA
FT                   YLPDRALAGIGDFDAMLRVLAARPQMQERLADQIAEVVSDTLGAKGVLVRLTAQHACMW
FT                   ARGERTVGSTAFSLASRGIYDTDAAARAEARVLLGLH"
FT   regulatory      690583..690588
FT                   /locus_tag="MTES_0646"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        690598..691392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0646"
FT                   /product="uncharacterized protein, putative amidase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0646"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73610"
FT                   /db_xref="InterPro:IPR003785"
FT                   /db_xref="InterPro:IPR024087"
FT                   /db_xref="UniProtKB/TrEMBL:E8NCG2"
FT                   /protein_id="BAJ73610.1"
FT                   /translation="MTSSTQISDVAAREGVALVPIGATEQHGPHLPVTTDTTIAAAFAT
FT                   AAAARAAKEVATWVLPPLPFGFSPEHAGRPGTIALSPQTLLAIADDIGRGVAASGIRRL
FT                   LFVNGHGGNPELLHVACRQLRERRGLAAFAVHVPGLALPPELAEGVTTGDLDAHAGHYE
FT                   TSVLLALDPAAVEMDAARADGLEEVRAAADSLTRPFGAVSVPWHVDDLSRSGVIGDPTT
FT                   ADARWGERAFAAQAGALADIVRAVAAHPLPPEWVHSRRGDAE"
FT   regulatory      691377..691382
FT                   /locus_tag="MTES_0647"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        691389..692390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0647"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0647"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73611"
FT                   /db_xref="GOA:E8NCG3"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E8NCG3"
FT                   /protein_id="BAJ73611.1"
FT                   /translation="MTDGPGRTPTLQEVATEAKVSLATASNALTGNRGVSPKLRDRVLE
FT                   AAQRVGYPRASGRRRTDRTTVGIVLPDVRHPAYAELAHAFEREGAQRDWALVLAGSDYE
FT                   PDNELEALENLVRSTDGVLLSPSRPPRSGVHRLQASPVPIVACDEPADSALIGGWVRSD
FT                   NFGGGRVAAHHLVDAGGSRFAMLGGEGYLPSTKERREGFLAGLADRGVADDDVLIIGEN
FT                   YGMDGGQSAMAELLETDAAVDAVFAVSDLHAVGAFFRALQEGRSVPDDLLLCGFDGVAW
FT                   TRQISPTITTVRQDWGKIAGRAMDILDTLMAGGDGDRAVIPVELVPGESTRR"
FT   CDS_pept        complement(692615..694087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gabD"
FT                   /locus_tag="MTES_0648"
FT                   /product="NAD-dependent aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0648"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73612"
FT                   /db_xref="GOA:E8NCG4"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:E8NCG4"
FT                   /protein_id="BAJ73612.1"
FT                   /translation="MTDSRESELLASVPTGLLINGEWRAATGGKTVAVNDPATGEVIHE
FT                   IADATVDDGVAAMDAAAEAFPSWAATPARERAEILRRAFDLLQERKEDIALLMTLEMGK
FT                   PLAEARGEVGYGGEFLRWFSEVTAHTQGRYGANPEGTGRMIVTQHPVGPCYLITPWNFP
FT                   LAMATRKIAPALAAGCTVVIKPATLTPLTTLFFAQILQDAGVPAGVVNVVTTTNTGPVS
FT                   ERIISDPRLRKLSFTGSTPVGVKLLQQAAPGVLRTSMELGGNAPFVVFEDADLDKAVDG
FT                   AMLAKFRNIGQACTAANRFIVQRSVVEEFTRRVTERVQGMKIGRGTEEGVQIGPLIDDR
FT                   AVDKAKTLVGDAVERGAKVTTGGSPIDGPGTFFEPTVVSDVQPGSDILREEIFGPVLAI
FT                   IPFDDEDDAVRLANDTEYGLVSYVFTESLARGQRMIDKLETGMMGLNVGVVSNAAAPFG
FT                   GWKQSGLGREGGDEGIHEYLQTKYTLTANPYA"
FT   regulatory      complement(694092..694097)
FT                   /gene="gabD"
FT                   /locus_tag="MTES_0648"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(694364..696208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0649"
FT                   /product="2-polyprenyl-6-methoxyphenol hydroxylase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0649"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73613"
FT                   /db_xref="GOA:E8NCG5"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR012941"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR038220"
FT                   /db_xref="UniProtKB/TrEMBL:E8NCG5"
FT                   /protein_id="BAJ73613.1"
FT                   /translation="MQFHHHGYVSGDPRVQNAAGTGIDRPDDLPDEVDVLIVGSGPAGM
FT                   LLAAQMSQFPQLTTRLIEKRDGRLALGQADGIQPRSVETFQAFGFADRITAEAYNIGWM
FT                   NFWAPDPENPERIVRTTRTEDYGYKISEFPHLIVNQARVLDYFAEAAANGPARIVPDYG
FT                   VEFLGLEVQDDHVDVRVGTDAGERTIRAKYVAGCDGARSGVRQAIGRSHVGAAAQHAWG
FT                   VMDVLVETDFPDWRIKCAINAAAGNILHIPREGGYLSRMYIDLGEVAADDDRRVRQTPI
FT                   EEIIRRANEILHPYTLDVKQVAWHSVYEVGHRVTDQFVDDLENPRVFLTGDACHTHSAK
FT                   AGQGMNVSMQDGFNLGWKLGHVLTGLAPVDLLRTYDAERRPVAQQLIDFDREWSSLMAR
FT                   KPGEITDPDELATYYLATAEFPSGFGTHYAPSRIVASDAAEELASGFPVGKRFQSVEVV
FT                   RVCDGNAVHLGHHARADGRWRVYAFADAEGSALRAWAAAALPIVERFTPEGADLDAVFD
FT                   VKVVFPGRWEDVVDVPALFRPRSGPLGLTDLEKVFAAAPSAWTSADIFAERGIGAAGAV
FT                   VVVRPDQYVAHVLPLTDPAGLERFLAGVVAVPAVAAAT"
FT   regulatory      complement(696213..696218)
FT                   /locus_tag="MTES_0649"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      696289..696294
FT                   /locus_tag="MTES_0650"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        696306..697010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0650"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0650"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73614"
FT                   /db_xref="GOA:E8NCG6"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E8NCG6"
FT                   /protein_id="BAJ73614.1"
FT                   /translation="MPARQEASPASQTLSRGIRLLEELADARTPLSIDDLAARVELHRS
FT                   VAYRLLRTLEDHGLVTRDAAGAVRLGTGLAALAAGVAADLQAEALPELTAAANELGMTC
FT                   FLVVLDHDECVTLTSVEPRHAVTAVAQRPGARHPVTRGAPGRAILAQLPPRRWPETVDA
FT                   RLAAEVADAAERGWATSHDEVVPSLRAVAVPLSVQGRQPAAVAAVYVATSLDDAAIAAR
FT                   LAAAAEAVRVAL"
FT   CDS_pept        complement(697020..697661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0651"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0651"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73615"
FT                   /db_xref="InterPro:IPR025874"
FT                   /db_xref="UniProtKB/TrEMBL:E8NCG7"
FT                   /protein_id="BAJ73615.1"
FT                   /translation="MSDLVPFTDNFSDLSNTDGYQFEFRCERCGNGYRSAFRSDPRAAG
FT                   QRLARGIGNLFGGQVSQFTSMADRLLDRGTNSPAKDQALRAATAEIAPKFHQCRACSDW
FT                   VCDDVCWNDGVGQCVRCSPIAVEELAQLQAEARRRQVQERLETVDMVGGVDLKTPARPR
FT                   CGACGAQSHGGKFCGECGSPLVVVATCTGCGSENPSGARFCSSCGTGLAS"
FT   CDS_pept        complement(697663..698256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0652"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0652"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73616"
FT                   /db_xref="GOA:E8NCG8"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:E8NCG8"
FT                   /protein_id="BAJ73616.1"
FT                   /translation="MPTPRRRAARDAELLAGSVRAFAARGYFGTSTAQVAAEMGVSQPY
FT                   VIRTFGSKLELFVRTHAFAAAEIVEVFRAAMTDGFDGDRLGAAYRELVLSNPAALLVWA
FT                   HAFSAATAEPAIGAESRRQFDDVYRTLREAGASDAELWAFMGRGMLINNLLLMEAPRYS
FT                   RDYDFAPLIDLVFGERPPLSPSPGTPRAPAPDQE"
FT   regulatory      complement(697665..697670)
FT                   /locus_tag="MTES_0651"
FT                   /regulatory_class="ribosome_binding_site"
FT   regulatory      complement(698262..698267)
FT                   /locus_tag="MTES_0652"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        complement(698327..699529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0653"
FT                   /product="transcriptional regulator/sugar kinase"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0653"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73617"
FT                   /db_xref="GOA:E8NCX8"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E8NCX8"
FT                   /protein_id="BAJ73617.1"
FT                   /translation="MTRDAGYVRRMRTFVDVAGEDASSTRHRVLAAVRDHGPISRADLA
FT                   RRTGLAASTITSAAQSLAVEGVLHEVEDAGEPVSRTGPRGRGLSVDPALASVAGIDFGF
FT                   RTVRVAVCDVHARVLVTRESRLAERYSSEEGLSVAAQLYRSAVSALPEEQGAVVTVGVA
FT                   LPGPIDAVRRRVIGSAVLPGWSGTTAEELTETFGVDTVIENDANLAALGEHVFGAGRDV
FT                   ADSLTVKFHSGIGAGLIVRDRLVGGAGSGEIGHFAVAAEGQVCRCGKRGCLDTFAAIPA
FT                   LLDAVSTDTETPDVRSLVERTVAGEPRASRIVSDAAELVGDAASRACLLFAPQRVIVVG
FT                   AMAEAGDAVLEPFARALRRGLIPDTQSAPEIVRGALAERSTVMGAVALALTASGWLPAG
FT                   G"
FT   regulatory      699679..699684
FT                   /locus_tag="MTES_0654"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        699694..700461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0654"
FT                   /product="ABC-type sugar transport system, ATPase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0654"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73618"
FT                   /db_xref="GOA:E8NCX9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E8NCX9"
FT                   /protein_id="BAJ73618.1"
FT                   /translation="MVTPSLELQGITKRFGHVAALRDVHLSAYAGQILAVVGDNGAGKS
FT                   SLIRTISGVYRPDEGTVRVDGAEQVFTNPAAARSAGIATVFQDLALIEVLDVATNMFIG
FT                   QYPRRGPFVRRRTMERETRAFLDELGVSVASVRTEIGMLSGGQRQIVAIARAMRTGGRI
FT                   VLLDEPTAALGVRETAQAADMIRTLRERGNTVIIVSHDMSLVFDLADRIQVMRLGRVAG
FT                   IRERAQTTRDEIIGLITGAVTGDEGTAPADTAA"
FT   regulatory      700521..700526
FT                   /locus_tag="MTES_0655"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        700535..701518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0655"
FT                   /product="ABC-type sugar transport system, periplasmic
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0655"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73619"
FT                   /db_xref="GOA:E8NCY0"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E8NCY0"
FT                   /protein_id="BAJ73619.1"
FT                   /translation="MSLISTRRLAATALAGATLVAALTGCGALSGGSIAASSDPSASLR
FT                   EVKTITYVNPAPFYPAFDDVGRCFEDAAKKNGWTPVEVGTSGSAVDNQGAIDLISQAIA
FT                   NGTDALVVFPTIPELFTPVITQARNADIYVVAQNAGDPSTGQQTQVGTDATQLGALIAE
FT                   GLGKTDPNAQVGILSGSASTTPHVQEIQGFTDYAKEHFPNMKVVASDYTNGDPTKAPEL
FT                   FSNMLTAHPEITALFPIEGTSVAAAITAVKERGLTGKVNVVANDLTDDHRASIEDGTLL
FT                   GVGEQGWCESGTKAVEAVKDLSEGKTLPAFIATTSTFYDKSNLPAK"
FT   regulatory      701557..701562
FT                   /locus_tag="MTES_0656"
FT                   /regulatory_class="ribosome_binding_site"
FT   CDS_pept        701576..702541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MTES_0656"
FT                   /product="ribose/xylose/arabinose/galactoside ABC-type
FT                   transport systems, permease components"
FT                   /db_xref="EnsemblGenomes-Gn:MTES_0656"
FT                   /db_xref="EnsemblGenomes-Tr:BAJ73620"
FT                   /db_xref="GOA:E8NCY1"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:E8NCY1"
FT                   /protein_id="BAJ73620.1"
FT                   /translation="MRNVVRRIAAAPQLGLILIIVLLILVAQAANPQ