(data stored in SCRATCH zone)

EMBL: AY028928

ID   AY028928; SV 1; linear; mRNA; STD; MUS; 3867 BP.
XX
AC   AY028928;
XX
DT   26-NOV-2001 (Rel. 69, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Mus musculus retinol dehydrogenase type 1 (Rdh1) mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-3867
RX   DOI; 10.1074/jbc.M105748200.
RX   PUBMED; 11562362.
RA   Zhang M., Chen W., Smith S.M., Napoli J.L.;
RT   "Molecular characterization of a mouse short chain dehydrogenase/reductase
RT   active with all-trans-retinol in intact cells, mRDH1";
RL   J Biol Chem 276(47):44083-44090(2001).
XX
RN   [2]
RP   1-3867
RA   Zhang M., Chen W., Smith S.M., Napoli J.L.;
RT   ;
RL   Submitted (20-MAR-2001) to the INSDC.
RL   Department of Nutritional Sciences and Toxicology, University of
RL   California, Berkeley, 119 Morgan Hall, Berkeley, CA 94720, USA
XX
DR   MD5; c316d26adb87bbe9af1d0751ebe10329.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3867
FT                   /organism="Mus musculus"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS_pept        130..1083
FT                   /codon_start=1
FT                   /gene="Rdh1"
FT                   /product="retinol dehydrogenase type 1"
FT                   /function="putative retinol (all-trans-retinol and
FT                   9-cis-retinol)dehydrogenase"
FT                   /function="putative sterol 3-alpha-hydroxydehydrogenase"
FT                   /note="RDH1"
FT                   /db_xref="GOA:Q8VIJ7"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="MGI:MGI:1195275"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VIJ7"
FT                   /protein_id="AAK30001.1"
FT                   /translation="MWLYLVALVGLWTLLRFFRERQVVSHLQVKYVFITGCDSGFGNLL
FT                   ARQLDRRGMRVLAACLTEKGAEELRNKTSDRLETVILDVTKTESIVAATQWVKERVGNR
FT                   GLWGLVNNAGISTPSGPNEWMKKQDFARVLDVNLLGMIEVTLSMLPLVRKARGRVVNVS
FT                   SVMGRMSFFGGGYCISKYGVEAFSDSLRRELSYFGVKVAIIEPGGFKTCVTSSDRLSSN
FT                   TKMIWDKASSEVKEIYGEKFLLFYLKNLNELDKRCNKDLSVVTDCMEHALTARHPRTRY
FT                   SAGWDAKFLFLPLSYLPTFLVDALLYWTSMKPEKAL"
XX
SQ   Sequence 3867 BP; 903 A; 906 C; 932 G; 1125 T; 1 other;
     cagagaggag caactgtcat acttgccaga agtctgtagg cttatgctgc ctgccacagt        60
     tttttgcatt cctattactc tctgaaaacg gggcaggctc attttgtcct gaaagcagct       120
     gtgtaaacca tgtggctcta cctggttgca ctggtgggcc tgtggacgct cctgcgcttc       180
     tttagggaga ggcaggtggt gagccatctc caagtcaagt atgtcttcat cacgggctgt       240
     gactctggct ttgggaacct gctggccaga cagctggaca ggagaggcat gagggtattg       300
     gctgcatgtc tgacggagaa gggagccgag gagctgagga acaagacatc tgacaggctg       360
     gagacagtga tcctggatgt caccaagaca gagagtattg tggcagccac tcagtgggtg       420
     aaggagcgtg ttgggaacag aggactctgg ggcctggtca acaacgctgg catctccacc       480
     ccctcgggtc ccaacgagtg gatgaaaaaa caggactttg caagagtact ggatgtgaac       540
     ctgttgggca tgatcgaggt gactctgagc atgctgccct tagtgaggaa ggcgaggggt       600
     cgtgtggtca acgtctccag cgtcatgggc cgaatgtctt tctttggtgg tggttactgc       660
     atctccaagt atggtgtaga ggccttctca gactccctca ggagggagct ctcctatttt       720
     ggggtgaagg tggctattat agagcctgga ggcttcaaga cttgtgtgac aagtagtgac       780
     aggctatcat caaacaccaa gatgatctgg gacaaggcca gctcggaagt caaagagatc       840
     tatggcgaga agtttttatt attctatctg aaaaacctaa acgaattgga caagaggtgc       900
     aacaaggacc tgtctgtggt gactgactgc atggagcacg ctctgactgc ccgccaccct       960
     cgcactcgat actcagcagg ctgggatgcc aagttcctct tcctcccctt gagctacctg      1020
     cccacctttc ttgtggatgc ccttctctac tggacttcca tgaagcctga gaaagccctc      1080
     tgaagtgttc acctatgtgc atacctgggg agatgtaggt agagtgtgag agagagaata      1140
     tttaggggaa attaggaggg ttgagggagg gagtttatta gtctggggtt cttagtcaac      1200
     acacttcatc tcattaattc tcctatgaca ctacacaaga ctgatgatga ccaaataaat      1260
     aggcaaagaa ttctgccaag ggattcagat acaaaagtgc tggctgatgt ccagactatg      1320
     agcatcatgg ctaccatgaa ggtcgacaca gatgaggagg ctgggaccag cttgtgccaa      1380
     gcattcttct gtgtcctcct ctgcaggaaa tgcacatgcc ctggctagtt taaaccccta      1440
     tgcagcatgg aagtgtccct gctctgaagt cacctgagac catggtgtag ggtctgagag      1500
     agtcactaat aaagccagca cccatgccct ggagtcaagt tggcaggccc tgggtgggag      1560
     gttcagttcc cggtgatgaa acctagcaga ggatggagac accatttttt taaaaaatca      1620
     tggcttcttt tggactcttt atttttagga caaagtatga ggtcatctcc tgtaccctgt      1680
     gatttaaatt atggcttttc tggttagtga ggtttggatc acaggggtca gggttggcac      1740
     aggccagcag gctttctgag ttgcagactc actaagtgac catgctttcc tgcagaccca      1800
     ctaggggacc atcccttgct gcagactcac taattgaccg tatcttacct gcatattcac      1860
     taattgaccg tatcttacct gcagaatcag gaagttgcca tcccttcctg cagactcaat      1920
     acatgataat caattccctg cagactcact aagtgaccat ccctttcctg cagacccatt      1980
     aagtgatcat tccttccctg cagacccatt aagtcaccat tccttcatat aagtatcact      2040
     aactgaccat tataataaaa cccttctgat tttctgtctg aacttgtccc aggccacttc      2100
     tcatgtcccc tccctctgtc ccactgccac actcctccag cagcatgcag agattgcctt      2160
     tcttatctct tgtctttcat tttatggaca atatttacaa aagatcaagg gtctttaact      2220
     cccatagcct ntgaggcctg gctctgcctg gtgctaggtt ggtgaatctc aagaataggc      2280
     tgagcaggga cagcatgtgt gggagagaca gaatcctggg ctcagtgcag acttgccctt      2340
     gggagggaat tccatagatg cctgactcct cttctctcag tagaaatgtg ggggctgagg      2400
     tgccataaga ggaacttgta aataaacgat aatttctgaa ttaatgaaaa tagaaattcc      2460
     aaccctatca tgtgcctggc catccattta atttatgtta ttttgaaagc tttgttttag      2520
     gacctttgag catatgtttg tatatctgta tgtttcatgt gtgggagtgc cctaagatgt      2580
     gagaaggaag atgagggcca ctggtttcaa gaagttttca gccatataat gtgggtgtca      2640
     ggaattgaat ttgggtttgc cataggagca ggaagcactt tttttctgat tttttattaa      2700
     atattttctt tatttacatt acaaatgtta tcccctttcc tagtttcccc tccgaaaaac      2760
     cccatccccc cccccactcc cctgctcacc aacccacaca ctcctgcttc ctggctctgg      2820
     cattccttta cactggggca tacagccttc ataggactaa gggcctctcc tcccattgat      2880
     gaccaacaag gccatcctct gctacatgtg cggctggagc catgggtccc tccatgtgta      2940
     ctctttggtt ggtggtttag tccgtgggaa ctctgggggt gctagttggt tcatattgtt      3000
     gttcctccta tggggctgca aaccccttca gctccttggg tcccttctct agttccttca      3060
     ttggggacat ggtgctcagt ccactggatg cctgagagca cccatctctg tatttgtcag      3120
     gtactggtag aacccttcag gagacagctt tatcaagttc ctgtcagctc ttgttggcat      3180
     ctacagtagt gtctgggttt gatgactgta tatgggatgg atacccaggt ggggcagtct      3240
     ctggatggcc tttccttcag tctctgctcc atacttcgta actcctttca tgggtatttt      3300
     gttctccctt ctaagaagga cccaagtatc tacactttgg tcttcctttt cctttctttc      3360
     ctttttttgt tttgcttctg gtttggtttg gttttttgag acagagtttc tctgtgtagc      3420
     ccgggctgtc ctggaactca ctctgtagac caggctggcc ttgaactcag aaatccacct      3480
     gcctgtgcct ccagagtgct gggattaaag gcgtgcgcca tcacgcccat ctggtcttcc      3540
     tttttcttga gcttcaggtg gtctgtgaat tgtatcttgg gtattcgaag cttctgggtt      3600
     aatacccact tttcactgag tgcataccat gtgtgtgtgt tcttttatga ttgggttacc      3660
     tcactcagga tgatattttc tagttccatc caattgccta agaatttcat aaattcattg      3720
     tttttaacag ctgagtagta ctccattgtg taaatgtacc acattttctg tatccattcc      3780
     tctgttgtgg gacatctggg ttctttccag cttctggcta ttaaaaataa ggctgctatc      3840
     aaaaaaaaaa aaaaaaaaaa aaaaaaa                                          3867
//

If you have problems or comments...

PBIL Back to PBIL home page