(data stored in ACNUC7421 zone)

EMBL: AY028965

ID   AY028965; SV 1; linear; genomic DNA; STD; PRO; 6066 BP.
XX
AC   AY028965;
XX
DT   11-APR-2001 (Rel. 67, Created)
DT   16-APR-2005 (Rel. 83, Last updated, Version 2)
XX
DE   Vibrio vulnificus alpha-galactosidase gene, partial cds; beta-galactosidase
DE   (lacZ) and galactoside ABC transporter genes, complete cds; and galactoside
DE   ABC transporter gene, partial cds.
XX
KW   .
XX
OS   Vibrio vulnificus
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Vibrionales; Vibrionaceae;
OC   Vibrio.
XX
RN   [1]
RP   1-6066
RA   Baek C.H., Park D.K., Lee K.E., Kim Y.T., You K.H., Hwang W., Kim K.S.;
RT   "Beta-galactosidase of Vibrio vulnificus ATCC 29307";
RL   Unpublished.
XX
RN   [2]
RP   1-6066
RA   Baek C.H., Park D.K., Lee K.E., Kim Y.T., You K.H., Hwang W., Kim K.S.;
RT   ;
RL   Submitted (21-MAR-2001) to the INSDC.
RL   Life Science, Sogang University, Sinsoo-Dong 1, Mapo-Gu, Seoul 121-742,
RL   Korea
XX
DR   MD5; 206ed31188370da927133dcfef289aa9.
DR   StrainInfo; 125990; 0.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..6066
FT                   /organism="Vibrio vulnificus"
FT                   /strain="ATCC 29307"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:672"
FT   CDS_pept        complement(<1..441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="alpha-galactosidase"
FT                   /note="melibiase"
FT                   /db_xref="InterPro:IPR031704"
FT                   /db_xref="UniProtKB/TrEMBL:Q9AEQ9"
FT                   /protein_id="AAK29749.1"
FT                   /translation="MTNKTVVELSGRETQLMVELGEYAEILHWGNKVQGELESARVALH
FT                   RPVPYGRLDTDVAMTLHPELGRGVFSSPGVEGHREGQDWAPVFVISHVEHGQGSIVIQS
FT                   EDAIAGLRLTTELMLDMHDVVKTRHTLTNIKAGLYQVNRLANT"
FT   CDS_pept        822..3917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lacZ"
FT                   /product="beta-galactosidase"
FT                   /db_xref="GOA:Q8D4H3"
FT                   /db_xref="InterPro:IPR004199"
FT                   /db_xref="InterPro:IPR006101"
FT                   /db_xref="InterPro:IPR006102"
FT                   /db_xref="InterPro:IPR006103"
FT                   /db_xref="InterPro:IPR006104"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR023232"
FT                   /db_xref="InterPro:IPR023933"
FT                   /db_xref="InterPro:IPR032312"
FT                   /db_xref="InterPro:IPR036156"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8D4H3"
FT                   /protein_id="AAK29750.1"
FT                   /translation="MTAFSEILQRRDWENPQSVNIHCLKAHSPLASFRDMAHARDGIHA
FT                   QRQSLNGQWKFKLFDAPEQVDGQFTQADFNDAEWDEIPVPSNWQLHGYDKPIYANIKYP
FT                   FDVNPPFVPSDNPTGCYRTRVSFSPEELANTQRIIFDGVNSAFHLWCNGTWVGYSQDSR
FT                   LPAEFDLTSHLVAGENTLAVMVMRWCDGSYLEDQDMWWLSGIFRDVTLLSKPQHCIEDV
FT                   FITPDLDACYRDGSLSIVTTIAAPETYQVQVQLFEGTQAVTEPNIARPHNRRIDERGTW
FT                   NDVVFQTLHLREPKKWTAETPNLYRLVVSLLDENGTHLESEAYPVGFRKVEISEGQLKL
FT                   NGKPLLIRGVNRHEHHPELGHVMTEEDMIRDICLMKQYNFNAVRTAHYPNHPRWYELCD
FT                   QYGLYVCDEANIETHGMQPMSRLSSDPQWAHAYMSRYTQMVLRDKNHPSIIIWSLGNES
FT                   GHGSNHNAMYAWSKNFDPSRPVQYEGGGSNTTATDIIAPMYARVNTLVADEAVPKWPIK
FT                   KWISLPNETRPLILCEYAHAMGNSLGSFDEYWAAFREFPRLQGGFIWDWVDQGLSQWDE
FT                   NGQHFWAYGGDFGDEINDRQFCINGLIFPDRTVHPTLQEAKYCQRMITVSLQEQTQKAC
FT                   TLLVTNENLFRTTDNEQLNWSLLENGQVIQTGSQVLSVEADSQTRLEIALNFTPKAQAQ
FT                   YHLNTDICLIEATSWAPAGHVVATEQMALRNHAGLAMPTLRTQPAPKLTQNGHAIVVSS
FT                   LDEKHQWRWDSQSGLLMEWNVDGKAQMLAAPQDNFFRAPLDNDIGISEVDNVDPNAWVC
FT                   RWEMAGIGQWERHCVQCESETLAHAVVVTTTFAYHFGGDVQAITQWTHTLSNDGEMLLD
FT                   VDVTLADALPPMPRIGLELQLPLHQTDTPITWQGLGPFENYPDRLAAARFGLHTQTLAQ
FT                   MHTPYIFPTDSGLRCGTQWLQVNELAISGDFQFSVSQYAQQQLAEAKHTHDLLAQERIY
FT                   LRLDHQHMGVGGDDSWSPSVHKEFQLTEKHYRYQLRFKPASR"
FT   CDS_pept        4276..5250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="galactoside ABC transporter"
FT                   /note="periplasmic D-galactose/D-glucose-binding protein"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q9AEQ7"
FT                   /protein_id="AAK29751.1"
FT                   /translation="MRKVTLLALLTAGVGFGTQALADTTLGFTIYKYDDNFMSVVRQAI
FT                   EKEAASDKSTRILMNDSQNSQSMQNDQVDVMLARGVQALAINLVDPAAAPTIIQKAKMD
FT                   DVPIVFYNKEPSPQALASYDKAYYVGTDSKESGIIQGDLIAQAWKANPAWDKNGDGVLQ
FT                   YVMLKGEPGHPDAEARTTYSVQTINENGIKTEELHMDTGMWDTAMAKDKMDAWLSGPNG
FT                   SKIEVVIANNDGMAMGAVEALRGAGVKLPVYGVDALAEALALVKSGDMAGTVLNDAESQ
FT                   AKATFELSRNLADGKQPAEGTRWQVVNKIVRVPYVGVDKDTLN"
FT   CDS_pept        5356..>6066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /product="galactoside ABC transporter"
FT                   /note="ATP-binding protein"
FT                   /db_xref="GOA:Q9AEQ6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015862"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9AEQ6"
FT                   /protein_id="AAK29752.1"
FT                   /translation="MVNQTHEFLLEMTGVSKEFPGVKALDKVNLNVRPHSIHALMGENG
FT                   AGKSTLLKCLFGIYEKNEGNILFLGKEVNFTSSKEALESGVSMVHQELNQVKQCSVMDN
FT                   IWLGRYPKKGFFVDHDKMYRDTKAIFAELDIDIDPKVKVATLSVSQMQMVEIAKAFSYD
FT                   AKIVIMDEPTSSLTEKEVSHLFTIINKLKEKGCGVVYISHKMEEIFAICDEITILRDGQ
FT                   WVDTRPLKGLDMDQI"
XX
SQ   Sequence 6066 BP; 1664 A; 1585 C; 1443 G; 1374 T; 0 other;
     agtgttcgcc aagcggttca cttggtatag acccgcttta atgttggtga gtgtgtggcg        60
     cgttttaacc acatcatgca tatccagcat cagctcggtt gtcaggcgaa ggcccgcgat       120
     cgcatcttcg ctttgaatca cgatggaacc ttggccgtgt tcaacatggg agatgacaaa       180
     cacgggtgcc caatcttgtc cttcacgatg cccttccaca ccggggctac tgaacacacc       240
     gcggccaagc tcaggatgga gtgtcatcgc aacatcagta tcaaggcgac catatggcac       300
     cggacgatgc agtgcaacgc gagcgctttc aagctccccc tgaaccttgt ttccccagtg       360
     cagaatctcc gcgtattcgc cgagctcgac cattaactga gtttcccgac cgcttaactc       420
     aaccactgtt ttgttcgtca tcatgcttac ctaaaaacga gaaattacgc cgcatcataa       480
     tgaaacggac aaaataatct gtgagccaca gcaaaatcat gaaaacgttt ccagatttat       540
     tcaaaactca gtgccgtagc tgccgataaa accaagaccc acaatctttt ccaacctttg       600
     aagcgctagc tctcatcacc atacctgacg gcaaaacaac gatcattctc acattgctat       660
     ggatttatcg tgtgcgagtg gaaaaatgcc acacacatca tgaaaacgtt tccaaaattt       720
     cattacactc tgcctcagtt aggaacttgt tacttgcttg tgctgctcta aaacacgctg       780
     acttatccgc ccgcaggtaa catcaatcat aaaggcacca catgactgca ttttcagaaa       840
     ttctccaacg acgcgactgg gaaaacccgc aatccgtgaa cattcactgc ctaaaggcac       900
     atagcccact cgccagtttt cgcgatatgg cccatgctcg cgatggtatt cacgcccagc       960
     gtcaatcact aaatggacaa tggaaattca aactgtttga tgcaccagag caggtggatg      1020
     gccagttcac gcaggccgat ttcaatgacg cggaatggga tgagatcccc gtgccgtcta      1080
     actggcaact gcacggttac gacaaaccca tttacgccaa tattaaatac ccatttgacg      1140
     taaacccgcc gtttgtacca agtgataacc caaccggttg ctaccgcact agggtatcgt      1200
     tctcaccaga agagttggcc aacacgcaac gcattatctt tgatggtgtg aattcggctt      1260
     tccatctttg gtgtaacggc acttgggttg gctacagcca agacagccgt ttgcctgccg      1320
     agtttgatct cacatcgcat ctcgtggcag gggaaaatac gctcgcggtc atggtgatgc      1380
     gttggtgtga tggcagctac ctagaagacc aagacatgtg gtggctaagc ggtatcttcc      1440
     gtgacgtgac attgctgtcg aaaccacagc actgcattga agatgtgttc atcacgccgg      1500
     atctcgacgc ctgctatcgc gacggctcgc tctccatcgt caccaccatt gcagcgccag      1560
     aaacctatca agtacaggtt caattgtttg agggtacaca agcggtcact gagccaaaca      1620
     tcgctcgccc acacaaccgt cgcatcgacg agcgtggtac ttggaatgat gtggtattcc      1680
     aaaccctgca cctacgcgag ccaaagaaat ggacggcgga aacaccgaac ctctaccgct      1740
     tagttgtttc actgttggat gaaaacggca cgcatctcga gagcgaagcg taccctgtgg      1800
     gctttcgtaa agtggaaatc agcgagggtc aattgaagct caacggcaag ccgctgctga      1860
     tccgcggggt caatcgccac gagcatcatc cagagctggg ccatgtgatg accgaagagg      1920
     atatgatccg cgacatctgc ctgatgaaac aatacaactt caacgcggtg cgcaccgctc      1980
     actatccaaa ccatccgcgt tggtacgaac tgtgtgacca atacggcttg tacgtgtgtg      2040
     atgaagcaaa cattgaaaca cacggcatgc agccaatgag tcgcttatcg agcgatccgc      2100
     aatgggcgca cgcgtacatg agtcgctata cccaaatggt actgcgcgat aagaaccatc      2160
     catcgatcat catctggtct ttaggtaatg aatcgggcca cggcagcaac cacaatgcga      2220
     tgtacgcttg gtcgaaaaac tttgatccgt cacgccctgt gcaatacgaa ggcggcggtt      2280
     caaacaccac ggcaaccgac atcattgcgc cgatgtacgc tcgcgtaaat accctagttg      2340
     ccgatgaagc ggtaccaaaa tggccaatca aaaaatggat ttctctaccc aacgaaacgc      2400
     gcccattgat cttgtgcgaa tacgcccatg cgatgggcaa tagcctaggc agttttgatg      2460
     aatactgggc ggcatttcgc gagttcccac gcctacaagg cggctttatt tgggattggg      2520
     ttgaccaagg cttgagccaa tgggatgaaa acggccagca cttctgggct tacggcggcg      2580
     attttggtga tgaaatcaat gaccgccagt tctgcattaa cggcttgatc ttccccgatc      2640
     gcaccgtgca tccaacgttg caagaagcca aatattgcca gcgcatgatc accgtctcgc      2700
     tgcaagagca aacccaaaaa gcgtgcacac tgttggtgac caacgagaac ctgttccgta      2760
     ccactgataa cgagcaattg aactggtcac tgttagaaaa tggccaagtc atccaaacgg      2820
     gttcacaggt gcttagcgta gaggctgaca gccaaacacg ccttgaaatt gcgctgaatt      2880
     tcacgccaaa agcgcaggcg caataccact taaataccga catttgcctt attgaagcga      2940
     cgtcatgggc tcccgctggc catgtggtgg cgacagagca aatggcgctg cgcaatcacg      3000
     caggccttgc catgccaacc ttgcgcacac agcctgcacc caagctgacc caaaacggcc      3060
     acgccattgt ggtcagcagt ctggatgaaa agcatcaatg gcgctgggat agccaaagcg      3120
     gtttgctgat ggaatggaac gtggatggca aagcgcaaat gctggccgcg ccgcaagaca      3180
     acttcttccg cgcgccgctg gataacgaca tcggcatcag tgaagtggat aacgttgacc      3240
     ccaacgcttg ggtatgccgt tgggagatgg cgggcattgg ccagtgggaa cgtcattgcg      3300
     tccagtgcga gagcgaaacg ctcgctcacg ccgtggtcgt aaccaccacg tttgcctacc      3360
     actttggcgg cgacgtgcaa gccattaccc agtggacgca cacactcagc aacgatggcg      3420
     aaatgctatt ggatgtcgac gtcacactgg cagacgctct gccgccgatg ccgcgtattg      3480
     gcttggagtt gcaacttccg cttcaccaaa ccgacacgcc gatcacatgg caaggcttag      3540
     gcccatttga aaactaccca gatcgcttag ccgcagcacg ttttggctta catactcaaa      3600
     cactagcgca gatgcacaca ccgtacatct tcccaaccga cagcggcctg cgttgtggca      3660
     cgcagtggtt gcaagtgaac gagttggcca tctcgggtga cttccagttc agtgttagcc      3720
     aatacgctca gcaacaattg gcagaagcga aacataccca tgatttgcta gcgcaagagc      3780
     ggatttacct gcgtctagat caccagcaca tgggggttgg cggtgacgat tcttggagcc      3840
     caagtgtgca caaagaattc caattaacgg agaaacacta ccgctaccag ttgcgattta      3900
     agcctgcttc acgctagcgt ttgctcgcct ctaggctttc tcactaggct ttccctctag      3960
     gccaaaccca ataagccaag cctttgattt tgcgtctaag gcttggtttt gtcgttttag      4020
     tgcgtatttt ttgcactcga tcattacctt tctgaccaac gtttacacgc aagataaaaa      4080
     accacactca aatcacaaaa cccttacaaa cattaacatt caattacaaa tctggtgaaa      4140
     tttttatcta gttcacatta attgattcgt ttgtcactat actcaaaggg taaacgtttt      4200
     caccaattat aaaattaatt gcagataacg aattacccct acagcaaacc aataacaaac      4260
     aatcaggatt tttctatgag aaaggttact ctacttgctc tgctcactgc tggtgtaggc      4320
     tttggaacac aagctctagc ggataccacc cttggattta ctatctacaa gtacgacgac      4380
     aacttcatgt cggttgtgcg ccaagcgatt gaaaaagaag cggcatcaga caaaagcact      4440
     cgcattctga tgaacgattc gcaaaacagc caatcgatgc aaaacgacca agtggacgtc      4500
     atgttggctc gtggtgtgca agcgctggcc attaacctgg ttgaccctgc ggctgcgcca      4560
     accatcatcc aaaaagcgaa aatggacgat gtgcctatcg tgttctacaa caaagaacca      4620
     agcccacaag cgctcgcgag ctacgacaaa gcgtactacg tcggtaccga ctcaaaagaa      4680
     tcgggcatca ttcagggtga tctcatcgcg caagcgtgga aagccaaccc agcatgggac      4740
     aaaaacggcg atggcgtact gcaatacgta atgctaaaag gcgaacctgg ccacccagat      4800
     gcggaagcac gcaccacgta ttctgtgcaa accatcaatg aaaacggcat caaaaccgaa      4860
     gagttgcaca tggataccgg catgtgggat accgcgatgg cgaaagacaa aatggacgct      4920
     tggctctctg gccctaacgg cagcaaaatc gaagtggtga ttgccaacaa cgacggcatg      4980
     gcaatgggcg cggtagaagc actacgcggc gcgggcgtga aactgcctgt gtacggtgtt      5040
     gatgccctag ctgaagcctt ggcgctggtc aaatctggcg acatggcggg taccgtactc      5100
     aacgatgcgg aatcccaagc gaaagcgacc tttgaactgt cacgcaacct cgccgatggc      5160
     aaacagcctg ctgaaggcac tcgctggcaa gtcgtgaaca aaattgttcg cgtgccttat      5220
     gttggcgttg ataaagatac cttgaactaa tttagtgccc gggggagcat gctcccccta      5280
     tgcgctttct tcattgtcac actgtcgtta gagaacattt ctgttgtccg cccattgacg      5340
     aaataaagag agaccatggt aaatcaaaca catgaattcc tgttggagat gacaggagta      5400
     agtaaagagt ttcctggggt aaaggcatta gataaggtta atttaaacgt tcgccctcat      5460
     tctattcatg cattaatggg agaaaatggg gctggcaaat caacactatt aaaatgtcta      5520
     tttggtattt acgagaagaa tgaaggaaat attctctttc tcggtaagga agtgaatttc      5580
     acctcatcaa aagaagcatt ggaatccggt gtttctatgg ttcaccaaga attgaaccaa      5640
     gtaaaacaat gctccgtcat ggataatatt tggctcggtc gttatccaaa gaaagggttc      5700
     tttgttgatc acgataaaat gtatcgcgat accaaagcaa tctttgccga attggatatc      5760
     gatatcgatc ctaaagtcaa agtcgcgacc ttatccgtgt cacagatgca gatggttgag      5820
     atcgccaaag cgttctccta tgacgccaaa atcgtcatca tggatgaacc cacctcatcg      5880
     ctgacggaaa aagaagtcag ccacctgttt accatcatca acaagctgaa agagaaaggc      5940
     tgtggtgtgg tgtacatctc gcacaagatg gaagaaatct ttgctatctg cgatgaaatc      6000
     accattttgc gcgatggaca atgggtcgac actcgccctc tcaaagggct cgatatggac      6060
     cagatc                                                                 6066
//

If you have problems or comments...

PBIL Back to PBIL home page