(data stored in ACNUC32233 zone)

EMBL: AY032655

ID   AY032655; SV 1; linear; mRNA; STD; MUS; 8735 BP.
XX
AC   AY032655;
XX
DT   15-OCT-2001 (Rel. 69, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Mus musculus beta4-spectrin mRNA, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-8735
RX   DOI; 10.1038/ng710.
RX   PUBMED; 11528393.
RA   Parkinson N.J., Olsson C.L., Hallows J.L., McKee-Johnson J., Keogh B.P.,
RA   Noben-Trauth K., Kujawa S.G., Tempel B.L.;
RT   "Mutant beta-spectrin 4 causes auditory and motor neuropathies in quivering
RT   mice";
RL   Nat Genet 29(1):61-65(2001).
XX
RN   [2]
RP   1-8735
RA   Parkinson N.J., Tempel B.L.;
RT   ;
RL   Submitted (16-APR-2001) to the INSDC.
RL   Otolaryngology, Univ. of Washington School of Medicine, 1959 NE Pacific St,
RL   Seattle, WA 98195, USA
XX
DR   MD5; 0b9c4aa880590e73214fd684f7937d50.
DR   Ensembl-Gn; ENSMUSG00000011751; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0031910; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AKRJ_G0031819; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0031894; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031616; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032359; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0030951; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0031581; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0031733; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0031689; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0031813; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0031724; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032390; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0030675; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031059; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000172269; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0082499; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AKRJ_T0082502; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0082525; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0082123; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0082992; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0082642; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0082071; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0082229; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0082106; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0082253; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0082120; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0083274; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0082071; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0081177; mus_musculus_wsbeij.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..8735
FT                   /organism="Mus musculus"
FT                   /chromosome="7"
FT                   /map="between D7Mit113 and Periaxin (D7Tem23)"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10090"
FT   CDS_pept        163..7830
FT                   /codon_start=1
FT                   /product="beta4-spectrin"
FT                   /note="mutations in beta4-spectrin found in quivering mouse
FT                   mutant alleles"
FT                   /db_xref="GOA:Q91ZE6"
FT                   /db_xref="InterPro:IPR001589"
FT                   /db_xref="InterPro:IPR001605"
FT                   /db_xref="InterPro:IPR001715"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR002017"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR016343"
FT                   /db_xref="InterPro:IPR018159"
FT                   /db_xref="InterPro:IPR036872"
FT                   /db_xref="InterPro:IPR041681"
FT                   /db_xref="MGI:MGI:1890574"
FT                   /db_xref="UniProtKB/TrEMBL:Q91ZE6"
FT                   /protein_id="AAK38731.1"
FT                   /translation="MAQVPGEVDNMEGPAVSNNNNPSARWESPDRGWDREPPAAANAAA
FT                   SLFECSRIKALADEREAVQKKTFTKWVNSHLARVGCHIGDLYADLRDGFVLTRLLEVLS
FT                   GEQLPRPTRGRMRIHSLENVDKALQFLKEQRVHLENVGSHDIVDGNHRLTLGLVWTIIL
FT                   RFQIQVIKIETEDNRETRSAKDALLLWCQMKTAGYPEVNIQNFTTSWRDGLAFNALIHR
FT                   HRPDLVDLSKLTKSNANYNLQRAFRTAEQHLGLARLLDPEDVNMEAPDEKSIITYVVSF
FT                   YHYFSKMKALAVEGKRIGKVLDQVLEVDKIIERYEELAAELLAWIHRTVDLISNQKFAN
FT                   SLSGVQQQLQAFTAYCTLEKPVKFQEKGNLEVLLFSIQSKLRAHNRRLFVPREGCGIWD
FT                   IDKAWGELEKAEHEREAALRAELIRQEKLELLAQRFDHKVAMRESWLNENQRLVSQDNF
FT                   GYELPAVEAAMKKHEAIEADIAAYEERVQGVAELAQALAAEGYYDARRVAAQRDSVLRQ
FT                   WALLTGLVGARRTRLEQNLALQKVFQEMVYMVDWMEEMQTQLLSRECGQHLVEADDLLQ
FT                   KHGLLEGDIAAQSERVEALNAAALRFSQPCDPQVICNRVNHVHGCLSELQEQAARRRAE
FT                   LEASRSLWALLQELEEAESWARDKERLLEATSGSGGAAGTAGGAHDLSSTARLLAQHKI
FT                   LQGELGGRRALLQQALRRGEELAAAGGSVGPGAEPLHLAGLAERAASARRRWQRLEEAA
FT                   ARRERRLQEARALHQFGADLDGLLDWLRDAYRLAAAGDFGHDEASSRRLARQHRALTGE
FT                   VEAHRGPVGGLRRQLATLGGASGAGPLVVALQVRVVEAEQLFAEVTEVAALRRQWLRDA
FT                   LAVYRMFGEVHACELWIGEKEQWLLAMRVPDSLDDVEVVQHRFESLDQEMNSLMGRVLD
FT                   VNQTVQELVEGGHPSSDEVRSCQDHLNSRWNRIVELVEQRKEEMSAVLLVENHVLEVAE
FT                   VRAQVREKRRAVESAPRAGGALQWRLSGLEAALQALEPRQAALLEEAALLAERFPAQAT
FT                   RLHQGAEELGAEWGALAGAAQACGEAVAAAGRLQRFLRDLDTFLDWLVRAQEAAGAVEG
FT                   PLPRSLEEADGLLARHAALKEEVDQREEDYARIVAASEALLASEGAELGPGLALDEWLP
FT                   HLEVGWHKLLGLWEERREALVQAHVYQLFLRDLCQALAVLRNQEVALSGAELPCTVESV
FT                   EEAMKRHRDFLTTMELNQQKMQVAVQAAESLLRQGNAYGEQAQEAVARLLEKSQENQLR
FT                   AQQWMQKLLDQLVLQHFLRDCHELDGWIHEKMLMARDGTREDSHKLHKRWLRHQAFMAE
FT                   LAQNKEWLEKIEREGQQLMQEKPELAASVRKKLGEIRQCWAELESTTQAKARQLFEASK
FT                   ADQLVQSFAELDKRLLHMESQLQDVDPGGDLATVNSQLKKLQSMESQVEEWCREVGELQ
FT                   AQTAALPLEQASKELVGERQSAVGERLVRLLEPLQERRRLLLASKELHQVAHDLDDELA
FT                   WVQERLPLAMQTERGTGLQAVQQHIKKNQGLRREIQAHGPRLEEVLERAGVLASLRSPE
FT                   AEAVRRGQEQLQSAWTGLREAAERRQQTLDAAFQVEQYYFDVAEVEAWLGEQELLMMSE
FT                   DKGKDEQSTLQLLKKHLQLEQGVENYEESIAQLSRQCRALLEMGHPDSEQISRRQSQVD
FT                   RLYVALKELGEERRVSLEQQYWLYQLSRQVDELEHWIAEKEVVAGSPELGQDFEHVSVL
FT                   QEKFSEFASETGTAGRERLAAVNQMVDELIECGHTAAATMAEWKDGLNEAWAELLELMG
FT                   TRAQLLAASRELHKFFSDARELQGQIEEKRRRLPRLTAPPEPRPSASSMQRTLRAFEHD
FT                   LQLLVSQVRQLQEGAAQLRTVYAGEHAEAIASREQEVLQGWKELLAACEDARLHVSSTA
FT                   DALRFHSQARDLLSWMDGIAGQIGAADKPRDVSSVEVLMNYHQGLKTELEARVPELATC
FT                   QELGRSLLLNKSAMADEIQAQLDKLGSRKEEVSEKWDRHWEWLQQMLEVHQFAQEAVVA
FT                   DAWLTAQEPLLQSRELGSSVDEVEQLIRRHEAFRKAAAAWEERFSSLRRLTTIEKLKAE
FT                   QSKQPPTPLLGRKFFGDPTELAAKAAPLLRPGGYDRGLEPLARRASDTLSAEVRTRVGY
FT                   VRQELKPERLQPRIDRLPETSGKVEPAAPTAAALDTTDTPGTPAATELVRPRSERQELA
FT                   DRAEELPRRRRSERQESVDQPEETARRRRPERQESADHEGPHSLTLGRYEQMERRRERR
FT                   ERRIERQESSEQETPTRGELVKGKATLADIVEQLQEKEAGPGIPAGPSLPQPRELPPGR
FT                   LPNGLEPPERTPRPDRPRARDRPKPRRRPRPREGGEGGGSRRSRSAPAQGGSAPAPPPP
FT                   PTHTVQHEGFLLRKRELDANRKSSNRSWVSLYCVLSKGELGFYKDSKGPASGGTHGGEP
FT                   LLSLHKATSEVASDYKKKKHVFKLQTQDGSEFLLQAKDEEEMNGWLEAVANSVAEHAEI
FT                   ARWGQTLPTTSSTDEGNPKREGGERRASGRRK"
XX
SQ   Sequence 8735 BP; 1772 A; 2453 C; 3079 G; 1431 T; 0 other;
     ggcacgaggg gtacttccct ctaccaaagc gtcctcccaa caagcaagag gggtgtgtgg        60
     ggtgattttg tgcctgtgtg accctcagtg accacaaggg acagcatggt tgtgggcgac       120
     acccggtttc attccttgtg ttgcaatgcc ctgcctcccc caatggcaca agtaccaggg       180
     gaggtggaca acatggaggg cccagcagtc tccaacaaca acaacccttc agctcgctgg       240
     gagagcccag atcggggctg ggatcgggaa cctcccgcag ccgccaatgc tgcggcttca       300
     ctctttgagt gctctcggat caaggcttta gcagatgagc gagaggctgt gcagaagaaa       360
     accttcacca agtgggtgaa ttcgcacctt gcccgcgtgg gctgccacat tggagacctg       420
     tatgcagacc ttcgggacgg gtttgtcctc acccggcttc tggaagtgct gtcgggggag       480
     cagctgccga ggcccactcg cggccgcatg cggatccact cgctggagaa cgtggacaag       540
     gctctgcagt tcctgaagga gcagcgtgtg catctggaga acgtggggtc acatgacatc       600
     gtggatggga accaccgact gacgctgggg ctggtctgga ccatcatcct gcgcttccag       660
     attcaagtca tcaagattga gacagaagac aacagagaga cccgctccgc caaggacgct       720
     ctgctcttgt ggtgccagat gaaaacagcc ggttaccctg aggtaaacat ccagaatttc       780
     accaccagct ggagagatgg cctggccttc aatgccctca ttcaccgtca caggcctgat       840
     cttgtggacc tcagcaaact taccaagtcc aacgccaact acaacctgca gagagctttc       900
     cgcacagccg agcagcacct ggggctagca cgtctgctgg accccgaaga tgtgaacatg       960
     gaggctccag atgagaagtc cattatcacc tatgtggtct ccttctacca ctacttctcc      1020
     aagatgaagg ctctggcggt ggagggaaaa cggattggaa aggtcctgga ccaggtgttg      1080
     gaggtggaca agatcataga acgctatgag gagctggcgg cggagctgtt ggcctggatc      1140
     catcgcactg tggacctcat tagcaaccaa aagtttgcta actcactgag tggggtgcag      1200
     cagcagctgc aggccttcac ggcttactgt acgctggaga agcccgtcaa gtttcaggag      1260
     aaggggaacc tggaggtgct actcttcagc atccaaagca aactgcgcgc ccacaaccgg      1320
     cgcctctttg tgcctcgaga aggctgtggc atctgggata ttgacaaggc gtggggtgag      1380
     ctggagaagg cagagcatga gcgagaggcg gccctcagag ctgagctcat ccggcaggag      1440
     aagttggaac tcttggctca aagatttgac cacaaggtgg ccatgaggga gagctggcta      1500
     aatgagaacc agcgcctggt ctcccaggac aacttcggat atgagctgcc ggcagtggag      1560
     gcagccatga agaagcacga agccattgag gcagacattg cagcctacga ggagcgggtt      1620
     cagggtgtgg cggagttagc ccaggcgttg gcagctgaag gctactatga tgcccggcgg      1680
     gtggctgccc agcgtgacag tgtccttcgc cagtgggccc tgctgaccgg gctggtaggt      1740
     gcccggcgga cccggcttga gcagaatctg gccctgcaga aggtcttcca ggagatggtc      1800
     tacatggtgg actggatgga ggagatgcag actcagctgc tgtctcggga atgtgggcag      1860
     cacctggtgg aggccgatga cctgctgcag aagcacgggc tgctggaggg ggacatcgca      1920
     gcccagagtg agcgagtgga ggccctcaat gctgcagccc tgagattctc ccagccctgc      1980
     gaccctcagg tcatttgcaa ccgtgtgaac cacgtgcatg gctgtctgtc ggagctgcag      2040
     gagcaggcag cacggcggcg cgcagagctg gaagcttctc ggagcctgtg ggcgctgctg      2100
     caggagctgg aggaggcgga gagttgggcg cgggacaagg agcgcctcct agaggccacg      2160
     agcggcagtg gtggcgcggc gggcacggcg ggcggcgcgc acgacctgtc cagcaccgct      2220
     cgcctgctgg cgcagcataa gatcctgcag ggcgagctgg gcggccggcg ggcgctgctg      2280
     cagcaggcgc tgcgacgcgg ggaggagttg gctgcggcgg gcggctccgt gggcccgggc      2340
     gccgagcctt tgcatttggc tggcctggcg gagcgcgcgg ctagcgctcg gcgccgctgg      2400
     cagcggctgg aagaggcggc tgcgcgccgg gaacggcggc tgcaggaggc gcgggcgctg      2460
     caccaatttg gcgccgacct ggacgggctg ctggactggc ttcgtgacgc gtatcgtcta      2520
     gcagccgctg gagattttgg tcacgacgaa gcgtccagcc gtcgcctggc gcgccagcac      2580
     cgcgctctca ccggggaggt ggaagcgcac cgtggccctg tgggtggcct gaggcgccag      2640
     ctggcgacac tgggaggagc cagtggcgca gggccgctgg tggtggctct gcaggtgcgc      2700
     gtggtggaag ccgaacagtt gttcgccgag gtgaccgagg tggccgcgct gcgacgacag      2760
     tggcttcggg acgcgctcgc cgtgtaccgc atgttcggcg aggtacatgc ctgcgagttg      2820
     tggatcgggg agaaagagca gtggctgctg gccatgcgtg tgcccgattc cctcgacgac      2880
     gttgaggtgg tgcagcatcg atttgaaagt cttgaccagg aaatgaacag cctgatgggc      2940
     cgagtcctgg atgtgaacca aacagttcag gagttggtag aaggaggtca tcccagctcc      3000
     gatgaggtgc gctcctgtca ggaccatctc aacagcaggt ggaaccgcat cgtggagttg      3060
     gtggaacagc gcaaagagga gatgagcgcg gtgctgctgg tggagaacca cgtgctggag      3120
     gtggccgagg tgcgcgccca agtgcgcgag aagcgacggg cagtggagag cgcgccccgg      3180
     gcggggggag ccctgcaatg gcgcctgagt ggcctggagg cggctctaca ggcgctagag      3240
     ccgcgacagg cggcgctgct ggaggaggcg gcgctgctgg ccgaacgctt ccccgcacag      3300
     gcgacgcgcc tgcaccaggg cgccgaggag ctaggagccg agtggggcgc actggccgga      3360
     gcggctcagg cctgcggcga ggcggttgcg gcggcaggtc gcctgcagcg tttcctgcgc      3420
     gatttggata ctttcctgga ctggctggtg cgggcgcagg aggcagcagg cgccgtcgag      3480
     gggccgctgc ctcgcagcct ggaggaggcg gatgggctgc tggcgcgcca cgccgcgctc      3540
     aaggaggagg tggatcagcg tgaggaggac tacgcgcgca tcgtggctgc cagtgaagcg      3600
     ctgctagcgt ccgagggcgc ggagctgggc cccggtctgg cgctagacga gtggctgccg      3660
     cacctcgagg ttggctggca caaactgctc ggcttgtggg aggagcgcag ggaggcgctg      3720
     gtccaagcgc acgtctatca actcttcctg agagacctgt gccaggcgct tgcggtgctg      3780
     cgcaaccagg aggtggcgct gtctggcgct gaactccctt gcacagtgga gtcggtagaa      3840
     gaggcgatga aaaggcaccg ggattttctc accacgatgg agctgaacca gcaaaagatg      3900
     caggtggcgg ttcaagctgc agagagcctg ctgcggcaag gcaacgccta cggggagcag      3960
     gcgcaggagg cagtggctcg gctgctagag aagagccaag aaaatcagct gagggcccag      4020
     cagtggatgc aaaaactact ggaccagctt gtgctgcagc actttcttag agattgtcat      4080
     gagctggatg gctggatcca tgagaagatg ctgatggctc gtgatggcac ccgggaagac      4140
     agccacaagc tgcacaagag atggctccgg caccaggcgt tcatggctga gctggctcag      4200
     aataaggagt ggctggagaa gatagaaagg gagggccagc aactgatgca ggagaaaccg      4260
     gagctggcag cctctgtgcg caagaaatta ggtgagatcc ggcagtgctg ggcggagctg      4320
     gagagcacca cacaggccaa ggcgcgccag ctcttcgagg ccagcaaggc ggaccagcta      4380
     gtgcagagct tcgcggagct ggacaagcgg ctgcttcaca tggaaagcca gctgcaagac      4440
     gtagaccccg gtggggacct ggccactgtc aacagccagc tcaagaagtt acagtccatg      4500
     gagtctcagg tggaggagtg gtgccgagag gtgggcgagc ttcaggcgca gacggcggcg      4560
     cttccgctgg agcaggcgag caaggagttg gtgggggagc ggcagagtgc ggtgggcgag      4620
     cgcctggtgc gcctgctgga gcctttgcag gagcgacgcc gcttgttgct ggcatccaag      4680
     gagctgcatc aggtggccca cgacctggac gatgaactgg cttgggttca agagcggctg      4740
     ccactggcca tgcagacaga gcgaggcact ggcttgcagg ctgtccagca gcacatcaaa      4800
     aagaaccagg gcctgcggcg ggagatccag gctcacgggc cgcgcttgga ggaggtgctg      4860
     gagcgcgcgg gcgtgctggc ctcgctgcgc agcccagagg ccgaagcggt gcgccgtggc      4920
     caagagcagc tgcagagcgc ctggaccggg ctgcgggaag cggccgaacg gcggcagcag      4980
     acgctggacg ccgccttcca ggtggaacag tactactttg acgtggctga ggtggaggca      5040
     tggctgggcg agcaggagct gctcatgatg agtgaggaca agggcaagga tgaacagagc      5100
     accctgcagc tgctcaagaa gcatttacaa ctggaacagg gcgtggagaa ctatgaggaa      5160
     agcatcgccc agctgtcacg ccagtgccgg gcgctactgg aaatgggaca cccagacagt      5220
     gagcaaatca gccgccgaca gtcccaagtg gatcgcctct atgtggcgct caaggagctg      5280
     ggcgaggaac gcagggtgag cctggaacag cagtactggc tctaccagct cagccgccag      5340
     gtggatgagc tggaacactg gatagccgag aaggaggtgg tagctggctc cccagagctg      5400
     ggccaggact tcgaacacgt gtcggtgcta caggagaaat tctcagagtt tgccagtgag      5460
     acaggaaccg cagggcggga gcggctggcg gcggtcaacc agatggtgga cgagctgatt      5520
     gagtgtggtc acacagcagc ggccaccatg gctgagtgga aggacgggct gaacgaggcc      5580
     tgggctgagc tgctggaact catgggcact cgggcccagc tgctcgctgc ctctcgggag      5640
     ctgcataagt tcttcagcga tgcccgggag cttcaagggc agattgagga gaagcggagg      5700
     aggctgcccc gcctgacggc accacctgaa cccagaccca gtgccagctc catgcagcgg      5760
     accctgcgag cctttgagca cgacctgcag ctcctcgtgt cccaggtacg gcagctgcag      5820
     gaaggggcgg cccagctgcg gacggtgtac gctggcgagc acgccgaggc catcgccagc      5880
     cgcgagcagg aggtgttgca gggctggaag gagctgctag cagcctgtga agatgctcgt      5940
     ctgcacgtca gctccacggc cgacgccctg cgcttccaca gccaggcccg cgacctgctc      6000
     tcctggatgg acggcatcgc gggccagatc ggggcagctg acaaacccag ggatgtgtca      6060
     tcggtggagg tgcttatgaa ctaccaccag ggcctgaaga cagagttgga ggcgcgcgtg      6120
     cctgagctgg caacctgcca ggagctgggg cggtctctat tactcaacaa aagcgccatg      6180
     gctgatgaga tccaggccca gctggacaag ctgggaagcc ggaaggagga ggtgtcggag      6240
     aagtgggacc gtcactggga gtggctgcag cagatgctgg aggtacacca gtttgctcag      6300
     gaggccgtgg tggctgacgc ctggctgaca gctcaggaac cgctcctgca gagccgggag      6360
     ctgggcagca gtgtggatga ggtggagcag cttatccggc gacacgaggc cttccgaaaa      6420
     gcagctgcgg cctgggagga gaggttcagc tctctgcggc gcttgaccac gatcgagaaa      6480
     ctcaaggcag aacagagtaa gcagccaccc acccccttac tggggcgcaa gttctttggg      6540
     gaccccacag agctggcggc caaggcagcg cctttgctgc gtccaggggg ctatgacagg      6600
     ggcctggagc ctttggcccg cagggcctcg gacacgctgt cagcggaggt gcggacccgg      6660
     gttgggtatg tgcgccagga gctcaagccc gagcgtctcc agccgcgcat tgaccggctg      6720
     ccagagacct cggggaaggt agaacccgcg gccccgacag ccgcagcgtt ggacacgacg      6780
     gacacccctg ggactccggc ggcgacggag ttggtccggc cccggtcgga gcgccaggag      6840
     ttagcggatc gtgcggagga gctgccacgg agacgaagat cagaacgcca ggagtccgtg      6900
     gatcaaccag aggagacagc gcggaggcgg cggcctgagc gccaggagtc cgcggaccac      6960
     gaggggccgc acagccttac tctaggtcgc tacgagcaga tggagagacg gcgggagcgg      7020
     agggagcggc ggatagaacg acaggagtct agcgaacagg agactcccac caggggagag      7080
     ctggtcaaag ggaaggccac tctggctgat attgtggagc aacttcagga gaaagaggca      7140
     ggcccaggga tccctgctgg gccgtcgctg cctcagcctc gcgagcttcc ccctggtcgc      7200
     ctgcccaacg ggcttgagcc gcccgagcgg acacctcggc ccgatcggcc gcgggcacgg      7260
     gaccggccca agccgcgccg gcggccacgg cctcgagagg gtggtgaggg cgggggaagc      7320
     cggcgctcgc gctccgcccc tgcccaggga ggctccgccc ccgcgccgcc acctccgccc      7380
     actcacacag tgcagcacga gggcttcctg ctgcgcaagc gcgagctcga cgctaaccgc      7440
     aagtcgtcca accggtcatg ggtgagcctg tactgtgtgc tcagcaaggg ggagctgggc      7500
     ttctacaagg actccaaagg cccagcatca gggggcacgc atggtgggga accactgctc      7560
     agcctgcaca aagccaccag cgaggtggct agtgactaca agaaaaagaa gcatgtcttc      7620
     aagctccaga cccaggatgg cagtgagttc ttgctccagg ctaaagatga ggaggagatg      7680
     aacggctggc tggaggctgt ggctaactcc gtggcagaac acgccgagat cgcccgatgg      7740
     ggtcagacac tacctaccac atcatccaca gatgagggca accccaagcg tgagggcggg      7800
     gagcgtaggg ccagcgggcg ccggaagtga ttccaggtac cctttccccc accttggagt      7860
     ctgacaagtc tccttgcccc tcctctctgc actgtggaca caaagacaac ttctcatccg      7920
     caagggccgg aatgactgcg gatgtgccac tgtgggcctg aaatagaagg gacttctgca      7980
     ctccaagagg tggtggtagg ggattgctgt ccctatagcc atatctcggt cccttcccgc      8040
     tcgccaaccc caccccaggt gctggggctc cattcttttt atgcaataac tgagcttggt      8100
     ggggccgggc agggagccag ttgagccaag ctccctgccc aatcgtcaga tcctgcccca      8160
     agaagctgga gtggcgaggg atctaggagg tggtgatttg ttggcctcct ctccgcccta      8220
     aggatggaca acgggggcgc tggtgaggtc ccctggacca tccagggtgc tagggggtgg      8280
     ggaggggaca cactccctcc ctgcctttac ctcacttcca atgctgcctt gatctgtctg      8340
     ggaagaggga ggacaggggc ccttagcccc tgtactccgc catctcagag ccatgcggtt      8400
     aattcctgac ttagtttatt tttgcaaaaa cgtagacccc ccctccttcc ccccgccccg      8460
     catccgcgaa ggcttttaat aggaggggag tcaaagttca aaactgtctt cctctctcct      8520
     ccccgattct agctgtaaat gccacttccc gagggggagg gggtgggaaa gccctccccc      8580
     tgcatgcttc tggctggagc acctccctgg gacggaggga atcagggtta caggcaaccc      8640
     ccgtggctgc ttggagacgc tgccaaggca gggggtgcgg ggcggtgtgg caggcgcaca      8700
     ctgtatgtac ctataataaa ccctttggct ttgac                                 8735
//

If you have problems or comments...

PBIL Back to PBIL home page