(data stored in ACNUC32233 zone)

EMBL: AH010690

ID   AH010690; SV 2; linear; genomic DNA; STD; MUS; 19901 BP.
XX
AC   AH010690; AY032691-AY032720;
XX
DT   13-JUN-2016 (Rel. 129, Created)
DT   13-JUN-2016 (Rel. 129, Last updated, Version 1)
XX
DE   Mus musculus strain C57BL/6 beta-spectrin 4 (Spnb4) gene, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-19901
RA   Parkinson N.J., Olsson C.L., Hallows J.L., Kujawa S.G., McKee-Johnson J.,
RA   Noben-Trauth K., Keogh B.P., Tempel B.L.;
RT   "Mutations in bIV-spectrin cause auditory and peripheral neuropathies in
RT   quivering mice";
RL   Unpublished.
XX
RN   [2]
RP   1-19901
RA   Parkinson N.J., Tempel B.L.;
RT   ;
RL   Submitted (17-APR-2001) to the INSDC.
RL   Otolaryngology, Virginia Merrill Bloedel Hearing Research Center,
RL   University of Washington Department of Medicine, Seattle, WA 98195, USA
XX
DR   MD5; 7c15c7bafe7c89628a657e3192410467.
DR   Ensembl-Gn; ENSMUSG00000011751; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000172269; mus_musculus.
XX
CC   On or before Jun 10, 2016 this sequence version replaced
CC   gi:20372318, gi:20372319, gi:20372320, gi:20372321, gi:20372322,
CC   gi:20372323, gi:20372324, gi:20372325, gi:20372326, gi:20372327,
CC   gi:20372328, gi:20372329, gi:20372330, gi:20372331, gi:20372332,
CC   gi:20372333, gi:20372334, gi:20372335, gi:20372336, gi:20372337,
CC   gi:20372338, gi:20372339, gi:20372340, gi:20372341, gi:20372342,
CC   gi:20372343, gi:20372344, gi:20372345, gi:20372346, gi:20372347,
CC   gi:20372317.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..19901
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   gene            <1..>19901
FT                   /gene="Spnb4"
FT   mRNA            join(<1..277,691..877,1214..1365,1746..1919,2251..2342,
FT                   2633..2713,3159..3274,3539..3651,3887..4074,4151..4268,
FT                   4473..4631,4985..5287,5666..5809,6123..7048,7506..7643,
FT                   7901..8651,8943..9145,9432..9522,9866..10012,10310..10573,
FT                   10917..11141,11479..11568,11832..12110,12203..12333,
FT                   12733..12937,13410..13790,14088..14332,14625..14763,
FT                   14871..14955,15603..15799,16080..16699,16947..17016,
FT                   17290..17582,17866..18039,18189..18231,18822..>19901)
FT                   /gene="Spnb4"
FT                   /product="beta-spectrin 4"
FT   exon            <1..277
FT                   /gene="Spnb4"
FT                   /number=1
FT   gap             407..506
FT                   /estimated_length=unknown
FT   exon            691..877
FT                   /gene="Spnb4"
FT                   /number=2
FT   CDS_pept        join(706..877,1214..1365,1746..1919,2251..2342,2633..2713,
FT                   3159..3274,3539..3651,3887..4074,4151..4268,4473..4631,
FT                   4985..5287,5666..5809,6123..7048,7506..7643,7901..8651,
FT                   8943..9145,9432..9522,9866..10012,10310..10573,
FT                   10917..11141,11479..11568,11832..12110,12203..12333,
FT                   12733..12937,13410..13790,14088..14332,14625..14763,
FT                   14871..14955,15603..15799,16080..16699,16947..17016,
FT                   17290..17582,17866..18039,18189..18231,18822..18980)
FT                   /codon_start=1
FT                   /gene="Spnb4"
FT                   /product="beta-spectrin 4"
FT                   /note="bIV-spectrin"
FT                   /db_xref="GOA:Q91ZE6"
FT                   /db_xref="InterPro:IPR001589"
FT                   /db_xref="InterPro:IPR001605"
FT                   /db_xref="InterPro:IPR001715"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="InterPro:IPR002017"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR016343"
FT                   /db_xref="InterPro:IPR018159"
FT                   /db_xref="InterPro:IPR036872"
FT                   /db_xref="InterPro:IPR041681"
FT                   /db_xref="MGI:MGI:1890574"
FT                   /db_xref="UniProtKB/TrEMBL:Q91ZE6"
FT                   /protein_id="AAK49014.1"
FT                   /translation="MAQVPGEVDNMEGPAVSNNNNPSARWESPDRGWDREPPAAANAAA
FT                   SLFECSRIKALADEREAVQKKTFTKWVNSHLARVGCHIGDLYADLRDGFVLTRLLEVLS
FT                   GEQLPRPTRGRMRIHSLENVDKALQFLKEQRVHLENVGSHDIVDGNHRLTLGLVWTIIL
FT                   RFQIQVIKIETEDNRETRSAKDALLLWCQMKTAGYPEVNIQNFTTSWRDGLAFNALIHR
FT                   HRPDLVDLSKLTKSNANYNLQRAFRTAEQHLGLARLLDPEDVNMEAPDEKSIITYVVSF
FT                   YHYFSKMKALAVEGKRIGKVLDQVLEVDKIIERYEELAAELLAWIHRTVDLISNQKFAN
FT                   SLSGVQQQLQAFTAYCTLEKPVKFQEKGNLEVLLFSIQSKLRAHNRRLFVPREGCGIWD
FT                   IDKAWGELEKAEHEREAALRAELIRQEKLELLAQRFDHKVAMRESWLNENQRLVSQDNF
FT                   GYELPAVEAAMKKHEAIEADIAAYEERVQGVAELAQALAAEGYYDARRVAAQRDSVLRQ
FT                   WALLTGLVGARRTRLEQNLALQKVFQEMVYMVDWMEEMQTQLLSRECGQHLVEADDLLQ
FT                   KHGLLEGDIAAQSERVEALNAAALRFSQPCDPQVICNRVNHVHGCLSELQEQAARRRAE
FT                   LEASRSLWALLQELEEAESWARDKERLLEATSGSGGAAGTAGGAHDLSSTARLLAQHKI
FT                   LQGELGGRRALLQQALRRGEELAAAGGSVGPGAEPLHLAGLAERAASARRRWQRLEEAA
FT                   ARRERRLQEARALHQFGADLDGLLDWLRDAYRLAAAGDFGHDEASSRRLARQHRALTGE
FT                   VEAHRGPVGGLRRQLATLGGASGAGPLVVALQVRVVEAEQLFAEVTEVAALRRQWLRDA
FT                   LAVYRMFGEVHACELWIGEKEQWLLAMRVPDSLDDVEVVQHRFESLDQEMNSLMGRVLD
FT                   VNQTVQELVEGGHPSSDEVRSCQDHLNSRWNRIVELVEQRKEEMSAVLLVENHVLEVAE
FT                   VRAQVREKRRAVESAPRAGGALQWRLSGLEAALQALEPRQAALLEEAALLAERFPAQAT
FT                   RLHQGAEELGAEWGALAGAAQACGEAVAAAGRLQRFLRDLDTFLDWLVRAQEAAGAVEG
FT                   PLPRSLEEADGLLARHAALKEEVDQREEDYARIVAASEALLASEGAELGPGLALDEWLP
FT                   HLEVGWHKLLGLWEERREALVQAHVYQLFLRDLCQALAVLRNQEVALSGAELPCTVESV
FT                   EEAMKRHRDFLTTMELNQQKMQVAVQAAESLLRQGNAYGEQAQEAVARLLEKSQENQLR
FT                   AQQWMQKLLDQLVLQHFLRDCHELDGWIHEKMLMARDGTREDSHKLHKRWLRHQAFMAE
FT                   LAQNKEWLEKIEREGQQLMQEKPELAASVRKKLGEIRQCWAELESTTQAKARQLFEASK
FT                   ADQLVQSFAELDKRLLHMESQLQDVDPGGDLATVNSQLKKLQSMESQVEEWCREVGELQ
FT                   AQTAALPLEQASKELVGERQSAVGERLVRLLEPLQERRRLLLASKELHQVAHDLDDELA
FT                   WVQERLPLAMQTERGTGLQAVQQHIKKNQGLRREIQAHGPRLEEVLERAGVLASLRSPE
FT                   AEAVRRGQEQLQSAWTGLREAAERRQQTLDAAFQVEQYYFDVAEVEAWLGEQELLMMSE
FT                   DKGKDEQSTLQLLKKHLQLEQGVENYEESIAQLSRQCRALLEMGHPDSEQISRRQSQVD
FT                   RLYVALKELGEERRVSLEQQYWLYQLSRQVDELEHWIAEKEVVAGSPELGQDFEHVSVL
FT                   QEKFSEFASETGTAGRERLAAVNQMVDELIECGHTAAATMAEWKDGLNEAWAELLELMG
FT                   TRAQLLAASRELHKFFSDARELQGQIEEKRRRLPRLTAPPEPRPSASSMQRTLRAFEHD
FT                   LQLLVSQVRQLQEGAAQLRTVYAGEHAEAIASREQEVLQGWKELLAACEDARLHVSSTA
FT                   DALRFHSQARDLLSWMDGIAGQIGAADKPRDVSSVEVLMNYHQGLKTELEARVPELATC
FT                   QELGRSLLLNKSAMADEIQAQLDKLGSRKEEVSEKWDRHWEWLQQMLEVHQFAQEAVVA
FT                   DAWLTAQEPLLQSRELGSSVDEVEQLIRRHEAFRKAAAAWEERFSSLRRLTTIEKLKAE
FT                   QSKQPPTPLLGRKFFGDPTELAAKAAPLLRPGGYDRGLEPLARRASDTLSAEVRTRVGY
FT                   VRQELKPERLQPRIDRLPETSGKVEPAAPTAAALDTTDTPGTPAATELVRPRSERQELA
FT                   DRAEELPRRRRSERQESVDQPEETARRRRPERQESADHEGPHSLTLGRYEQMERRRERR
FT                   ERRIERQESSEQETPTRGELVKGKATLADIVEQLQEKEAGPGIPAGPSLPQPRELPPGR
FT                   LPNGLEPPERTPRPDRPRARDRPKPRRRPRPREGGEGGGSRRSRSAPAQGGSAPAPPPP
FT                   PTHTVQHEGFLLRKRELDANRKSSNRSWVSLYCVLSKGELGFYKDSKGPASGGTHGGEP
FT                   LLSLHKATSEVASDYKKKKHVFKLQTQDGSEFLLQAKDEEEMNGWLEAVANSVAEHAEI
FT                   ARWGQTLPTTSSTDEGNPKREGGERRASGRRK"
FT   gap             1026..1125
FT                   /estimated_length=unknown
FT   exon            1214..1365
FT                   /gene="Spnb4"
FT                   /number=3
FT   gap             1520..1619
FT                   /estimated_length=unknown
FT   exon            1746..1919
FT                   /gene="Spnb4"
FT                   /number=4
FT   gap             2025..2124
FT                   /estimated_length=unknown
FT   exon            2251..2342
FT                   /gene="Spnb4"
FT                   /number=5
FT   gap             2415..2514
FT                   /estimated_length=unknown
FT   exon            2633..2713
FT                   /gene="Spnb4"
FT                   /number=6
FT   gap             2923..3022
FT                   /estimated_length=unknown
FT   exon            3159..3274
FT                   /gene="Spnb4"
FT                   /number=7
FT   gap             3376..3475
FT                   /estimated_length=unknown
FT   exon            3539..3651
FT                   /gene="Spnb4"
FT                   /number=8
FT   exon            3887..4074
FT                   /gene="Spnb4"
FT                   /number=9
FT   exon            4151..4268
FT                   /gene="Spnb4"
FT                   /number=10
FT   gap             4310..4409
FT                   /estimated_length=unknown
FT   exon            4473..4631
FT                   /gene="Spnb4"
FT                   /number=11
FT   gap             4757..4856
FT                   /estimated_length=unknown
FT   exon            4985..5287
FT                   /gene="Spnb4"
FT                   /number=12
FT   gap             5409..5508
FT                   /estimated_length=unknown
FT   exon            5666..5809
FT                   /gene="Spnb4"
FT                   /number=13
FT   gap             5932..6031
FT                   /estimated_length=unknown
FT   exon            6123..7048
FT                   /gene="Spnb4"
FT                   /number=14
FT   gap             7112..7211
FT                   /estimated_length=unknown
FT   exon            7506..7643
FT                   /gene="Spnb4"
FT                   /number=15
FT   gap             7732..7831
FT                   /estimated_length=unknown
FT   exon            7901..8651
FT                   /gene="Spnb4"
FT                   /number=16
FT   gap             8727..8826
FT                   /estimated_length=unknown
FT   exon            8943..9145
FT                   /gene="Spnb4"
FT                   /number=17
FT   gap             9227..9326
FT                   /estimated_length=unknown
FT   exon            9432..9522
FT                   /gene="Spnb4"
FT                   /number=18
FT   gap             9625..9724
FT                   /estimated_length=unknown
FT   exon            9866..10012
FT                   /gene="Spnb4"
FT                   /number=19
FT   gap             10112..10211
FT                   /estimated_length=unknown
FT   exon            10310..10573
FT                   /gene="Spnb4"
FT                   /number=20
FT   gap             10645..10744
FT                   /estimated_length=unknown
FT   exon            10917..11141
FT                   /gene="Spnb4"
FT                   /number=21
FT   gap             11210..11309
FT                   /estimated_length=unknown
FT   exon            11479..11568
FT                   /gene="Spnb4"
FT                   /number=22
FT   gap             11669..11768
FT                   /estimated_length=unknown
FT   exon            11832..12110
FT                   /gene="Spnb4"
FT                   /number=23
FT   exon            12203..12333
FT                   /gene="Spnb4"
FT                   /number=24
FT   gap             12512..12611
FT                   /estimated_length=unknown
FT   exon            12733..12937
FT                   /gene="Spnb4"
FT                   /number=25
FT   gap             13072..13171
FT                   /estimated_length=unknown
FT   exon            13410..13790
FT                   /gene="Spnb4"
FT                   /number=26
FT   gap             13852..13951
FT                   /estimated_length=unknown
FT   exon            14088..14332
FT                   /gene="Spnb4"
FT                   /number=27
FT   gap             14431..14530
FT                   /estimated_length=unknown
FT   exon            14625..14763
FT                   /gene="Spnb4"
FT                   /number=28
FT   exon            14871..14955
FT                   /gene="Spnb4"
FT                   /number=29
FT   exon            15603..15799
FT                   /gene="Spnb4"
FT                   /number=30
FT   gap             15896..15995
FT                   /estimated_length=unknown
FT   exon            16080..16699
FT                   /gene="Spnb4"
FT                   /number=31
FT   gap             16793..16892
FT                   /estimated_length=unknown
FT   exon            16947..17016
FT                   /gene="Spnb4"
FT                   /number=32
FT   gap             17085..17184
FT                   /estimated_length=unknown
FT   exon            17290..17582
FT                   /gene="Spnb4"
FT                   /number=33
FT   gap             17685..17784
FT                   /estimated_length=unknown
FT   exon            17866..18039
FT                   /gene="Spnb4"
FT                   /number=34
FT   exon            18189..18231
FT                   /gene="Spnb4"
FT                   /number=35
FT   gap             18482..18581
FT                   /estimated_length=unknown
FT   exon            18822..>19901
FT                   /gene="Spnb4"
FT                   /number=36
FT   regulatory      19865..19870
FT                   /gene="Spnb4"
FT                   /regulatory_class="polyA_signal_sequence"
XX
SQ   Sequence 19901 BP; 3619 A; 4557 C; 5472 G; 3351 T; 2902 other;
     gagcagtttg tcacttagcg ctctgcctac tagagacagc cacccttagt gggcggggct        60
     gagcggggcg gggccggccg gggcgttacg cccaccgtgc tctctttgct cacgccccct       120
     tacagacagg ctctgagatg gtacttccct ctaccaaagc gtcctcccaa caagcaagag       180
     gggtgtgtgg ggtgattttg tgcctgtgtg accctcagtg accacaaggg acagcatggt       240
     tgtgggcgac acccggtttc attccttgtg ttgcaatgtg agttgtgtat agagatcatt       300
     aatgttattt ggcgtccatg ggggtgatac tgtgaggggt actcagcctg tgtgatatgg       360
     taagctgtaa tggagtgtga tactttcgga ttgggaaggt ttgggannnn nnnnnnnnnn       420
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnaatt gaactctgga ccttcggaag agcagtcagg       540
     tgctcttacc cactgagcca tctcaccagc ccacaattgg cttttttagt cagattgaga       600
     cagggaacag aatatatggg cactcactgt cagaagtggg tcctctgaac tcagcccgtt       660
     tccctgcact aattttcctc tctcttccag gccctgcctc ccccaatggc acaagtacca       720
     ggggaggtgg acaacatgga gggcccagca gtctccaaca acaacaaccc ttcagctcgc       780
     tgggagagcc cagatcgggg ctgggatcgg gaacctcccg cagccgccaa tgctgcggct       840
     tcactctttg agtgctctcg gatcaaggct ttagcaggta tctggaaaag aggcctggga       900
     gggtggacgg acatggggcg gcgagagcgc acctctccat ggctgggagt caggaggagt       960
     tgctcccagc actggagttc cttgactagc tctaccagtg aacttcccac tgagatgaga      1020
     ctgttnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1080
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnngccag tagaagattg      1140
     gagggtcgtg gggggcgcta gaagcagacg aaggactcct gggaagactg ggctcagtct      1200
     ttgtttcttc cagatgagcg agaggctgtg cagaagaaaa ccttcaccaa gtgggtgaat      1260
     tcgcaccttg cccgcgtggg ctgccacatt ggagacctgt atgcagacct tcgggacggg      1320
     tttgtcctca cccggcttct ggaagtgctg tcgggggagc agctggtgag agggccttga      1380
     tggctggggg aataagggct aatcaggggc ctggctgagg gagaggcaga aagccctaac      1440
     tgtgtgtaaa aggtcccctt attcagtttt gtggggcggg gtctagttga agaggagggc      1500
     tcttacagat gtggtagagn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1560
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnng      1620
     cagagatgat aggactgggt cctgagtctt ggatgagatt gaagggcctt ggcagtgaga      1680
     gaggcagagc cgagggctcc tcgctcttgg ctaggtccca tcactcaatg cccctgctgc      1740
     cctagccgag gcccactcgc ggccgcatgc ggatccactc gctggagaac gtggacaagg      1800
     ctctgcagtt cctgaaggag cagcgtgtgc atctggagaa cgtggggtca catgacatcg      1860
     tggatgggaa ccaccgactg acgctggggc tggtctggac catcatcctg cgcttccagg      1920
     tgacccctca atgacccctg tacagcccgc tgcccactgc ggaggaggca ttaggagggt      1980
     gtcccccccc ctcactcctt cctcccccag attttcctct catgnnnnnn nnnnnnnnnn      2040
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      2100
     nnnnnnnnnn nnnnnnnnnn nnnntcagta caggactatc acggtacgag acagtctgtc      2160
     acagtcctga gtcctgcaag cgtccccttg cactagccac cttcagtagc aggaggggaa      2220
     gtgcttgacc tcatgtttgt ctcttcacag attcaagtca tcaagattga gacagaagac      2280
     aacagagaga cccgctccgc caaggacgct ctgctcttgt ggtgccagat gaaaacagcc      2340
     gggtgagcgc cccctcctca gaggcgggtg ggcctgcgac cttgggcttc ctcccagaac      2400
     aacagcttaa ggagnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      2460
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnntacatt      2520
     gttgagccat cttgccaccc gacacccatt agatagtcac ctttctcttc ttcactcctg      2580
     ttcttctctt ctcactcatc tctgcctctg tttcttcatt ccccataccc agttaccctg      2640
     aggtaaacat ccagaatttc accaccagct ggagagatgg cctggccttc aatgccctca      2700
     ttcaccgtca caggtatcag cctgctctgc cctctaccct cacagtcctg aggccacaca      2760
     cttgtacaca cacacacaca cacacacaca cacacacaca cacacacacg gatgacacag      2820
     aaaacctctc tctgtacctt tactccttca tatacacttg tttcccattg gacacatatt      2880
     tttctcagag gtacacatcc ccacacagac tcttgtcctg tannnnnnnn nnnnnnnnnn      2940
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      3000
     nnnnnnnnnn nnnnnnnnnn nncacacctt tcctccttgc ctccttggct gggttgtgcc      3060
     tctcacctgg gtggggctca ggtcagggtg tcttctcacc tgcttgctca ctggctctgg      3120
     agcctgcctg ctgcctgctg ctctgtgccc ctgcccaggc ctgatcttgt ggacctcagc      3180
     aaacttacca agtccaacgc caactacaac ctgcagagag ctttccgcac agccgagcag      3240
     cacctggggc tagcacgtct gctggacccc gaaggtgagc cccatctggt cccgtctgaa      3300
     tccttcccaa ctccactgtg aaaatacctc catctcccca gaaccacact ggagcccata      3360
     gtcattccaa accccnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      3420
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnntgctt      3480
     tgcctaaggt cacgcagata gtctccaccg tgctccttga ccccccctcc cctaccagat      3540
     gtgaacatgg aggctccaga tgagaagtcc attatcacct atgtggtctc cttctaccac      3600
     tacttctcca agatgaaggc tctggcggtg gagggaaaac ggattggaaa ggtaggaggg      3660
     agcctagggg tggggagggt agagacctta ggaattactc acgggtctag gagataaatc      3720
     tctataccgc tacccagggc cgccagtgcg gtcccctcac ccccccccac ctttacatcg      3780
     gcaccagaca ccaccaccac cccccccccc acacacacac accttggact tggagatttc      3840
     ccccgactct ccggtttttg tttttgttgt ttgtgtgctg ggtcaggtcc tggaccaggt      3900
     gttggaggtg gacaagatca tagaacgcta tgaggagctg gcggcggagc tgttggcctg      3960
     gatccatcgc actgtggacc tcattagcaa ccaaaagttt gctaactcac tgagtggggt      4020
     gcagcagcag ctgcaggcct tcacggctta ctgtacgctg gagaagcccg tcaagtaaga      4080
     ctcggctcag tatcggaggg gtggtgatgg acgtgggaga cgggggaacc ctgaactcat      4140
     gtctcctcag gtttcaggag aaggggaacc tggaggtgct actcttcagc atccaaagca      4200
     aactgcgcgc ccacaaccgg cgcctctttg tgcctcgaga aggctgtggc atctgggata      4260
     ttgacaaggt gagtgaggct ggggacaggg gagagacaag atggcattan nnnnnnnnnn      4320
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      4380
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnng ccaggatcat taaacagggg acagttgctg      4440
     aaatccaagt acctcctctt gtcttcctcc aggcgtgggg tgagctggag aaggcagagc      4500
     atgagcgaga ggcggccctc agagctgagc tcatccggca ggagaagttg gaactcttgg      4560
     ctcaaagatt tgaccacaag gtggccatga gggagagctg gctaaatgag aaccagcgcc      4620
     tggtctccca ggtacacggc tgggcttggc cagngntagg gggtgaggcg gtgaggggtg      4680
     gggggatggg gatgcgaggt ggggggatgg gggtgaggta agggcgtgag ggtgggggtg      4740
     agaagctctc attgtannnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      4800
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnaggg      4860
     taaaggacac tgtaggcttg ctctctgatg atgaggggag aggtcctagg gtcattcggg      4920
     ttcaaagcat caggaggact tgctgaggca gcatggtcag tgtctgtggc ctgcaactgc      4980
     ccaggacaac ttcggatatg agctgccggc agtggaggca gccatgaaga agcacgaagc      5040
     cattgaggca gacattgcag cctacgagga gcgggttcag ggtgtggcgg agttagccca      5100
     ggcgttggca gctgaaggct actatgatgc ccggcgggtg gctgcccagc gtgacagtgt      5160
     ccttcgccag tgggccctgc tgaccgggct ggtaggtgcc cggcggaccc ggcttgagca      5220
     gaatctggcc ctgcagaagg tcttccagga gatggtctac atggtggact ggatggagga      5280
     gatgcaggtg aggaccagat gaggggcctc agagtgcggg ggggtcaggt gtttggggac      5340
     agggaaggat gcagattctg ggttgacacg gaggtagagg tgtgggaggg acgagacaga      5400
     gagataaann nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      5460
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnncc tgagagttgg      5520
     gaacattctg ggagacacag agatgcagga cgatgggcac agggagacca tgacagatga      5580
     aagctgtgtc ctgcagcaaa ggctggggtg gggtggggag aggtaagtgg ccccggacaa      5640
     tgcccagctc actgtctctt gacagactca gctgctgtct cgggaatgtg ggcagcacct      5700
     ggtggaggcc gatgacctgc tgcagaagca cgggctgctg gagggggaca tcgcagccca      5760
     gagtgagcga gtggaggccc tcaatgctgc agccctgaga ttctcccagc tacagggtga      5820
     gtctggagaa tggaggcggt gagtctcatg gtggatgcat gagaggcaaa gaggactcat      5880
     gagagggatg gcacggaagg gaggatggaa cggaagagag aatggaggaa gnnnnnnnnn      5940
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      6000
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nctaagcttg ggatgtctgg gaagcctaat      6060
     gaaaggatgg catgggctgg catctcttcc taccttttcc ttcccctgcc ccaggctatc      6120
     agccctgcga ccctcaggtc atttgcaacc gtgtgaacca cgtgcatggc tgtctgtcgg      6180
     agctgcagga gcaggcagca cggcggcgcg cagagctgga agcttctcgg agcctgtggg      6240
     cgctgctgca ggagctggag gaggcggaga gttgggcgcg ggacaaggag cgcctcctag      6300
     aggccacgag cggcagtggt ggcgcggcgg gcacggcggg cggcgcgcac gacctgtcca      6360
     gcaccgctcg cctgctggcg cagcataaga tcctgcaggg cgagctgggc ggccggcggg      6420
     cgctgctgca gcaggcgctg cgacgcgggg aggagttggc tgcggcgggc ggctccgtgg      6480
     gcccgggcgc cgagcctttg catttggctg gcctggcgga gcgcgcggct agcgctcggc      6540
     gccgctggca gcggctggaa gaggcggctg cgcgccggga acggcggctg caggaggcgc      6600
     gggcgctgca ccaatttggc gccgacctgg acgggctgct ggactggctt cgtgacgcgt      6660
     atcgtctagc agccgctgga gattttggtc acgacgaagc gtccagccgt cgcctggcgc      6720
     gccagcaccg cgctctcacc ggggaggtgg aagcgcaccg tggccctgtg ggtggcctga      6780
     ggcgccagct ggcgacactg ggaggagcca gtggcgcagg gccgctggtg gtggctctgc      6840
     aggtgcgcgt ggtggaagcc gaacagttgt tcgccgaggt gaccgaggtg gccgcgctgc      6900
     gacgacagtg gcttcgggac gcgctcgccg tgtaccgcat gttcggcgag gtacatgcct      6960
     gcgagttgtg gatcggggag aaagagcagt ggctgctggc catgcgtgtg cccgattccc      7020
     tcgacgacgt tgaggtggtg cagcatcggt gagcgcaccc ggggaagccc ccagggcccc      7080
     ttgctcaccc acccaacctc acatgctttg gnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      7140
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      7200
     nnnnnnnnnn nttgggctac atgtgctacc ctgcttcatc accagcagca gcaaagccaa      7260
     accaaaccaa aagcaaaaca gacacaaaac aaagaaaaca aacaactccc tcccaaaaat      7320
     ccagacacag acacaaaaca aacccccccc cccccgcaaa tccaacaaca aaagagtagg      7380
     aaagaaagag agaaaaattc ctgcgaagga acttgagaaa tgtcataaag acctacaact      7440
     aaagaagtga gctggctctt gagagcccag acctctgact tctacaccct cttcctcttc      7500
     tgcagatttg aaagtcttga ccaggaaatg aacagcctga tgggccgagt cctggatgtg      7560
     aaccaaacag ttcaggagtt ggtagaagga ggtcatccca gctccgatga ggtgcgctcc      7620
     tgtcaggacc atctcaacag caggtaggtg ggtcctgggg caggaagttc ctcctgctag      7680
     caccttctct atccatgcac tgtgaaagcc agaggtgtgt gatatcaacc cnnnnnnnnn      7740
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      7800
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn naaacctgga ttttaccctg ggtgtgcgga      7860
     ttctccgcat ccgatcaccc tctttcccgc ccctgaacag gtggaaccgc atcgtggagt      7920
     tggtggaaca gcgcaaagag gagatgagcg cggtgctgct ggtggagaac cacgtgctgg      7980
     aggtggccga ggtgcgcgcc caagtgcgcg agaagcgacg ggcagtggag agcgcgcccc      8040
     gggcgggggg agccctgcaa tggcgcctga gtggcctgga ggcggctcta caggcgctag      8100
     agccgcgaca ggcggcgctg ctggaggagg cggcgctgct ggccgaacgc ttccccgcac      8160
     aggcgacgcg cctgcaccag ggcgccgagg agctaggagc cgagtggggc gcactggccg      8220
     gagcggctca ggcctgcggc gaggcggttg cggcggcagg tcgcctgcag cgtttcctgc      8280
     gcgatttgga tactttcctg gactggctgg tgcgggcgca ggaggcagca ggcgccgtcg      8340
     aggggccgct gcctcgcagc ctggaggagg cggatgggct gctggcgcgc cacgccgcgc      8400
     tcaaggagga ggtggatcag cgtgaggagg actacgcgcg catcgtggct gccagtgaag      8460
     cgctgctagc gtccgagggc gcggagctgg gccccggtct ggcgctagac gagtggctgc      8520
     cgcacctcga ggttggctgg cacaaactgc tcggcttgtg ggaggagcgc agggaggcgc      8580
     tggtccaagc gcacgtctat caactcttcc tgagagacct gtgccaggcg cttgcggtgc      8640
     tgcgcaacca ggtgcctgat ggctgtctgg ggtgcggggt ctgggctgag agggattggg      8700
     tgtgggggca cagacttgct ttgatgnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      8760
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      8820
     nnnnnncaga ctgctaaaaa gaggggccag caggagtaaa agaccctgag gtggaactgt      8880
     gcctgaagcc aaccagcgtc ctggggtgga gccaagctga cctgtatccc ttccgttccc      8940
     aggaggtggc gctgtctggc gctgaactcc cttgcacagt ggagtcggta gaagaggcga      9000
     tgaaaaggca ccgggatttt ctcaccacga tggagctgaa ccagcaaaag atgcaggtgg      9060
     cggttcaagc tgcagagagc ctgctgcggc aaggcaacgc ctacggggag caggcgcagg      9120
     aggcagtggc tcggctgcta gagaagtagg tccccggttc caaaactgtg cccagaaagt      9180
     ggggtctggg caccgtagag tggggaaggg atacccagat ctttctnnnn nnnnnnnnnn      9240
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      9300
     nnnnnnnnnn nnnnnnnnnn nnnnnnccta tcagtgtttc ctaggcttcc cctgtcccct      9360
     gctctattta actcctgcca gcactctcat tccatgcctg agcctctctc cagcctttct      9420
     cttctcctta ggagccaaga aaatcagctg agggcccagc agtggatgca aaaactactg      9480
     gaccagcttg tgctgcagca ctttcttaga gattgtcatg aggtaggccc tccagctgtg      9540
     ctggggacca tagaaaaagg cttgatccct gatggttgga gggactggaa cgccccgtct      9600
     aagtgggtcg aggaacattg ctctnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      9660
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      9720
     nnnntttgca cagatttccc ctcccttcac ttagcccaac tcttatgggc caagagcctg      9780
     aacctgaagt tcttgagggg tgttttgagg ctgtgctaga tggggagagg gtccatcctg      9840
     agccctcttc ctctgccctg cacagctgga tggctggatc catgagaaga tgctgatggc      9900
     tcgtgatggc acccgggaag acagccacaa gctgcacaag agatggctcc ggcaccaggc      9960
     gttcatggct gagctggctc agaataagga gtggctggag aagatagaaa gggtgaggaa     10020
     gatgaagggt cctctgctgt ctgggagaca cactctcact tctgattccc ttactgtcat     10080
     ccttgtgggt tggccatttc tcgactgctt cnnnnnnnnn nnnnnnnnnn nnnnnnnnnn     10140
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn     10200
     nnnnnnnnnn nttgtgtctc tcctgttgtc acggaatctc tgtctgtttc tgttgcccat     10260
     ctcctccttc ctctcctttc cgactccgac cttccatccc tctggccagg agggccagca     10320
     actgatgcag gagaaaccgg agctggcagc ctctgtgcgc aagaaattag gtgagatccg     10380
     gcagtgctgg gcggagctgg agagcaccac acaggccaag gcgcgccagc tcttcgaggc     10440
     cagcaaggcg gaccagctag tgcagagctt cgcggagctg gacaagcggc tgcttcacat     10500
     ggaaagccag ctgcaagacg tagaccccgg tggggacctg gccactgtca acagccagct     10560
     caagaagtta caggtatgat ctactggctg gcctggtgag ggggctcaca tccaaccctc     10620
     tggggtgttt caacctgagg ctgtnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn     10680
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn     10740
     nnnntagggg ttggtaagaa gccctgtgtg ttcatacagg gagagcgcgg tacttcgggg     10800
     gggggggggg ggaggcgtgc aggggagagg taaaggatct gttcacatga gtgcctggtc     10860
     accataagga gcctggaggg agggtgggac cactgaccat gcccctgtct ccacagtcca     10920
     tggagtctca ggtggaggag tggtgccgag aggtgggcga gcttcaggcg cagacggcgg     10980
     cgcttccgct ggagcaggcg agcaaggagt tggtggggga gcggcagagt gcggtgggcg     11040
     agcgcctggt gcgcctgctg gagcctttgc aggagcgacg ccgcttgttg ctggcatcca     11100
     aggagctgca tcaggtggcc cacgacctgg acgatgaact ggtgaggcgg ggcatagggg     11160
     cctgggaccg ggactcgagg atggggcggg atctaaggcc aggaattgan nnnnnnnnnn     11220
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn     11280
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnna aagctaagca ggagtttgcc cctaagagca     11340
     gagagcaggt agtgtgtcac ccaagaggct gcttaggtga gaaagggcac tggtgcacgt     11400
     aaagagttca aaatgcttgt tgggaggcag cagtcctcgg aggcctctct catggaccct     11460
     ctcctgtatt ctctccaggc ttgggttcaa gagcggctgc cactggccat gcagacagag     11520
     cgaggcactg gcttgcaggc tgtccagcag cacatcaaaa agaaccaggt aagctgtgcc     11580
     aggtgaggga atgaggtggg agccatgcgg atgtgagtgc tagagatgaa gtcagttaaa     11640
     taattagcca agtagatggg agagagagnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn     11700
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn     11760
     nnnnnnnnca acctcagagg aactctgggt ggagtctctg atctcctctc cacccgatgt     11820
     ctcattcgca gggcctgcgg cgggagatcc aggctcacgg gccgcgcttg gaggaggtgc     11880
     tggagcgcgc gggcgtgctg gcctcgctgc gcagcccaga ggccgaagcg gtgcgccgtg     11940
     gccaagagca gctgcagagc gcctggaccg ggctgcggga agcggccgaa cggcggcagc     12000
     agacgctgga cgccgccttc caggtggaac agtactactt tgacgtggct gaggtggagg     12060
     catggctggg cgagcaggag ctgctcatga tgagtgagga caagggcaag gtgcgcccag     12120
     aacaggggtt caggggttcg gggacgtcgg agccagaggc cccgtcctct gcgaactcat     12180
     cgcgggcgcc ttgtgcttcc aggatgaaca gagcaccctg cagctgctca agaagcattt     12240
     acaactggaa cagggcgtgg agaactatga ggaaagcatc gcccagctgt cacgccagtg     12300
     ccgggcgcta ctggaaatgg gacacccaga caggtgggtg ggcagggcca aactggatca     12360
     tttcgggggt gggggaaagg gtccatctaa ggctaggatt gagtaaagag taccagagct     12420
     aggcttgatg gaacattcaa atattcccag cactcaggag actgagacag gaggattgct     12480
     gcaaatttga ggccagtgtg gtcaatagag annnnnnnnn nnnnnnnnnn nnnnnnnnnn     12540
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn     12600
     nnnnnnnnnn naaaaagaat taggacccag gcaatgatcc aggaggaaac agtcctggct     12660
     gaggaagggg aggttgtaag tgctcccaga agtctcaggg ggctctctct tatcccccat     12720
     ctccatcatc agtgagcaaa tcagccgccg acagtcccaa gtggatcgcc tctatgtggc     12780
     gctcaaggag ctgggcgagg aacgcagggt gagcctggaa cagcagtact ggctctacca     12840
     gctcagccgc caggtggatg agctggaaca ctggatagcc gagaaggagg tggtagctgg     12900
     ctccccagag ctgggccagg acttcgaaca cgtgtcggtg aggattctta taatgctctg     12960
     ctgtcttagt tacttttctg ttgggatggc aaaacactgg aaccaaggca actaatgaaa     13020
     gacagtgttt aattgaactt agagtttcag agggttagag ttcatgacag annnnnnnnn     13080
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn     13140
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nccgggcatg gtatactcaa tgcctagcat     13200
     ggtattagtt attaatacta tatatcatat atattaagca tttattatat tgttgctata     13260
     aaatggtcaa gaactatcag atattatttt gttataatga cgattattat catcatttgt     13320
     atctgtcaca tggtaacagg ttggaggagg ctaggcacgg tcaccctctt tccggtcttt     13380
     tctcacccca cctcatgtct cgatcccagg tgctacagga gaaattctca gagtttgcca     13440
     gtgagacagg aaccgcaggg cgggagcggc tggcggcggt caaccagatg gtggacgagc     13500
     tgattgagtg tggtcacaca gcagcggcca ccatggctga gtggaaggac gggctgaacg     13560
     aggcctgggc tgagctgctg gaactcatgg gcactcgggc ccagctgctc gctgcctctc     13620
     gggagctgca taagttcttc agcgatgccc gggagcttca agggcagatt gaggagaagc     13680
     ggaggaggct gccccgcctg acggcaccac ctgaacccag acccagtgcc agctccatgc     13740
     agcggaccct gcgagccttt gagcacgacc tgcagctcct cgtgtcccag gtgaggtggt     13800
     gagtgggagg gcctgactat gtggctggga gggcagacaa cagctgtgta gnnnnnnnnn     13860
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn     13920
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nacctctgaa gtggggaaag agggagggtc     13980
     cacaggtgat ggaggaggaa aggatggagg ttgagtcaag taagatgaat aggagggtgg     14040
     agcctgtgcc cgcgctggac cagcgcagga cctggcttgt ctctcaggta cggcagctgc     14100
     aggaaggggc ggcccagctg cggacggtgt acgctggcga gcacgccgag gccatcgcca     14160
     gccgcgagca ggaggtgttg cagggctgga aggagctgct agcagcctgt gaagatgctc     14220
     gtctgcacgt cagctccacg gccgacgccc tgcgcttcca cagccaggcc cgcgacctgc     14280
     tctcctggat ggacggcatc gcgggccaga tcggggcagc tgacaaaccc aggtgctcct     14340
     taacctactt ccagatcccc aacaaggggc cttcgcgaca ggaaccgcga aggggctgac     14400
     agcccccctg ccatgtgctg ttctggatgc nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn     14460
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn     14520
     nnnnnnnnnn gtgtcgagga tttgtgttcg gcaggagttg catctgaggg tcaggccgag     14580
     ggtatctgca tgcagcttag atccctgtcc cctgcccact gcagggatgt gtcatcggtg     14640
     gaggtgctta tgaactacca ccagggcctg aagacagagt tggaggcgcg cgtgcctgag     14700
     ctggcaacct gccaggagct ggggcggtct ctattactca acaaaagcgc catggctgat     14760
     gaggtggggg agacacaagg cgggggtggg gggtgagggc aggtccatct ctgctccttc     14820
     cttttgcata cctggtacct agctcaccca cccacgcatg gcattcccag atccaggccc     14880
     agctggacaa gctgggaagc cggaaggagg aggtgtcgga gaagtgggac cgtcactggg     14940
     agtggctgca gcagagtgag taagggccta gacaaggcac atcggggaca caggaggcat     15000
     atttcagaat gtctagccaa gggcagaggg gtcacaggtg acgtgagcat gctttgctca     15060
     ccaactttgg gtctccaaag ccaaacatga gggtggatca ctgaagggga gaggggtgtt     15120
     ggtatcttta gaaacatccc cagagactgg gggtgtggcc tacagagact gggggtgtgg     15180
     cctaggtgat cgagtgcttg cttgcatgca cgaagcccgg ggtcccatat ctacagcctc     15240
     gtaaaactga atgtggtggc ccattcctgt tgtcccatga caccctgttt caaagaaaca     15300
     gcatagcccc tgttcctaca gtagagagat tgctcagtga gaaaagtcgc ttgctgccaa     15360
     gtttgatgat ctgagtttga ttcccgggac ctccttagtg aaaggggaga cctggatccc     15420
     acataactgt cctcatacac acacaataag ttcaatgtat atttaaatag cctagtctcc     15480
     attactccta aggctggact gggagtagcc caggggcatg ggaggctaga gaaaccatag     15540
     ccctcaccct ggggaaagac ctcaggctct cctagtgcct catctcacgt gcctgccccc     15600
     agtgctggag gtacaccagt ttgctcagga ggccgtggtg gctgacgcct ggctgacagc     15660
     tcaggaaccg ctcctgcaga gccgggagct gggcagcagt gtggatgagg tggagcagct     15720
     tatccggcga cacgaggcct tccgaaaagc agctgcggcc tgggaggaga ggttcagctc     15780
     tctgcggcgc ttgaccacgg tcagacccca gatccccgct tcccacccac cgtcctacta     15840
     tatagaaatc tctcactgac agcagctctg agtgcccaga gctttgggca gaattnnnnn     15900
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn     15960
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnctaag ttgagcagag aaggggaacg     16020
     cccagcacct tcgcgaaccg ttctctcacc ccaacctgac ctgacctttc tactcccaga     16080
     tcgagaaact caaggcagaa cagagtaagc agccacccac ccccttactg gggcgcaagt     16140
     tctttgggga ccccacagag ctggcggcca aggcagcgcc tttgctgcgt ccagggggct     16200
     atgacagggg cctggagcct ttggcccgca gggcctcgga cacgctgtca gcggaggtgc     16260
     ggacccgggt tgggtatgtg cgccaggagc tcaagcccga gcgtctccag ccgcgcattg     16320
     accggctgcc agagacctcg gggaaggtag aacccgcggc cccgacagcc gcagcgttgg     16380
     acacgacgga cacccctggg actccggcgg cgacggagtt ggtccggccc cggtcggagc     16440
     gccaggagtt agcggatcgt gcggaggagc tgccacggag acgaagatca gaacgccagg     16500
     agtccgtgga tcaaccagag gagacagcgc ggaggcggcg gcctgagcgc caggagtccg     16560
     cggaccacga ggggccgcac agccttactc taggtcgcta cgagcagatg gagagacggc     16620
     gggagcggag ggagcggcgg atagaacgac aggagtctag cgaacaggag actcccacca     16680
     ggggagagct ggtcaaaggg taaggacctc tgtgaccagg atgttcgaga aggggaaagc     16740
     ggaggcagag gccagagggc cagggtcagc gagggaaaca gccttatcac ctnnnnnnnn     16800
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn     16860
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nncagagcag tagcaaaagg cccagaatct     16920
     cacttctttt gtctcttctt ctccaggaag gccactctgg ctgatattgt ggagcaactt     16980
     caggagaaag aggcaggccc agggatccct gctggggtgg taagttgaac aactgggatg     17040
     ggtgggtgta gaagccctct tagtggccag gatttcagag gcaannnnnn nnnnnnnnnn     17100
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn     17160
     nnnnnnnnnn nnnnnnnnnn nnnnccctaa agacgcatag gaccccaggc cctcgggctc     17220
     cctgagacag gatgctcccc ctagtcatca tgcacagtac ccctctcccc cctcccttca     17280
     ttcacacagc cgtcgctgcc tcagcctcgc gagcttcccc ctggtcgcct gcccaacggg     17340
     cttgagccgc ccgagcggac acctcggccc gatcggccgc gggcacggga ccggcccaag     17400
     ccgcgccggc ggccacggcc tcgagagggt ggtgagggcg ggggaagccg gcgctcgcgc     17460
     tccgcccctg cccagggagg ctccgccccc gcgccgccac ctccgcccac tcacacagtg     17520
     cagcacgagg gcttcctgct gcgcaagcgc gagctcgacg ctaaccgcaa gtcgtccaac     17580
     cggtgagcgc gtgggcgggg ctttggatgg cttgggcgcc tgctctgggt atttaatgaa     17640
     tgagtagctg ggctggagga ggggcgggac tcaagttcaa agctnnnnnn nnnnnnnnnn     17700
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn     17760
     nnnnnnnnnn nnnnnnnnnn nnnnggtgca aagtagcatg acccagcata cgctttgtga     17820
     tggtaatgat gtagccctgc cttcatcacc atctcatcac cccaggtcat gggtgagcct     17880
     gtactgtgtg ctcagcaagg gggagctggg cttctacaag gactccaaag gcccagcatc     17940
     agggggcacg catggtgggg aaccactgct cagcctgcac aaagccacca gcgaggtggc     18000
     tagtgactac aagaaaaaga agcatgtctt caagctccag tgagtccctc cctccctcgg     18060
     gaagaaggga ggggtcccat cgtcgcttcc tttcctcctt gtatacgctt ggttcccatg     18120
     aaagacgatg ggtgatgggg agaggggttg ggttcctcaa gatacctgaa gtcctgtgtc     18180
     tcctgcagga cccaggatgg cagtgagttc ttgctccagg ctaaagatga ggtaagatct     18240
     gatcctctca tcccacaggt tgaccttagc ttagtggctt agctcccagg gtggttcctg     18300
     aatcaaaata acgggactat agaaggaacc acacaggttg gacctgtcag ggttgtaaca     18360
     ggaaagcagt gagagccccg aggagcttaa ggagtcgggg gtcatgggga gggattcagg     18420
     gcaggtgctt gctagccatg ataactaggt ctgtcttctt tgccatggta actcagaagg     18480
     cnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn     18540
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nagtacttca tttgcattgt     18600
     ttctctctgc ttgtggaggt ggtctctgct ttatagataa tcctattggt tctgtttaag     18660
     ggggtgcatc cacagaagtg cttagagagg agtctggggc atgtaactgt tcttttatcc     18720
     ttactgtcag cattatcctg ctaacaggaa agtgaagcta gggagggcgg tgtggttgag     18780
     ttcctcttcc aaatatggac ttgtcctgcg tcttccgtca ggaggagatg aacggctggc     18840
     tggaggctgt ggctaactcc gtggcagaac acgccgagat cgcccgatgg ggtcagacac     18900
     tacctaccac atcatccaca gatgagggca accccaagcg tgagggcggg gagcgtaggg     18960
     ccagcgggcg ccggaagtga ttccaggtac cctttccccc accttggagt ctgacaagtc     19020
     tccttgcccc tcctctctgc actgtggaca caaagacaac ttctcatccg caagggccgg     19080
     aatgactgcg gatgtgccac tgtgggcctg aaatagaagg gacttctgca ctccaagagg     19140
     tggtggtagg ggattgctgt ccctatagcc atatctcggt cccttcccgc tcgccaaccc     19200
     caccccaggt gctggggctc cattcttttt atgcaataac tgagcttggt ggggccgggc     19260
     agggagccag ttgagccaag ctccctgccc aatcgtcaga tcctgcccca agaagctgga     19320
     gtggcgaggg atctaggagg tggtgatttg ttggcctcct ctccgcccta aggatggaca     19380
     acgggggcgc tggtgaggtc ccctggacca tccagggtgc tagggggtgg ggaggggaca     19440
     cactccctcc ctgcctttac ctcacttcca atgctgcctt gatctgtctg ggaagaggga     19500
     ggacaggggc ccttagcccc tgtactccgc catctcagag ccatgcggtt aattcctgac     19560
     ttagtttatt tttgcaaaaa cgtagacccc ccctccttcc ccccgccccg catccgcgaa     19620
     ggcttttaat aggaggggag tcaaagttca aaactgtctt cctctctcct ccccgattct     19680
     agctgtaaat gccacttccc gagggggagg gggtgggaaa gccctccccc tgcatgcttc     19740
     tggctggagc acctccctgg gacggaggga atcagggtta caggcaaccc ccgtggctgc     19800
     ttggagacgc tgccaaggca gggggtgcgg ggcggtgtgg caggcgcaca ctgtatgtac     19860
     ctataataaa ccctttggct ttgacagtct tcgctggttt g                         19901
//

If you have problems or comments...

PBIL Back to PBIL home page