(data stored in ACNUC3759 zone)

EMBL: AY032734

ID   AY032734; SV 1; linear; mRNA; STD; ROD; 3411 BP.
XX
AC   AY032734;
XX
DT   15-MAY-2001 (Rel. 67, Created)
DT   16-APR-2005 (Rel. 83, Last updated, Version 2)
XX
DE   Rattus norvegicus GATA2 (Gata2) mRNA, complete cds.
XX
KW   .
XX
OS   Rattus norvegicus (Norway rat)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Rattus.
XX
RN   [1]
RP   1-3411
RA   Itoh T., Itoh A., Pleasure D.;
RT   ;
RL   Submitted (17-APR-2001) to the INSDC.
RL   Neurology Research, The Children's Hospital of Philadelphia, Abramson
RL   Research Center, Room 516 I, 3517 Civic Center Boulevard, Philadelphia, PA
RL   19104, USA
XX
DR   MD5; f0344b4092857e2184e61ff3dee96a64.
DR   Ensembl-Gn; ENSRNOG00000012347; rattus_norvegicus.
DR   Ensembl-Tr; ENSRNOT00000017240; rattus_norvegicus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3411
FT                   /organism="Rattus norvegicus"
FT                   /strain="Sprague-Dawley"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:10116"
FT   CDS_pept        444..1886
FT                   /codon_start=1
FT                   /gene="Gata2"
FT                   /product="GATA2"
FT                   /db_xref="GOA:Q924Y4"
FT                   /db_xref="InterPro:IPR000679"
FT                   /db_xref="InterPro:IPR013088"
FT                   /db_xref="InterPro:IPR016374"
FT                   /db_xref="InterPro:IPR029522"
FT                   /db_xref="InterPro:IPR039355"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q924Y4"
FT                   /protein_id="AAK51128.1"
FT                   /translation="MEVAPEQPRWMAHPAVLNAQHPDSHHPGLAHNYMEPAQLLPPDEV
FT                   DVFFNHLDSQGNPYYANPAHARARVSYSPAHARLTGGQMCRPHLLHSPGLPWLDGGKAA
FT                   LSAAAAHHHSPWTVSPFSKTPLHPSAAGAPGGPLSVYPGAAGGSGGGSGSSVASLTPTA
FT                   AHSGSHLFGFPPTPPKEVSPDPSTTGAASPASPSAGGSVARGEDKDGVKYQVSLSESMK
FT                   MEGGSPLRPGLAPMGTQPATHHPIPTYPSYVPASAHEYGSGLFHPGGFLGGPASSFTPK
FT                   QRSKARSCSEGRECVNCGATATPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLS
FT                   AARRAGTCCANCQTTTTTLWRRNANGDPVCNACGLYYKLHNVNRPLTMKKEGIQTRNRK
FT                   MSSKSKKSKKGAECFEELSKCMQEKSSPFSAAALAGHMAPVGHLPPFSHSGHILPTPTP
FT                   IHPSSSLSFGHPHPSSMVTAMG"
XX
SQ   Sequence 3411 BP; 753 A; 1018 C; 925 G; 715 T; 0 other;
     agagaggtcc caatctcgag actcgtgctg tccagccgat cctaccagcc ccttgcacag        60
     ccagccctga taggaggaca gagggtttgg ggagtcagta ggacttgggc tgaccgtggt       120
     ccgtagcagg ggaggtgggt ctccgcccga gagtgaaaaa tctgtggtac cagcagagag       180
     atacccagaa ggagtcggca gctggcgcca gggcggccgg aggatgcaga ggggccggag       240
     ccgggcgggc cggaggccga gacgcgcgct gtcccccacc tctatcccgt gaatccgcca       300
     gccttgggac gcgctgtcgc tgggcccgcc gtacccgggc tctcctggtg tcccttactc       360
     tctactgctg agccctcccc ttcccgcgcc gctgcgagtg gtcgccccac cttcgcctgg       420
     atcccaagcc gcagtagtgg accatggagg tggcgcctga gcagcctcgc tggatggcgc       480
     accccgccgt attgaatgcg cagcaccccg actcgcacca tccgggcctg gcacacaact       540
     acatggagcc ggcacagctg ctgcctccgg acgaggtgga tgtcttcttc aaccacctcg       600
     actcgcaggg caacccctac tacgccaacc cagcccacgc gcgcgcgcgc gtttcctaca       660
     gtccagcgca tgcccgtctc acaggaggcc agatgtgccg accacacttg ttgcacagcc       720
     caggcttgcc atggctggac gggggcaaag cagctctctc tgccgctgct gcccatcacc       780
     acagcccctg gaccgtcagc ccgttctcca agaccccgct gcacccctca gctgctggag       840
     cacctggagg gcctctgtct gtgtacccag gggctgcggg tgggagcggt ggaggcagcg       900
     ggagctccgt agcctccctc acccccactg cagcccactc aggctcccat ctcttcggct       960
     tcccacccac gccacccaaa gaagtgtctc cagaccccag caccacagga gctgcttccc      1020
     cagcctcacc ttcagcaggg ggtagtgtag cccggggtga ggacaaggat ggcgtcaagt      1080
     atcaagtgtc actgtctgag agcatgaaga tggaaggtgg cagtcccctg cgcccgggcc      1140
     tagctcccat gggcacccag cctgcaacac accacccaat acccacctat ccctcctatg      1200
     tgcctgcctc agctcatgaa tatggcagcg ggctcttcca tcccggaggc ttcctgggtg      1260
     gcccagcctc cagcttcacc cctaagcagc gaagcaaggc tcgctcctgc tcagaaggcc      1320
     gggagtgtgt caactgcggg gccacagcca cccctctctg gcgacgggat ggcacgggcc      1380
     actacctgtg caatgcctgt gggctctacc acaagatgaa tggacagaat cggccgctca      1440
     tcaagcccaa gaggagactg tctgctgcca ggagagcggg cacctgttgt gcaaattgtc      1500
     agacgacaac caccacctta tggcgccgga acgccaacgg ggaccctgtg tgcaacgcct      1560
     gtggcctcta ctacaagctg cacaatgtta acaggccact gaccatgaag aaggaaggga      1620
     tccagacccg gaatcggaag atgtccagca aatccaagaa gagcaagaaa ggagccgaat      1680
     gctttgagga gctatccaag tgcatgcagg agaagtcatc ccccttcagt gcggctgccc      1740
     tggctggaca catggcacct gtgggacacc tcccaccttt tagtcactct ggacacatcc      1800
     tacctacgcc aacgcctatc cacccctcct ccagtctctc ctttggtcac ccccacccgt      1860
     ccagcatggt gactgccatg ggctaggcac agcctccggc tggacagaca tggacatcaa      1920
     gggtggttgg cagaaccaga gcgaggctgg gcactccccg gatgggtgga acgtactctt      1980
     ggctcctgcc catcccaaga gacccacttc ctcctgccag cctagtctgg ctgaagccac      2040
     ctctccttgg aggactccca gccttgtgcc gccattactg tgaatatttc taagtgggct      2100
     gcagcttgtg tgtgccctgg gtgctgccca gaagtgtttt cacggacagt gtttgtttgg      2160
     agagcaaaat ggacaggttt acagatttat agcaagagga ggagactagg gatagaaaaa      2220
     tgaaactttt ttttcttttt tttttttttg aaggagaaag gagtaggcaa aaaaatattt      2280
     attttgctct tatttcttac aagaacgtga agacacagag gcatgggctg tttgtgttct      2340
     ctgggtcctt ccttgggacc tactgccacc agtcagggct cttgggggca gcttacaggt      2400
     cctcaggctg agcctgctcc tccccagcct gccgggaggg tagcccttgc cctgacgcag      2460
     ccccagaggg cagagacaat tgcaggcggt cctgtgcgga ttcccaggcc agggctgggt      2520
     cacaggaagg aagcattctc tggaaagggg aaatgtctcc cagatcattc ccctggcttc      2580
     cagaggccaa aactggtgtg acccaaatgg gccaagctgt agcctgtgct ctaggccagt      2640
     tggacccctg taaatacatc cttttttttc tgctaaaccc ctcaaccccc tcccactcta      2700
     agataaataa gaaaatactc aaatcaaaaa ccaaactgca taagcttaac ccgctgatga      2760
     gtggttttac tttgaaactc gttttgggtc cagtccgttg tacgtcgcca cagaagccac      2820
     accatgaaaa agaataaaac cttaaaaaac aaaacaaaac aaaacaaaac cagggccaag      2880
     cttcacagtt ctttaaatgg ttcttgggtt ccacggccct agcaggagac tggggacaag      2940
     gggcaatctt ctgctcttgg tttctggggg gacagggcgt gggcaggcag tggccctgtg      3000
     gtcccaggct tctgttctgc ggtagccggc tggatccttc aaggtacagc tgtacataaa      3060
     aatgtgtccc aagcttcgat tctgtgtgcg gtggtggcag tggtgcagca gccggcacgg      3120
     ggccccgagc ccagggagac gattgtgcgg actagtcaac caagtgcaat atcggtgccc      3180
     actgctgcag agcgccccaa cagaaagtaa cttattttgt gctagtaccc gcctaagaaa      3240
     agaatcggca gtattttctg tttttatgtt ttgggcttgt tttattttgg attagtgacc      3300
     taagttattg ttaactgtgt acaacattta aatattgtct gtaaaaattg tatgctaccc      3360
     tcttattcct ttaaagtgaa tactgttaaa agtaataaaa tactttttgt g               3411
//

If you have problems or comments...

PBIL Back to PBIL home page