(data stored in ACNUC21562 zone)

EMBL: AY042194

ID   AY042194; SV 1; linear; mRNA; STD; MUS; 1503 BP.
XX
AC   AY042194;
XX
DT   11-SEP-2001 (Rel. 69, Created)
DT   29-NOV-2004 (Rel. 81, Last updated, Version 3)
XX
DE   Mus musculus RF-amide G protein-coupled receptor (MrgA4) mRNA, complete
DE   cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1503
RX   DOI; 10.1016/S0092-8674(01)00483-4.
RX   PUBMED; 11551509.
RA   Dong X., Han S., Zylka M.J., Simon M.I., Anderson D.J.;
RT   "A diverse family of GPCRs expressed in specific subsets of nociceptive
RT   sensory neurons";
RL   Cell 106(5):619-632(2001).
XX
RN   [2]
RP   1-1503
RA   Dong X., Han S.-K., Zylka M.J., Simon M.I., Anderson D.J.;
RT   ;
RL   Submitted (19-JUN-2001) to the INSDC.
RL   Division of Biology, 216-76, California Institute of Technology, 1201 E.
RL   California Blvd., Pasadena, CA 91125, USA
XX
DR   MD5; 620a96b43289003f5511202e0c86d03f.
DR   Ensembl-Gn; ENSMUSG00000067173; mus_musculus.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032769; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032786; mus_musculus_nzohlltj.
DR   Ensembl-Tr; ENSMUST00000087092; mus_musculus.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0084577; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0084853; mus_musculus_nzohlltj.
DR   EuropePMC; PMC403691; 14525927.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1503
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6"
FT                   /mol_type="mRNA"
FT                   /tissue_type="dorsal root ganglia"
FT                   /db_xref="taxon:10090"
FT   CDS_pept        446..1387
FT                   /codon_start=1
FT                   /gene="MrgA4"
FT                   /product="RF-amide G protein-coupled receptor"
FT                   /note="Mas-related gene A4"
FT                   /db_xref="GOA:Q91WW2"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="InterPro:IPR026233"
FT                   /db_xref="InterPro:IPR026234"
FT                   /db_xref="MGI:MGI:3033100"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q91WW2"
FT                   /protein_id="AAK91790.1"
FT                   /translation="MAPTTTNPMNETIPGSIDIETLIPNLMIIIFGLVGLTGNVILFWL
FT                   LGFHLHRNAFLVYILNLALADFLFLLCHIINSTMLLLKVHLPNNILNHCFDIIMTVLYI
FT                   TGLSMLSAISTERCLSVLCPIWYRCRRPEHTSTVLCAVIWFLPLLICILNGYFCHFFGP
FT                   KYVIDSVCLATNFFIRTYPMFLFIVLCLSTLALLARLFCGGGKTKFTRLFVTIMLTVLV
FT                   FLLCGLPLGFFWFLVPWINRDFSVLDYILFQTSLVLTSVNSCANPIIYFFVGSFRHRLK
FT                   HKTLKMVLQSALQDTPETPENMVEMSRSKAEP"
XX
SQ   Sequence 1503 BP; 383 A; 367 C; 335 G; 418 T; 0 other;
     tgaactccta gggactaagc catcaacaaa agagtacaca tggctccaga tgcatatgtt        60
     gcagaggatg gccatatcat gcattgatgg aagaggtcct tgaacctatg aaggttctat       120
     tgatgcccca gtgtaaggga atcgagggca gagaggtgga agtgggtgtg tgggttgagc       180
     aacaccctca cagaagcagg gggagggagg atgagatggg ggtttccagg aaggggggaa       240
     gcaggaaagg ggataacatt ttaaatttaa atatagaaaa tatccaatac aaaacatttt       300
     gaacaaacaa caaaaaactc acaaaaacaa caacaacaaa aaaaagaaat taaaagttgt       360
     gttcatagtg aaggcctcat ttcttctttg tgttcccagc aacaccagtg cagggtttct       420
     ggccctaaac acctcagcct cggcaatggc acccacaaca acaaatccaa tgaacgaaac       480
     catccctgga agtattgaca tcgagaccct gatcccaaac ttgatgatca tcatcttcgg       540
     actggtcggg ctgacaggaa atgtcatttt gttttggctc ctgggcttcc acttgcacag       600
     gaatgccttc ttagtctaca tcctaaactt ggccctggct gacttcctct tccttctctg       660
     tcacatcata aattccacaa tgcttcttct caaggttcac ctacccaaca atattttgaa       720
     ccattgcttt gacatcatca tgacagttct ctacatcaca ggcctgagca tgctcagtgc       780
     catcagcact gagcgctgcc tgtctgtcct gtgccccatc tggtatcggt gccgccgccc       840
     agaacacaca tcaactgtcc tgtgtgctgt gatctggttc ctgcccctgt tgatctgcat       900
     tctgaatgga tatttctgtc atttctttgg tcccaaatat gtaattgact ctgtgtgtct       960
     ggcaacgaac ttctttatca gaacataccc gatgtttttg tttatagtcc tctgtctgtc      1020
     caccctggct ctgctggcca ggttgttctg tggtggtggg aagacgaaat ttaccagatt      1080
     attcgtgacc atcatgctga ccgttttggt ttttcttctc tgtgggttgc ccctgggctt      1140
     cttctggttt ctggtgccgt ggattaaccg tgatttcagt gtactagatt atatactttt      1200
     tcagacatca cttgtcctaa cttctgttaa cagctgtgcc aaccccatca tttacttctt      1260
     tgtgggctcc ttcaggcatc ggttgaagca caagaccctc aaaatggttc tccagagtgc      1320
     attgcaggac actcctgaga cacctgaaaa catggtggag atgtcaagaa gcaaagcaga      1380
     gccgtgatga agagcctcta cctggacctc agaggtggct ttggattgag cactgccctg      1440
     ctgcacttga ccactgtcca ctctcctctc agcttactga ctttggatgc ctcagtggtc      1500
     caa                                                                    1503
//

If you have problems or comments...

PBIL Back to PBIL home page