(data stored in ACNUC21562 zone)

EMBL: AY042200

ID   AY042200; SV 1; linear; genomic DNA; STD; MUS; 1300 BP.
XX
AC   AY042200;
XX
DT   11-SEP-2001 (Rel. 69, Created)
DT   29-NOV-2004 (Rel. 81, Last updated, Version 3)
XX
DE   Mus musculus G protein-coupled receptor (MrgB2) gene, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-1300
RX   DOI; 10.1016/S0092-8674(01)00483-4.
RX   PUBMED; 11551509.
RA   Dong X., Han S., Zylka M.J., Simon M.I., Anderson D.J.;
RT   "A diverse family of GPCRs expressed in specific subsets of nociceptive
RT   sensory neurons";
RL   Cell 106(5):619-632(2001).
XX
RN   [2]
RP   1-1300
RA   Dong X., Han S.-K., Zylka M.J., Simon M.I., Anderson D.J.;
RT   ;
RL   Submitted (19-JUN-2001) to the INSDC.
RL   Division of Biology, 216-76, California Institute of Technology, 1201 E.
RL   California Blvd., Pasadena, CA 91125, USA
XX
DR   MD5; 9dfb7569076f576cecdbbd2c1afc73c0.
DR   Ensembl-Gn; ENSMUSG00000050425; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0032292; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0032271; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0032207; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0032283; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0031996; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0032776; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0031324; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0031961; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0032118; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0032072; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0032199; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0032109; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0032793; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0031044; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0031442; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000052730; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0084043; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0084116; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0084066; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0084091; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0083661; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0084587; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0084173; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0083602; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0083788; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0083644; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0083807; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0083695; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0084863; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0083589; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0082715; mus_musculus_wsbeij.
DR   EuropePMC; PMC403691; 14525927.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1300
FT                   /organism="Mus musculus"
FT                   /strain="C57BL/6"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:10090"
FT   mRNA            <13..>1029
FT                   /gene="MrgB2"
FT                   /product="G protein-coupled receptor"
FT   CDS_pept        13..1029
FT                   /codon_start=1
FT                   /gene="MrgB2"
FT                   /product="G protein-coupled receptor"
FT                   /note="Mas-related gene B2"
FT                   /db_xref="GOA:Q3KNA1"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="InterPro:IPR026234"
FT                   /db_xref="MGI:MGI:2441674"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3KNA1"
FT                   /protein_id="AAK91796.1"
FT                   /translation="MSGDFLIKNLSTSAWKTNITVLNGSYYIDTSVCVTRNQAMILLSI
FT                   IISLVGMGLNAIVLWFLGIRMHTNAFTVYILNLAMADFLYLCSQFVICLLIAFYIFYSI
FT                   DINIPLVLYVVPIFAYLSGLSILSTISIERCLSVIWPIWYRCKRPRHTSAITCFVLWVM
FT                   SLLLGLLEGKACGLLFNSFDSYWCETFDVITNIWSVVFFGVLCGSSLTLLVRIFCGSQR
FT                   IPMTRLYVTITLTVLVFLIFGLPFGIYWILYQWISNFYYVEICNFYLEILFLSCVNSCM
FT                   NPIIYFLVGSIRHRRFRRKTLKLLLQRAMQDTPEEEQSGNKSSSEHPEELETVQSCS"
XX
SQ   Sequence 1300 BP; 312 A; 267 C; 261 G; 460 T; 0 other;
     tgtttcagga acatgagtgg agatttccta atcaagaatc taagcacctc agcctggaaa        60
     acgaacatca cagtgctgaa tggaagctac tacatcgata cttcagtttg tgtcaccagg       120
     aaccaagcca tgattttgct ttccatcatc atttccctgg ttgggatggg actaaatgcc       180
     atagtgctgt ggttcctggg catccgtatg cacacgaatg ccttcactgt ctacattctc       240
     aacctggcta tggctgactt tctttacctg tgctctcagt ttgtaatttg tcttcttatt       300
     gccttttata tcttctactc aattgacatc aacatccctt tggttcttta tgttgtgcca       360
     atatttgctt atctttcagg tctgagcatt ctcagcacca ttagcattga gcgctgcttg       420
     tctgtaatat ggcccatttg gtatcgctgt aaacgtccaa gacacacatc agctatcaca       480
     tgttttgtgc tttgggttat gtccttattg ttgggtctcc tggaagggaa ggcatgtggc       540
     ttactgttta atagctttga ctcttattgg tgtgaaacat ttgatgttat cactaatata       600
     tggtcagttg ttttttttgg tgttctctgt gggtctagcc tcaccctgct tgtcaggatc       660
     ttctgtggct cacagcgaat tcctatgacc aggctgtatg tgactattac actcacagtc       720
     ttggtcttcc tgatctttgg tcttcccttt gggatctatt ggatactcta tcagtggatt       780
     agcaattttt attatgttga aatttgtaat ttttatcttg agatactatt cctatcctgt       840
     gttaacagct gtatgaaccc catcatttat ttccttgttg gctccattag gcaccgaagg       900
     ttcaggcgga agactctcaa gctacttctg cagagagcca tgcaagacac ccctgaggag       960
     gaacaaagtg gaaataagag ttcttcagaa caccctgaag aactggaaac tgttcagagc      1020
     tgcagctgac aactgcttga tcagacaaaa atggttttga tggaaatact ttttcttatc      1080
     cgtgtggacc atttttacaa cctttattca gtttgttatc tcatcttcaa ttgtttaatt      1140
     aggacaataa tttttgtaaa agttgagaga aatgggtctt gtcatactaa tactgaatgt      1200
     agcatttctg aagctgtgtt acttagggat ttaccatctc cttttcatgg gactccttgt      1260
     aagtattctg tggtagagaa cttctcctat tgttgacaaa                            1300
//

If you have problems or comments...

PBIL Back to PBIL home page