(data stored in ACNUC21429 zone)

EMBL: AY042828

ID   AY042828; SV 1; linear; mRNA; STD; PLN; 1948 BP.
XX
AC   AY042828;
XX
DT   06-JUL-2001 (Rel. 68, Created)
DT   16-APR-2005 (Rel. 83, Last updated, Version 2)
XX
DE   Arabidopsis thaliana putative ubiquitin-like protein (At2g17190; T23A1.5)
DE   mRNA, complete cds.
XX
KW   FLI_CDNA.
XX
OS   Arabidopsis thaliana (thale cress)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae;
OC   rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis.
XX
RN   [1]
RP   1-1948
RA   Nguyen M., Karlin-Neumann G., Southwick A., Lam B., Miranda M., Palm C.J.,
RA   Bowser L., Jones T., Banh J., Carninci P., Chen H., Cheuk R., Chung M.K.,
RA   Hayashizaki Y., Ishida J., Kamiya A., Kawai J., Kim C., Lin J., Liu S.X.,
RA   Narusaka M., Pham P.K., Sakano H., Sakurai T., Satou M., Seki M., Shinn P.,
RA   Yamada K., Shinozaki K., Ecker J., Theologis A., Davis R.W.;
RT   ;
RL   Submitted (25-JUN-2001) to the INSDC.
RL   DNA Sequencing and Technology Center, Stanford University, 855 California
RL   Avenue, Palo Alto, CA 94304, USA
XX
DR   MD5; b61e3b0742416366fc9ed798b46cd887.
XX
CC   e-mail for correspondence: arab@sequence.stanford.edu
CC   RIKEN Genomic Sciences Center (GSC) members carried out the
CC   collection and clustering of RAFL cDNAs (RAFL cDNA : 'RIKEN
CC   Arabidopsis  Full-Length cDNA'): Seki,M., Narusaka,M., Ishida,J.,
CC   Satou,M., Kamiya,A., Sakurai,T., Carninci,P., Kawai,J.,
CC   Hayashizaki,Y. and Shinozaki,K.
CC   The Salk, Stanford, PGEC (SSP) Consortium members carried out the
CC   sequencing and annotation of the RAFL cDNAs: Nguyen,M.,
CC   Southwick,A., Karlin-Neumann,G.,  Lam,B., Miranda,M., Palm,C.J.,
CC   Bowser,L., Jones,T., Banh,J., Chen,H., Cheuk,R., Chung,M.K.,
CC   Kim,C., Lin,J., Liu,S.X., Pham,P.K., Sakano,H., Shinn,P.,
CC   Yamada,K., Ecker,J., Theologis,A. and Davis,R.W.
CC   Nguyen,M., (SSP/Stanford) and Seki,M. (RIKEN GSC) contributed
CC   equally to this work.  Shinozaki,K. (RIKEN GSC) and Davis,R.W.
CC   (SSP/Stanford) contributed equally to this work as PIs.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1948
FT                   /organism="Arabidopsis thaliana"
FT                   /chromosome="II"
FT                   /mol_type="mRNA"
FT                   /clone="RAFL04-16-J06"
FT                   /note="This clone is in pBluescript ecotype: Columbia"
FT                   /db_xref="taxon:3702"
FT   CDS_pept        124..1740
FT                   /codon_start=1
FT                   /gene="At2g17190; T23A1.5"
FT                   /product="putative ubiquitin-like protein"
FT                   /db_xref="GOA:Q9SII9"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR006636"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR015496"
FT                   /db_xref="InterPro:IPR015940"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9SII9"
FT                   /protein_id="AAK68768.1"
FT                   /translation="MGGEADSRQPLTAEGVAVAVNVRCSNGTKFSVTTSLDSTVESFKE
FT                   LIAQNSDVPANQQRLIYKGRILKDDQTLLSYGLQADHTVHMVRGFVPSSPSAPAANAGN
FT                   QTTAPQAVGSNDSSNLGGGESLFPGLGFNPLGGGNAMAGLFGSGLPDLEQAQQQLAQNP
FT                   NMIREMMNTPAIQNLMNNPEFMRSMIMNNPQMRELVDRNPELGHVLNDPSILRQTLEAA
FT                   RNPELMREMMRNTDRAMSNIESMPEGFNMLRRMYENVQEPLMNATTMSENAGNNTSSNP
FT                   FAALLGNQGVTTQGSDTSNNISAPNAETGTPNANPLPNPWGATAGQTTAPGRTNAGLGG
FT                   LGGLGGLGGLGMLGADSPLGATPDASQLSQILQNPAMSQMMQSVLSNPQYMNQLMSLNP
FT                   QLRSMLDMNPQLREMMQNPDFLRQFSSPEMMQQMMSLQQSLFSQNRNTAGQDPTQTGAA
FT                   TGTANNGGLDLLMNMFGSLGAGGLSGTNQPNVPPEERFATQLQQLQEMGFYDRAENIRA
FT                   LLATNGNVNAAVERLLGSIGQ"
XX
SQ   Sequence 1948 BP; 518 A; 439 C; 458 G; 533 T; 0 other;
     agaaccgact tattagagct tcgagtctcc tcaaatcttc ttctacgatt ttttcttcta        60
     ggtttagagc ttttgattct ccgatcaatt tcgcgatttg ttgaactagg atctgaaatt       120
     agaatgggtg gtgaagcaga ttcgaggcag ccgctgactg ctgaaggcgt agctgttgcc       180
     gtgaacgtca gatgctccaa tggcacgaaa tttagtgtga cgacgagcct cgattccacg       240
     gtggagtctt tcaaagagtt aattgcgcag aacagcgatg tgccggcaaa tcagcagcgt       300
     ttgatttaca agggacgtat cctcaaagac gatcagactc tcctcagcta tggtttgcag       360
     gctgatcaca ccgttcatat ggttcgaggt tttgtgcctt cttctccttc tgctcccgct       420
     gcaaatgctg gaaaccaaac cactgctcct caagcggttg gttcaaatga tagctcaaac       480
     ctcggaggag gtgaatcttt gttccctggc cttggattta atcctttggg tggtggaaat       540
     gctatggctg gattatttgg atctggtctt cctgatcttg agcaggcaca gcaacaacta       600
     gctcagaacc ctaacatgat tagagagatg atgaatactc cagccatcca gaatcttatg       660
     aacaacccag aatttatgag gagtatgatt atgaataacc ctcaaatgcg tgagcttgta       720
     gatcgcaatc ctgagcttgg tcatgtgctc aatgacccaa gcatccttcg tcaaactcta       780
     gaagcggcga gaaacccaga gcttatgcgt gaaatgatga gaaatactga tagggctatg       840
     agtaatattg agtctatgcc tgagggattt aacatgctta ggcgtatgta tgaaaatgtc       900
     caggaaccgt taatgaatgc taccactatg tccgagaatg ctggaaacaa tacgagctct       960
     aatccatttg ctgctcttct gggaaaccag ggggttacta cacaaggaag cgatacttct      1020
     aataatattt cggcaccgaa tgctgaaacg ggtacaccta atgcaaatcc acttcctaat      1080
     ccttggggtg ccacggctgg ccagacaact gcccctggaa ggacaaatgc tggacttggt      1140
     ggtcttggtg ggcttggagg ccttggtgga ctcggtatgc tgggagcgga ctcacctctt      1200
     ggtgcgactc cagatgcttc tcaattgagc caaatactgc aaaaccccgc tatgtcgcag      1260
     atgatgcaaa gcgtactttc caatccacag tacatgaatc agcttatgag tcttaaccca      1320
     caactccgaa gcatgctaga tatgaatcct cagttgaggg aaatgatgca gaaccctgat      1380
     ttccttcgcc agtttagctc tcccgagatg atgcagcaaa tgatgtctct acaacaatca      1440
     cttttctctc agaataggaa cacggctggc caggatccta cgcaaactgg tgctgcgaca      1500
     gggacagcca ataacggagg actagattta ttgatgaata tgtttggcag ccttggtgct      1560
     ggcggcctaa gtggcacaaa ccaacccaat gttcctcctg aagagcgatt tgcgactcag      1620
     ttgcaacagt tgcaagaaat gggattctac gacagagcag agaacataag ggctttgctt      1680
     gcaaccaatg gtaacgttaa cgctgctgta gaacgactct tggggagtat tggccagtaa      1740
     catacaggat cgcgaacttg tggatagaaa agccgctcat cgatacacta tttgttttca      1800
     atggtcatct tctttcctct ttacccaatc cccacaacct tttttacata ctttgggtcg      1860
     tctgttatct ttcagattct atttgaagtt gttacctcgt acatctgtag aagttgattt      1920
     cgaaatgtgg aatggttaca tttacgtt                                         1948
//

If you have problems or comments...

PBIL Back to PBIL home page