(data stored in ACNUC16935 zone)

EMBL: AY042884

ID   AY042884; SV 1; linear; mRNA; STD; PLN; 927 BP.
XX
AC   AY042884;
XX
DT   06-JUL-2001 (Rel. 68, Created)
DT   16-APR-2005 (Rel. 83, Last updated, Version 2)
XX
DE   Arabidopsis thaliana Unknown protein mRNA, complete cds.
XX
KW   FLI_CDNA.
XX
OS   Arabidopsis thaliana (thale cress)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliophyta; eudicotyledons; Gunneridae; Pentapetalae;
OC   rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis.
XX
RN   [1]
RP   1-927
RA   Nguyen M., Karlin-Neumann G., Southwick A., Lam B., Miranda M., Palm C.J.,
RA   Bowser L., Jones T., Banh J., Carninci P., Chen H., Cheuk R., Chung M.K.,
RA   Hayashizaki Y., Ishida J., Kamiya A., Kawai J., Kim C., Lin J., Liu S.X.,
RA   Narusaka M., Pham P.K., Sakano H., Sakurai T., Satou M., Seki M., Shinn P.,
RA   Yamada K., Shinozaki K., Ecker J., Theologis A., Davis R.W.;
RT   ;
RL   Submitted (25-JUN-2001) to the INSDC.
RL   DNA Sequencing and Technology Center, Stanford University, 855 California
RL   Avenue, Palo Alto, CA 94304, USA
XX
DR   MD5; cae4ad1b6c26882f59f02deeb5b1f289.
XX
CC   e-mail for correspondence: arab@sequence.stanford.edu
CC   RIKEN Genomic Sciences Center (GSC) members carried out the
CC   collection and clustering of RAFL cDNAs (RAFL cDNA : 'RIKEN
CC   Arabidopsis  Full-Length cDNA'): Seki,M., Narusaka,M., Ishida,J.,
CC   Satou,M., Kamiya,A., Sakurai,T., Carninci,P., Kawai,J.,
CC   Hayashizaki,Y. and Shinozaki,K.
CC   The Salk, Stanford, PGEC (SSP) Consortium members carried out the
CC   sequencing and annotation of the RAFL cDNAs: Nguyen,M.,
CC   Southwick,A., Karlin-Neumann,G.,  Lam,B., Miranda,M., Palm,C.J.,
CC   Bowser,L., Jones,T., Banh,J., Chen,H., Cheuk,R., Chung,M.K.,
CC   Kim,C., Lin,J., Liu,S.X., Pham,P.K., Sakano,H., Shinn,P.,
CC   Yamada,K., Ecker,J., Theologis,A. and Davis,R.W.
CC   Nguyen,M., (SSP/Stanford) and Seki,M. (RIKEN GSC) contributed
CC   equally to this work.  Shinozaki,K. (RIKEN GSC) and Davis,R.W.
CC   (SSP/Stanford) contributed equally to this work as PIs.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..927
FT                   /organism="Arabidopsis thaliana"
FT                   /chromosome="IV"
FT                   /mol_type="mRNA"
FT                   /clone="RAFL04-16-G03"
FT                   /note="This clone is in pBluescript ecotype: Columbia"
FT                   /db_xref="taxon:3702"
FT   CDS_pept        68..757
FT                   /codon_start=1
FT                   /product="Unknown protein"
FT                   /note="unannotated coding sequence from BAC T5J8"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR019954"
FT                   /db_xref="InterPro:IPR019956"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="UniProtKB/TrEMBL:Q94B30"
FT                   /protein_id="AAK68824.1"
FT                   /translation="MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF
FT                   AGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
FT                   KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKPLPGK
FT                   TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
FT                   LRLRGGF"
XX
SQ   Sequence 927 BP; 253 A; 213 C; 211 G; 250 T; 0 other;
     acaaattcag attccaaatt tctcaaactc tgaaatcgtt ctttcaaatc tctcaatcgg        60
     gatcaagatg cagatctttg ttaagactct caccggaaag actatcaccc tcgaggtgga       120
     aagctctgac accatcgaca acgtcaaggc caagatccaa gacaaggagg gtattcctcc       180
     ggaccagcag aggttgatct tcgctggaaa gcagttggag gatggcagaa ctcttgctga       240
     ctacaacatc cagaaggagt ccacacttca tcttgttctc aggctccgtg gtggtatgca       300
     gatctttgtc aagacgttga ctggaaagac tatcactttg gaggtggaga gctctgacac       360
     tatcgacaat gtcaaagcca agatccagga caaagagggt atcccaccgg accagcagag       420
     attgatcttc gccggaaaac aacttgaaga tggtagaact ttggctgact acaacattca       480
     gaaggagtct acacttcact tggtgttgcg tctccgtgga ggtatgcaga ttttcgtgaa       540
     gcctctccct ggaaagacca ttactcttga agttgagagc tccgacacca ttgacaacgt       600
     gaaggctaag atccaggaca aggaaggtat ccctccggac cagcagcgtc tcatcttcgc       660
     tggaaaacag cttgaggatg gtcgtacttt ggccgactac aacatccaga aggagtctac       720
     ccttcacttg gtgctaaggc tccgtggtgg tttctaaaaa cttatctctg ttatgaatca       780
     gaagaagttc atgtctcgtt tcatttaaaa ctttggtggt ttgtgttttg gggccttgta       840
     aagcccctga tgaataattg ttcaactatg tttccgttcc tgtgttatac ctttctttct       900
     aatgagtaat gacatcaaac ttcttct                                           927
//

If you have problems or comments...

PBIL Back to PBIL home page