(data stored in ACNUC15468 zone)

EMBL: AY046403

ID   AY046403; SV 1; linear; mRNA; STD; MUS; 2671 BP.
XX
AC   AY046403;
XX
DT   24-JUL-2002 (Rel. 72, Created)
DT   24-SEP-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Mus musculus chloride channel 1 mRNA, partial cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-2671
RX   DOI; 10.1016/S1097-2765(02)00563-4.
RX   PUBMED; 12150905.
RA   Mankodi A., Takahashi M.P., Jiang H., Beck C., Bowers W.J., Moxley R.T.,
RA   Cannon S.C., Thornton C.A.;
RT   "Expanded CUG repeats trigger aberrant splicing of ClC-1 chloride channel
RT   pre-mRNA and hyperexcitability of skeletal muscle in myotonic dystrophy";
RL   Mol. Cell 10(1):35-44(2002).
XX
RN   [2]
RP   1-2671
RA   Thornton C.A.;
RT   ;
RL   Submitted (17-JUL-2001) to the INSDC.
RL   Neurology, University of Rochester Medical Center, 601 Elmwood Avenue Box
RL   673, Rochester, NY 14642, USA
XX
DR   MD5; 41e2d1bfc63b51dbbe9914da4a61e178.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2671
FT                   /organism="Mus musculus"
FT                   /strain="FVB/N"
FT                   /mol_type="mRNA"
FT                   /tissue_type="skeletal muscle"
FT                   /db_xref="taxon:10090"
FT   CDS_pept        <1..>2671
FT                   /codon_start=1
FT                   /product="chloride channel 1"
FT                   /note="ClC-1; alternatively spliced"
FT                   /db_xref="GOA:Q8K3N1"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001807"
FT                   /db_xref="InterPro:IPR002243"
FT                   /db_xref="InterPro:IPR014743"
FT                   /db_xref="MGI:MGI:88417"
FT                   /db_xref="UniProtKB/TrEMBL:Q8K3N1"
FT                   /protein_id="AAL05907.1"
FT                   /translation="SYGLPSENGGLQHRPRKDMGPRHNAHPTQIYGHQKEQYSYKAQDG
FT                   GMPKKMGSSSTMDSLDEDHYSKCQDCVHRLGRVLRRKLGEDWIFLVLLGLLMALVSWCM
FT                   DYVSAKSLQAYKWTYAQMKPSLPLQYLAWVTFPLILILFSALFCQLISPQAVGSGIPEM
FT                   KTILRGVVLKEYLTLKAFVAKVVALTAGLGSGIPVGKEGPFVHIASICAAVLSKFMSMF
FT                   SGVYEQPYYYTDILTVGCAVGVGCCFGTPLGGVLFSIEVTSTYFAVRNYWRGFFAATFS
FT                   AFVFRVLAVWNKDAVTITALFRTNFRMDFPFDLKELPAFAVIGICCGFLGAVFVYLHRQ
FT                   VMLGVRKHKCLSQFLAKHRLLYPGIVTFVIASLTFPPGMGQFMAGELMPREAISTLFDN
FT                   NTWVKHIGDPQSLGQSAVWLHPQVNVVIIILLFFVMKFWMSIVATTMPIPCGGFMPVFV
FT                   LGAAFGRLVGEIMAMLFPEGILFDDIIYKILPGGYAVIGAAALTGAVSHTVSTAVICFE
FT                   LTGQIAHILPMMVAVILANMVAQSLQPSLYDSIIQVKKLPYLPDLGWNQLSKFTIFVED
FT                   IMVRDVKFVSASCTYGELRNLLQATTVKTLPLVDSKDSMILLGSVERSELQSLLQRHLC
FT                   AERRLKAAQDMARKLSELPYNGKAQLAGDWHPGGRPESFAFVDEDEDEDLSRKMELPLT
FT                   PAPPPPSPPPPPSQFPIAPSHPEEPNGPLPSHKQPPEASDSADQRSSTFQRLLHCLLGK
FT                   AHSKKKKITQDSTDLVDNMSPEEIEAWEREQLSQPVCFDCCCIDQSPFQLVEQTTLHKT
FT                   HTLFSLLGLHLAYVTSMGKLRGVLALEELQKAIEGHTKSGVQLRPPLASFRNTTSIRKT
FT                   PGGPPPPAEGWNVPEDGDG"
XX
SQ   Sequence 2671 BP; 598 A; 725 C; 661 G; 687 T; 0 other;
     agctatggac tgccctcaga gaatgggggc cttcagcacc ggccccgaaa ggacatgggt        60
     cccaggcaca atgcccaccc aacgcagata tatggccatc aaaaagaaca atattcatat       120
     aaggcacagg acgggggaat gcccaagaag atgggctcca gttctaccat ggacagcttg       180
     gatgaggacc actattctaa atgtcaagac tgtgtccatc gcctgggacg tgtgctgaga       240
     aggaagctgg gggaagattg gatctttctt gtgctcctgg gcctcctgat ggctctagtc       300
     agctggtgca tggactatgt tagtgccaag agccttcagg cctacaagtg gacctatgcc       360
     cagatgaagc ctagccttcc tctgcagtac ctggcctggg tcaccttccc acttatcctc       420
     atcctcttca gcgccctctt ttgccaactc atctctcccc aggctgtggg ctctggaatc       480
     cctgagatga aaacaattct tcgtggtgtt gtcttgaagg aatacctcac actcaaggcc       540
     tttgtagcca aggtggtagc tttgacagct ggactgggca gtggcatccc tgtggggaaa       600
     gagggtccct ttgttcacat cgccagcatc tgtgctgctg tcctcagcaa gtttatgtcc       660
     atgttctctg gtgtctatga gcagccatac tattacactg acatcctgac agtgggctgt       720
     gccgtggggg tcggttgctg ttttggaaca ccacttggag gagtgctatt tagcatcgag       780
     gtcacctcta cctactttgc tgttcggaat tactggcgag gattctttgc agccacattc       840
     agtgcctttg tgttccgtgt cctggccgtt tggaacaagg atgctgtcac catcactgct       900
     ctgttcagaa cgaatttccg aatggatttc ccctttgacc tgaaggaact cccagctttt       960
     gctgtcattg ggatttgctg cgggttcttg ggagctgttt tcgtttatct gcatcgccaa      1020
     gtcatgctcg gtgtccgaaa gcacaagtgt ctcagccaat ttcttgctaa gcaccgcctg      1080
     ctatatcctg gaattgttac ctttgtcatc gcctcgctca catttccacc aggaatgggt      1140
     caattcatgg ctggagagct gatgccccgt gaagctatca gtaccctctt tgacaacaac      1200
     acatgggtaa agcacatagg tgacccccaa agcttgggcc agtcagctgt gtggcttcac      1260
     ccccaggtca acgtggtcat catcatcctt ctcttcttcg ttatgaagtt ttggatgtcc      1320
     attgtagcca ccactatgcc cataccctgt ggaggcttca tgcctgtttt tgtgctagga      1380
     gctgcatttg gaaggctggt aggagagatc atggccatgc tattccctga gggtatctta      1440
     tttgatgata tcatctataa gatcttacct gggggctatg cagtaattgg agcagcagct      1500
     ttgacagggg ctgtctccca cacagtctcc acagccgtca tttgcttcga attaaccggt      1560
     cagattgctc acatcctgcc catgatggtg gctgttatct tggccaacat ggtggctcag      1620
     agtctgcagc cctccctcta tgacagcatc atccaggtca agaagcttcc ctatctgcca      1680
     gaccttggtt ggaaccagct cagcaaattt acaatttttg ttgaggacat catggtacgt      1740
     gatgtgaagt tcgtttcagc ttcttgtaca tatggggaac tgagaaacct actccaggcc      1800
     accacagtca agactttacc attggttgac tccaaagatt caatgatcct gctgggctct      1860
     gtggaacgct cagaactgca gtccctcctg cagcgccacc tgtgtgcaga gcgaaggttg      1920
     aaggctgccc aggacatggc tcgaaagtta tcagagctgc cttataatgg caaggctcag      1980
     ctggctgggg actggcatcc tggtggtcga cctgagtcct ttgccttcgt agatgaagat      2040
     gaagatgagg acctctccag gaagatggag cttccactga ctccagctcc tccccctcct      2100
     tcccctcctc ctccaccttc ccagtttcct attgctccat cacaccctga agaacctaat      2160
     gggccactgc ccagccataa acagccacct gaagcctcag actctgcaga tcaaagatca      2220
     tccaccttcc aacgcctgct gcactgcttg ctaggaaaag ctcactccaa aaagaagaaa      2280
     ataacacagg attcaacaga tttagtggat aacatgtcac ctgaagagat tgaggcctgg      2340
     gagcgggagc agctgagcca gcctgtgtgc tttgattgct gctgcatcga ccagtctccc      2400
     ttccagctgg tggagcagac aaccctgcac aagactcata cactcttctc acttcttggc      2460
     ctccatcttg cctatgtgac cagcatgggg aagctcagag gtgtcttggc actagaagag      2520
     ctacagaaag ctattgaggg ccacaccaaa tctggggtgc agcttcgccc tccacttgcc      2580
     agcttccgga atacaacttc aatccggaag actcctgggg ggccaccccc tcctgcagag      2640
     ggctggaatg tacctgagga tggagatggg g                                     2671
//

If you have problems or comments...

PBIL Back to PBIL home page