(data stored in SCRATCH zone)

EMBL: AY049245

ID   AY049245; SV 1; linear; mRNA; STD; PLN; 1990 BP.
XX
AC   AY049245;
XX
DT   10-AUG-2001 (Rel. 68, Created)
DT   16-APR-2005 (Rel. 83, Last updated, Version 2)
XX
DE   Arabidopsis thaliana AT4g26270/T25K17_80 mRNA, complete cds.
XX
KW   FLI_CDNA.
XX
OS   Arabidopsis thaliana (thale cress)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae;
OC   rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis.
XX
RN   [1]
RP   1-1990
RA   Cheuk R., Chen H., Kim C.J., Koesema E., Meyers M.C., Banh J., Bowser L.,
RA   Carninci P., Dale J.M., Goldsmith A.D., Hayashizaki Y., Ishida J.,
RA   Jiang P.X., Jones T., Kamiya A., Karlin-Neumann G., Kawai J., Lam B.,
RA   Lee J.M., Lin J., Liu S.X., Miranda M., Narusaka M., Nguyen M.,
RA   Onodera C.S., Palm C.J., Pham P.K., Quach H.L., Sakurai T., Satou M.,
RA   Seki M., Southwick A., Tang C.C., Toriumi M., Yamada K., Yamamura Y.,
RA   Yu G., Yu S., Shinozaki K., Davis R.W., Theologis A., Ecker J.R.;
RT   "Arabidopsis cDNA clones";
RL   Unpublished.
XX
RN   [2]
RP   1-1990
RA   Cheuk R., Chen H., Kim C.J., Koesema E., Meyers M.C., Banh J., Bowser L.,
RA   Carninci P., Dale J.M., Goldsmith A.D., Hayashizaki Y., Ishida J.,
RA   Jiang P.X., Jones T., Kamiya A., Karlin-Neumann G., Kawai J., Lam B.,
RA   Lee J.M., Lin J., Liu S.X., Miranda M., Narusaka M., Nguyen M.,
RA   Onodera C.S., Palm C.J., Pham P.K., Quach H.L., Sakurai T., Satou M.,
RA   Seki M., Southwick A., Tang C.C., Toriumi M., Yamada K., Yamamura Y.,
RA   Yu G., Yu S., Shinozaki K., Davis R.W., Theologis A., Ecker J.R.;
RT   ;
RL   Submitted (22-JUL-2001) to the INSDC.
RL   Salk Institute Genomic Analysis Laboratory (SIGnAL), Plant Biology
RL   Laboratory, The Salk Institute for Biological Studies, 10010 N. Torrey
RL   Pines Road, La Jolla, CA 92037, USA
XX
DR   MD5; 26239b7b50e8735a28bc45fd6258c5fd.
XX
CC   RIKEN Genomic Sciences Center (GSC) members carried out the
CC   collection and clustering of RAFL cDNAs (RAFL cDNA : 'RIKEN
CC   Arabidopsis Full-Length cDNA') :  Seki,M., Narusaka,M., Ishida,J.,
CC   Satou,M., Kamiya,A., Sakurai,T., Carninci,P.,  Kawai,J.,
CC   Hayashizaki,Y. and Shinozaki,K.
CC   The Salk, Stanford, PGEC (SSP) Consortium members carried out the
CC   sequencing and annotation of the RAFL cDNAs: Cheuk,R., Chen,H.,
CC   Kim,C.J., Koesema,E., Meyers,M.C., Shinn,P., Banh,J. Bowser,L.,
CC   Dale,J.M., Goldsmith,A.D., Jiang,P.X., Jones,T., Karlin-Neumann,G.,
CC   Lam,B., Lee,J.M., Lin,J., Liu,S.X., Miranda,M., Nguyen,M.,
CC   Onodera,C.S., Palm,C.J., Pham,P.K., Quach,H.L., Southwick,A.,
CC   Tang,C.C., Toriumi,M., Yamada,K., Yamamura, Y., Yu,G., Yu,S.,
CC   Davis,R.W.,  Theologis,A., and Ecker,J.R.
CC   Cheuk,R. (SSP/Salk) and Seki,M. (RIKEN GSC) contributed equally to
CC   this work.  Shinozaki,K. (RIKEN GSC) and Ecker,J.R. (SSP/Salk)
CC   contributed equally to this work as PIs.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1990
FT                   /organism="Arabidopsis thaliana"
FT                   /chromosome="4"
FT                   /mol_type="mRNA"
FT                   /clone="RAFL07-18-H05(R13212)"
FT                   /note="ecotype: Columbia"
FT                   /db_xref="taxon:3702"
FT   5'UTR           1..318
FT   CDS_pept        319..1788
FT                   /codon_start=1
FT                   /product="AT4g26270/T25K17_80"
FT                   /note="pyrophosphate-dependent phosphofructo-1-kinase"
FT                   /db_xref="GOA:Q94AA4"
FT                   /db_xref="InterPro:IPR000023"
FT                   /db_xref="InterPro:IPR012004"
FT                   /db_xref="InterPro:IPR022953"
FT                   /db_xref="InterPro:IPR035966"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q94AA4"
FT                   /protein_id="AAK83587.1"
FT                   /translation="MSTVESSKPKIINGSCGYVLEDVPHLSDYLPGLPTYPNPLQDNPA
FT                   YSVVKQYFVDADDSVPQKIVVHKDGPRGIHFRRAGPRQKVYFESDEVHACIVTCGGLCP
FT                   GLNTVIREIVSSLSYMYGVKRILGIDGGYRGFYAKNTVSLDSKVVNDIHKRGGTILGTS
FT                   RGGHDTTKIVDSIQDRGINQVYIIGGDGTQRGASVIFEEIRRRGLKVAVIGIPKTIDND
FT                   IPVIDKSFGFDTAVEEAQRAINAAHVEAESIENGIGVVKLMGRYSGFIAMYATLASRDV
FT                   DCCLIPESPFYLEGEGGLFEYIEKRLKESGHMVLVIAEGAGQDLMSKSMESMTLKDASG
FT                   NKLLKDVGLWLSQSIKDHFNQKKMVMNLKYIDPTYMIRAVPSNASDNVYCTLLAQSAVH
FT                   GAMAGYTGYISGLVNGRQTYIPFYRITEKQNHVVITDRMWARLLSSTNQPSFLGPKDVF
FT                   DNKEKPMSALLDDGNCNGVVDVPPVTKEITK"
FT   3'UTR           1789..1990
XX
SQ   Sequence 1990 BP; 575 A; 387 C; 451 G; 577 T; 0 other;
     aaaagcagtg accaaaacca ccatttccgc acatagctaa gacctttaat ggtttcctct        60
     ctctctctat ctctacctgg ctttgtaatt tgtttaccga ctacaatggt caaaatttct       120
     ctactcctat aaaaatgggt cgccttgttt ttgatcaacg gatttgattc atctttcttt       180
     ttacctttct tcctgctttc gtattcaatt tgtagttgac cagttcaaaa gtctctatac       240
     cagaaaaaaa aatcgttttt tattatatta taagactttt cccctgaaat tgttgttcct       300
     ctgtttcgag cgttcgttat gagtactgtg gagagtagca aaccgaagat catcaatggc       360
     tcttgtggtt atgttctaga agatgtaccg catctctccg attaccttcc tggtcttcct       420
     acttatccta atccattgca agacaatcca gcttactcag tggttaagca atactttgtt       480
     gatgctgatg acagtgttcc tcaaaagatc gttgttcaca aggatggtcc aagggggatt       540
     cattttagac gagccgggcc acgtcagaag gtatacttcg aatctgatga agtgcatgct       600
     tgcatagtta cctgtggagg tctttgtcct ggccttaata ccgtgattag agaaatagtg       660
     agcagtctat cttatatgta tggagtgaag agaatactgg gaatagatgg tggatataga       720
     ggcttttatg ctaagaatac tgtctccttg gactctaaag ttgtaaatga tatccataag       780
     cgtggaggga ctatccttgg gacctcacga ggtggtcacg ataccacaaa gatagttgac       840
     agcattcaag atcgaggaat caatcaggtt tacattatag gaggagatgg aacacagcga       900
     ggagcatctg tcatatttga ggaaattaga agacgtggcc tgaaagttgc agttattgga       960
     atcccgaaaa caatcgataa tgacatacct gtgatagaca aatcttttgg gtttgacact      1020
     gctgtagaag aggctcaacg agctattaat gcagcacatg tggaagccga gagtatagag      1080
     aatggtatcg gagttgtcaa gcttatgggt cgctacagcg ggttcatagc gatgtatgcc      1140
     actctagcaa gcagagatgt ggactgctgt ttgattccgg agtcaccatt ttacctggaa      1200
     ggagaaggcg gactgtttga gtacatagag aaacgactca aggagagcgg tcacatggtt      1260
     cttgtgattg cagaaggtgc aggacaagat ctaatgtcga agagcatgga atctatgaca      1320
     ctcaaagatg catctggtaa caaacttctt aaagatgttg gcctttggct gtcacaaagc      1380
     atcaaggatc attttaatca gaagaagatg gtgatgaacc tcaagtacat agatccaaca      1440
     tacatgattc gagctgttcc tagcaatgcg tcagacaatg tttattgtac acttctggct      1500
     cagagtgcag tgcacggtgc aatggctgga tacactggct atatcagtgg tctagtgaac      1560
     ggaagacaaa cctacatacc cttttacagg ataacggaga aacagaacca tgtggtgatc      1620
     acagacagga tgtgggcaag gctactctct tcgacaaacc agccgagttt cttgggcccc      1680
     aaagatgtct ttgataataa agagaaaccg atgtcggctc tccttgacga tggtaactgc      1740
     aatggcgtgg tggatgttcc tccagtcacc aaagagatca ccaagtgacc tgaacataag      1800
     aacaacgaca gaaaagcttt gcgttttcaa aagatgttac atgttttagg tagttgagta      1860
     aaataatagg gtgttgacgg ttttaccctt tttggcataa caaagcaatc tttgttagat      1920
     gcctcacgtt gtaattttcc acgtcatgat gctttagtcc cacgtcatat aaataagttc      1980
     catttatccc                                                             1990
//

If you have problems or comments...

PBIL Back to PBIL home page