(data stored in ACNUC16935 zone)

EMBL: AY052661

ID   AY052661; SV 1; linear; mRNA; STD; PLN; 958 BP.
XX
AC   AY052661;
XX
DT   06-SEP-2001 (Rel. 69, Created)
DT   16-APR-2005 (Rel. 83, Last updated, Version 2)
XX
DE   Arabidopsis thaliana AT4g05050/T32N4_13 mRNA, complete cds.
XX
KW   FLI_CDNA.
XX
OS   Arabidopsis thaliana (thale cress)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliophyta; eudicotyledons; Gunneridae; Pentapetalae;
OC   rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis.
XX
RN   [1]
RP   1-958
RA   Cheuk R., Chen H., Kim C.J., Koesema E., Meyers M.C., Banh J., Bowser L.,
RA   Carninci P., Dale J.M., Goldsmith A.D., Hayashizaki Y., Ishida J.,
RA   Jiang P.X., Jones T., Kamiya A., Karlin-Neumann G., Kawai J., Lam B.,
RA   Lee J.M., Lin J., Liu S.X., Miranda M., Narusaka M., Nguyen M.,
RA   Onodera C.S., Palm C.J., Pham P.K., Quach H.L., Sakurai T., Satou M.,
RA   Seki M., Southwick A., Tang C.C., Toriumi M., Yamada K., Yamamura Y.,
RA   Yu G., Yu S., Shinozaki K., Davis R.W., Theologis A., Ecker J.R.;
RT   "Arabidopsis cDNA clones";
RL   Unpublished.
XX
RN   [2]
RP   1-958
RA   Cheuk R., Chen H., Kim C.J., Koesema E., Meyers M.C., Banh J., Bowser L.,
RA   Carninci P., Dale J.M., Goldsmith A.D., Hayashizaki Y., Ishida J.,
RA   Jiang P.X., Jones T., Kamiya A., Karlin-Neumann G., Kawai J., Lam B.,
RA   Lee J.M., Lin J., Liu S.X., Miranda M., Narusaka M., Nguyen M.,
RA   Onodera C.S., Palm C.J., Pham P.K., Quach H.L., Sakurai T., Satou M.,
RA   Seki M., Southwick A., Tang C.C., Toriumi M., Yamada K., Yamamura Y.,
RA   Yu G., Yu S., Shinozaki K., Davis R.W., Theologis A., Ecker J.R.;
RT   ;
RL   Submitted (17-AUG-2001) to the INSDC.
RL   Salk Institute Genomic Analysis Laboratory (SIGnAL), Plant Biology
RL   Laboratory, The Salk Institute for Biological Studies, 10010 N. Torrey
RL   Pines Road, La Jolla, CA 92037, USA
XX
DR   MD5; 5cf80215c9bbdcb5c332b8e714706d8e.
XX
CC   RIKEN Genomic Sciences Center (GSC) members carried out the
CC   collection and clustering of RAFL cDNAs (RAFL cDNA : 'RIKEN
CC   Arabidopsis Full-Length cDNA') :  Seki,M., Narusaka,M., Ishida,J.,
CC   Satou,M., Kamiya,A., Sakurai,T., Carninci,P.,  Kawai,J.,
CC   Hayashizaki,Y. and Shinozaki,K.
CC   The Salk, Stanford, PGEC (SSP) Consortium members carried out the
CC   sequencing and annotation of the RAFL cDNAs: Cheuk,R., Chen,H.,
CC   Kim,C.J., Koesema,E., Meyers,M.C., Shinn,P., Banh,J. Bowser,L.,
CC   Dale,J.M., Goldsmith,A.D., Jiang,P.X., Jones,T., Karlin-Neumann,G.,
CC   Lam,B., Lee,J.M., Lin,J., Liu,S.X., Miranda,M., Nguyen,M.,
CC   Onodera,C.S., Palm,C.J., Pham,P.K., Quach,H.L., Southwick,A.,
CC   Tang,C.C., Toriumi,M., Yamada,K., Yamamura, Y., Yu,G., Yu,S.,
CC   Davis,R.W.,  Theologis,A., and Ecker,J.R.
CC   Cheuk,R. (SSP/Salk) and Seki,M. (RIKEN GSC) contributed equally to
CC   this work.  Shinozaki,K. (RIKEN GSC) and Ecker,J.R. (SSP/Salk)
CC   contributed equally to this work as PIs.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..958
FT                   /organism="Arabidopsis thaliana"
FT                   /chromosome="4"
FT                   /mol_type="mRNA"
FT                   /clone="RAFL06-74-F01(R13740)"
FT                   /note="ecotype: Columbia"
FT                   /db_xref="taxon:3702"
FT   5'UTR           1..68
FT   CDS_pept        69..758
FT                   /codon_start=1
FT                   /product="AT4g05050/T32N4_13"
FT                   /note="putative polyubiquitin"
FT                   /db_xref="GOA:P0CH33"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR019954"
FT                   /db_xref="InterPro:IPR019956"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CH33"
FT                   /protein_id="AAK96565.1"
FT                   /translation="MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF
FT                   AGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
FT                   KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
FT                   TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
FT                   LRLRGGF"
FT   3'UTR           759..958
XX
SQ   Sequence 958 BP; 253 A; 230 C; 213 G; 262 T; 0 other;
     tgacaattca gattccaatt ttctcaaact ctaaaatcaa tctctcaaat ctctcaaccg        60
     tgatcaagat gcagatcttc gttaagactc tcaccggaaa gactatcacc ctcgaggtgg       120
     aaagctctga caccatcgac aacgttaagg ccaagatcca ggataaggaa ggtattcctc       180
     cggatcagca gaggcttatc ttcgccggaa agcagttgga ggatggccgc acgttggcgg       240
     attacaatat ccagaaggaa tccaccctcc acttggttct caggctccgt ggtggtatgc       300
     agattttcgt taaaacccta acgggaaaga cgattactct tgaggtggag agctctgaca       360
     ccattgacaa cgtcaaggcc aagatccaag ataaggaggg tattcctccg gaccagcaga       420
     ggttgatctt cgccggaaag caacttgagg acggcagaac tttggcggat tacaacatcc       480
     agaaggagtc tacgcttcat ttggtcttgc gtctgcgtgg aggtatgcag atcttcgtaa       540
     agactttgac cggaaagacc atcactcttg aagttgagag ctccgacacc attgataacg       600
     tgaaggctaa gatccaggac aaggaaggca ttcctccgga ccagcagcgt ctcatcttcg       660
     ctggaaagca gcttgaggat ggacgtactt tggccgacta caacatccag aaggagtcta       720
     ctcttcactt ggtcctccgt ctccgtggtg gtttctaaac cttgtctctc tctcttatgg       780
     ttactgaacc aagttcatgt atcgtttcat ctagtacttt ggtggtttat gttttggggc       840
     catgtacagc ctctgataaa taattgatcg actatgtttc cgtttctttc atctctcttt       900
     tctttcaaac aacaaatcga acttattctc tattgcaatt atctctttcg attcaaag         958
//

If you have problems or comments...

PBIL Back to PBIL home page