(data stored in ACNUC16935 zone)

EMBL: AY054281

ID   AY054281; SV 1; linear; mRNA; STD; PLN; 884 BP.
XX
AC   AY054281;
XX
DT   02-OCT-2001 (Rel. 69, Created)
DT   16-APR-2005 (Rel. 83, Last updated, Version 2)
XX
DE   Arabidopsis thaliana AT4g05050/T32N4_13 mRNA, complete cds.
XX
KW   FLI_CDNA.
XX
OS   Arabidopsis thaliana (thale cress)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae;
OC   rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis.
XX
RN   [1]
RP   1-884
RA   Cheuk R., Chen H., Kim C.J., Koesema E., Meyers M.C., Banh J., Bowser L.,
RA   Carninci P., Dale J.M., Goldsmith A.D., Hayashizaki Y., Ishida J.,
RA   Jiang P.X., Jones T., Kamiya A., Karlin-Neumann G., Kawai J., Lam B.,
RA   Lee J.M., Lin J., Liu S.X., Miranda M., Narusaka M., Nguyen M.,
RA   Onodera C.S., Palm C.J., Pham P.K., Quach H.L., Sakurai T., Satou M.,
RA   Seki M., Southwick A., Tang C.C., Toriumi M., Yamada K., Yamamura Y.,
RA   Yu G., Yu S., Shinozaki K., Davis R.W., Theologis A., Ecker J.R.;
RT   "Arabidopsis cDNA clones";
RL   Unpublished.
XX
RN   [2]
RP   1-884
RA   Cheuk R., Chen H., Kim C.J., Koesema E., Meyers M.C., Banh J., Bowser L.,
RA   Carninci P., Dale J.M., Goldsmith A.D., Hayashizaki Y., Ishida J.,
RA   Jiang P.X., Jones T., Kamiya A., Karlin-Neumann G., Kawai J., Lam B.,
RA   Lee J.M., Lin J., Liu S.X., Miranda M., Narusaka M., Nguyen M.,
RA   Onodera C.S., Palm C.J., Pham P.K., Quach H.L., Sakurai T., Satou M.,
RA   Seki M., Southwick A., Tang C.C., Toriumi M., Yamada K., Yamamura Y.,
RA   Yu G., Yu S., Shinozaki K., Davis R.W., Theologis A., Ecker J.R.;
RT   ;
RL   Submitted (22-AUG-2001) to the INSDC.
RL   Salk Institute Genomic Analysis Laboratory (SIGnAL), Plant Biology
RL   Laboratory, The Salk Institute for Biological Studies, 10010 N. Torrey
RL   Pines Road, La Jolla, CA 92037, USA
XX
DR   MD5; 13cfdea930fb7c701d54543d2030e255.
XX
CC   RIKEN Genomic Sciences Center (GSC) members carried out the
CC   collection and clustering of RAFL cDNAs (RAFL cDNA : 'RIKEN
CC   Arabidopsis Full-Length cDNA') :  Seki,M., Narusaka,M., Ishida,J.,
CC   Satou,M., Kamiya,A., Sakurai,T., Carninci,P.,  Kawai,J.,
CC   Hayashizaki,Y. and Shinozaki,K.
CC   The Salk, Stanford, PGEC (SSP) Consortium members carried out the
CC   sequencing and annotation of the RAFL cDNAs: Cheuk,R., Chen,H.,
CC   Kim,C.J., Koesema,E., Meyers,M.C., Shinn,P., Banh,J. Bowser,L.,
CC   Dale,J.M., Goldsmith,A.D., Jiang,P.X., Jones,T., Karlin-Neumann,G.,
CC   Lam,B., Lee,J.M., Lin,J., Liu,S.X., Miranda,M., Nguyen,M.,
CC   Onodera,C.S., Palm,C.J., Pham,P.K., Quach,H.L., Southwick,A.,
CC   Tang,C.C., Toriumi,M., Yamada,K., Yamamura, Y., Yu,G., Yu,S.,
CC   Davis,R.W.,  Theologis,A., and Ecker,J.R.
CC   Cheuk,R. (SSP/Salk) and Seki,M. (RIKEN GSC) contributed equally to
CC   this work.  Shinozaki,K. (RIKEN GSC) and Ecker,J.R. (SSP/Salk)
CC   contributed equally to this work as PIs.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..884
FT                   /organism="Arabidopsis thaliana"
FT                   /chromosome="4"
FT                   /mol_type="mRNA"
FT                   /clone="RAFL09-19-F11(R13875)"
FT                   /note="ecotype: Columbia"
FT                   /db_xref="taxon:3702"
FT   5'UTR           1..66
FT   CDS_pept        67..756
FT                   /codon_start=1
FT                   /product="AT4g05050/T32N4_13"
FT                   /note="unknown protein"
FT                   /db_xref="GOA:P0CH33"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR019954"
FT                   /db_xref="InterPro:IPR019956"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0CH33"
FT                   /protein_id="AAL06940.1"
FT                   /translation="MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF
FT                   AGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
FT                   KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
FT                   TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV
FT                   LRLRGGF"
FT   3'UTR           757..884
XX
SQ   Sequence 884 BP; 233 A; 213 C; 208 G; 230 T; 0 other;
     acaattcaga ttccaatttt ctcaaactct aaaatcaatc tctcaaatct ctcaaccgtg        60
     atcaagatgc agatcttcgt taagactctc accggaaaga ctatcaccct cgaggtggaa       120
     agctctgaca ccatcgacaa cgttaaggcc aagatccagg ataaggaagg tattcctccg       180
     gatcagcaga ggcttatctt cgccggaaag cagttggagg atggccgcac gttggcggat       240
     tacaatatcc agaaggaatc caccctccac ttggttctca ggctccgtgg tggtatgcag       300
     attttcgtta aaaccctaac gggaaagacg attactcttg aggtggagag ctctgacacc       360
     attgacaacg tcaaggccaa gatccaagat aaggagggta ttcctccgga ccagcagagg       420
     ttgatcttcg ccggaaagca acttgaggac ggcagaactt tggcggatta caacatccag       480
     aaggagtcta cgcttcattt ggtcttgcgt ctgcgtggag gtatgcagat cttcgtaaag       540
     actttgaccg gaaagaccat cactcttgaa gttgagagct ccgacaccat tgataacgtg       600
     aaggctaaga tccaggacaa ggaaggcatt cctccggacc agcagcgtct catcttcgct       660
     ggaaagcagc ttgaggatgg acgtactttg gccgactaca acatccagaa ggagtctact       720
     cttcacttgg tcctccgtct ccgtggtggt ttctaaacct tgtctctctc tcttatggtt       780
     actgaaccaa gttcatgtat cgtttcatct agtactttgg tggtttatgt tttggggcca       840
     tgtacagcct ctgataaata attgatcgac tatgtttccg tttc                        884
//

If you have problems or comments...

PBIL Back to PBIL home page