(data stored in SCRATCH zone)

EMBL: AY056313

ID   AY056313; SV 1; linear; mRNA; STD; PLN; 730 BP.
XX
AC   AY056313;
XX
DT   02-OCT-2001 (Rel. 69, Created)
DT   20-SEP-2002 (Rel. 73, Last updated, Version 3)
XX
DE   Arabidopsis thaliana putative caffeoyl-CoA O-methyltransferase (At4g26220)
DE   mRNA, complete cds.
XX
KW   FLI_CDNA.
XX
OS   Arabidopsis thaliana (thale cress)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae;
OC   rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis.
XX
RN   [1]
RP   1-730
RA   Yamada K., Liu S.X., Sakano H., Pham P.K., Banh J., Etgu P., Lee J.M.,
RA   Toriumi M., Yu G., Brooks S., Chao Q., Chen H., Karlin-Neumann G., Kim C.,
RA   Lam B., Miranda M., Nguyen M., Palm C.J., Shinn P., Southwick A.,
RA   Davis R.W., Ecker J.R., Theologis A.;
RT   "Arabidopsis Open Reading Frame (ORF) Clones";
RL   Unpublished.
XX
RN   [2]
RP   1-730
RA   Yamada K., Banh J., Banno F., Dale J.M., Goldsmith A.D., Lee J.M.,
RA   Onodera C.S., Quach H.L., Tang C.C., Toriumi M., Yamamura Y., Yu G., Yu S.,
RA   Bowser L., Carninci P., Chen H., Cheuk R., Hayashizaki Y., Ishida J.,
RA   Jones T., Kamiya A., Karlin-Neumann G., Kawai J., Kim C., Koesema E.,
RA   Lam B., Lin J., Meyers M.C., Miranda M., Narusaka M., Nguyen M., Palm C.J.,
RA   Sakurai T., Satou M., Seki M., Shinn P., Southwick A., Tracy S.E.,
RA   Shinozaki K., Davis R.W., Ecker J.R., Theologis A.;
RT   ;
RL   Submitted (09-SEP-2001) to the INSDC.
RL   Plant Gene Expression Center, 800 Buchanan Street, Albany, CA 94710, USA
XX
DR   MD5; 702d2143721074efd2e6147a5b368008.
XX
CC   The RIKEN Genomic Sciences Center (GSC) members carried out the
CC   collection and clustering of RAFL cDNAs (RAFL cDNA : 'RIKEN
CC   Arabidopsis  Full-Length  cDNA'): Seki,M., Narusaka,M.,  Ishida,J.,
CC    Satou,M.,  Kamiya,A., Sakurai,T., Carninci,P.,  Kawai, J.,
CC   Hayashizaki,Y.  and  Shinozaki,K.
CC   The Salk, Stanford, PGEC (SSP) Consortium members constructed and
CC   sequenced the pUNI (ORF) clones using the RAFL cDNAs: Yamada,K.,
CC   Banh,J., Banno,F., Dale,J.M., Goldsmith,A.D., Lee,J.M.,
CC   Onodera,C.S., Quach,H.L., Tang,C.C., Toriumi,M., Yamamura,Y.,
CC   Yu,G., Yu,S., Bowser,L., Chen,H., Cheuk,R., Jones,T.,
CC   Karlin-Neumann,G., Kim,C., Koesema,E., Lam,B., Lin,J., Meyers,M.C.,
CC   Miranda,M., Nguyen,M., Palm,C.J., Shinn,P., Southwick,A.,
CC   Tracy,S.E., Davis,R.W., Ecker,J.R. and Theologis,A.
CC   Yamada,K. (SSP/PGEC) and Seki, M. (RIKEN GSC) contributed equally
CC   to this work.  Shinozaki,K. (RIKEN GSC) and Theologis,A. (SSP
CC   /PGEC) contributed equally to this work as PIs.
CC   Annotation is based on the January 2002 version of the Arabidopsis
CC   genome submitted to GenBank.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..730
FT                   /organism="Arabidopsis thaliana"
FT                   /chromosome="4"
FT                   /mol_type="mRNA"
FT                   /clone="U09428"
FT                   /note="This clone is in pUNI 51. ecotype: Columbia"
FT                   /db_xref="taxon:3702"
FT   CDS_pept        1..699
FT                   /codon_start=1
FT                   /gene="At4g26220"
FT                   /product="putative caffeoyl-CoA O-methyltransferase"
FT                   /db_xref="GOA:Q9C5D7"
FT                   /db_xref="InterPro:IPR002935"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9C5D7"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT                   /protein_id="AAL07162.1"
FT                   /translation="MAKDEAKGLLKSEELYKYILETSVYPREPEVLRELRNITHNHPQA
FT                   GMATAPDAGQLMGMLLNLVNARKTIEVGVFTGYSLLLTALTLPEDGKVIAIDMNRDSYE
FT                   IGLPVIKKAGVEHKIDFKESEALPALDELLNNKVNEGGFDFAFVDADKLNYWNYHERLI
FT                   RLIKVGGIIVYDNTLWGGSVAEPDSSTPEWRIEVKKATLELNKKLSADQRVQISQAALG
FT                   DGITICRRLY"
FT   3'UTR           700..730
FT                   /gene="At4g26220"
XX
SQ   Sequence 730 BP; 205 A; 140 C; 195 G; 190 T; 0 other;
     atggctaagg atgaagccaa gggattgctg aaaagtgaag agctctataa atatatactg        60
     gagactagtg tgtacccacg cgagccagag gttctcaggg agcttaggaa cattactcat       120
     aaccaccctc aagctggtat ggctactgca ccagacgctg gccagttgat ggggatgctg       180
     ctgaatctgg taaatgcaag aaagactatc gaggttgggg ttttcactgg atactctctt       240
     ctcctcactg ctcttacgct accagaagat ggcaaggtta tcgccattga catgaataga       300
     gactcgtatg aaataggatt gccggttata aagaaagctg gtgttgaaca caaaattgat       360
     ttcaaagagt ctgaagctct tccagccctc gacgagcttt taaacaataa agtgaatgag       420
     ggtggattcg acttcgcatt tgtggatgca gacaagctga attattggaa ctatcatgag       480
     aggcttatta gattgatcaa ggttggtggg atcatagtgt atgataacac tctctgggga       540
     ggatcagttg ctgaaccgga ctcgtccacg cccgagtgga ggatagaagt caagaaagca       600
     accctcgagc tgaacaagaa actctcggct gatcagcgtg tgcagatctc gcaagctgcg       660
     cttggcgatg gtatcactat ttgcaggagg ttatattgag cgagtattgt tgttctttgt       720
     gatctttagg                                                              730
//

If you have problems or comments...

PBIL Back to PBIL home page