(data stored in SCRATCH zone)

EMBL: AY056412

ID   AY056412; SV 1; linear; mRNA; STD; PLN; 1749 BP.
XX
AC   AY056412;
XX
DT   05-OCT-2001 (Rel. 69, Created)
DT   05-OCT-2001 (Rel. 69, Last updated, Version 1)
XX
DE   Arabidopsis thaliana AT5g01210/F7J8_190 mRNA, complete cds.
XX
KW   FLI_CDNA.
XX
OS   Arabidopsis thaliana (thale cress)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae;
OC   rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis.
XX
RN   [1]
RP   1-1749
RA   Cheuk R., Chen H., Kim C.J., Koesema E., Meyers M.C., Banh J., Bowser L.,
RA   Carninci P., Dale J.M., Goldsmith A.D., Hayashizaki Y., Ishida J.,
RA   Jiang P.X., Jones T., Kamiya A., Karlin-Neumann G., Kawai J., Lam B.,
RA   Lee J.M., Lin J., Liu S.X., Miranda M., Narusaka M., Nguyen M.,
RA   Onodera C.S., Palm C.J., Pham P.K., Quach H.L., Sakurai T., Satou M.,
RA   Seki M., Southwick A., Tang C.C., Toriumi M., Yamada K., Yamamura Y.,
RA   Yu G., Yu S., Shinozaki K., Davis R.W., Theologis A., Ecker J.R.;
RT   "Arabidopsis cDNA clones";
RL   Unpublished.
XX
RN   [2]
RP   1-1749
RA   Cheuk R., Chen H., Kim C.J., Koesema E., Meyers M.C., Banh J., Bowser L.,
RA   Carninci P., Dale J.M., Goldsmith A.D., Hayashizaki Y., Ishida J.,
RA   Jiang P.X., Jones T., Kamiya A., Karlin-Neumann G., Kawai J., Lam B.,
RA   Lee J.M., Lin J., Liu S.X., Miranda M., Narusaka M., Nguyen M.,
RA   Onodera C.S., Palm C.J., Pham P.K., Quach H.L., Sakurai T., Satou M.,
RA   Seki M., Southwick A., Tang C.C., Toriumi M., Yamada K., Yamamura Y.,
RA   Yu G., Yu S., Shinozaki K., Davis R.W., Theologis A., Ecker J.R.;
RT   ;
RL   Submitted (10-SEP-2001) to the INSDC.
RL   Salk Institute Genomic Analysis Laboratory (SIGnAL), Plant Biology
RL   Laboratory, The Salk Institute for Biological Studies, 10010 N. Torrey
RL   Pines Road, La Jolla, CA 92037, USA
XX
DR   MD5; 1a7c89a17c0b09bf6ea992c3b07e80e6.
XX
CC   RIKEN Genomic Sciences Center (GSC) members carried out the
CC   collection and clustering of RAFL cDNAs (RAFL cDNA : 'RIKEN
CC   Arabidopsis Full-Length cDNA') :  Seki,M., Narusaka,M., Ishida,J.,
CC   Satou,M., Kamiya,A., Sakurai,T., Carninci,P.,  Kawai,J.,
CC   Hayashizaki,Y. and Shinozaki,K.
CC   The Salk, Stanford, PGEC (SSP) Consortium members carried out the
CC   sequencing and annotation of the RAFL cDNAs: Cheuk,R., Chen,H.,
CC   Kim,C.J., Koesema,E., Meyers,M.C., Shinn,P., Banh,J. Bowser,L.,
CC   Dale,J.M., Goldsmith,A.D., Jiang,P.X., Jones,T., Karlin-Neumann,G.,
CC   Lam,B., Lee,J.M., Lin,J., Liu,S.X., Miranda,M., Nguyen,M.,
CC   Onodera,C.S., Palm,C.J., Pham,P.K., Quach,H.L., Southwick,A.,
CC   Tang,C.C., Toriumi,M., Yamada,K., Yamamura, Y., Yu,G., Yu,S.,
CC   Davis,R.W.,  Theologis,A., and Ecker,J.R.
CC   Cheuk,R. (SSP/Salk) and Seki,M. (RIKEN GSC) contributed equally to
CC   this work.  Shinozaki,K. (RIKEN GSC) and Ecker,J.R. (SSP/Salk)
CC   contributed equally to this work as PIs.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1749
FT                   /organism="Arabidopsis thaliana"
FT                   /chromosome="5"
FT                   /mol_type="mRNA"
FT                   /clone="RAFL09-32-I18(R14297)"
FT                   /note="ecotype: Columbia"
FT                   /db_xref="taxon:3702"
FT   5'UTR           1..80
FT   CDS_pept        81..1508
FT                   /codon_start=1
FT                   /product="AT5g01210/F7J8_190"
FT                   /note="anthranilate N-benzoyltransferase-like protein"
FT                   /db_xref="GOA:Q9LFB5"
FT                   /db_xref="InterPro:IPR003480"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="UniProtKB/TrEMBL:Q9LFB5"
FT                   /protein_id="AAL08268.1"
FT                   /translation="MPSCSVTEISKCIVYPEKKSTVSDLRLSVSDLPMLSCHYIQKGVL
FT                   LTSPPPSFSFDDLVSSLRRSLSSTLSLFPALAGRFSTTPAGHISIVCNDAGVDFVAASA
FT                   KHVKLSDVLLPGEDVPLLFREFFVFERLVSYNGHHKPLAAVQVTELHDGVFIGCTVNHS
FT                   VTDGTSFWHFFNTFADVTSGACKIKHLPDFSRHTVFDSPVVLPVPPGGPRVTFDADQPL
FT                   RERIFHFSREAITKLKQRTNNRVNGIETAVNDGRKCNGEINGKITTVLDSFLNNKKSYD
FT                   RTAEISSFQSLSAQLWRSVTRARNLDPSKTTTFRMAVNCRHRLEPKMDPYYFGNAIQSI
FT                   PTLASAGDLLSKDLRWSAEQLHRNVVAHDDATVRRGIAAWESDPRLFPLGNPDGASITM
FT                   GSSPRFPMYDNDFGWGKPLAVRSGGANKFDGKISAFPGREGNGSVDLEVVLAPETMTGI
FT                   ENDAEFMQYVSEVTYDC"
FT   3'UTR           1509..1749
XX
SQ   Sequence 1749 BP; 442 A; 444 C; 396 G; 467 T; 0 other;
     tactcatcac caatacgggc aagttaaacc cataactccc aaaatccata tcctctttaa        60
     aacatttttg tccaaataaa atgccttctt gttcggtaac tgaaatttca aaatgtatcg       120
     tctatccgga gaagaagtcc accgtctccg atctccgtct ctccgtctcc gacctcccta       180
     tgctctcatg tcattacatt caaaaaggcg tcctcctcac cagccctcct ccttccttct       240
     ccttcgacga ccttgtctcc tctctccgcc gttctctctc ctccactctt tccctcttcc       300
     ctgctttagc cggccgtttc tccaccactc ccgccggtca catttccatt gtctgcaacg       360
     acgccggagt tgatttcgtc gccgcttccg ctaaacacgt caaactctct gatgttctct       420
     taccaggtga agacgttcct ctgcttttcc gtgagttttt cgtcttcgag cgtctcgtta       480
     gttacaacgg tcatcataag cctctcgccg ccgttcaagt gacggagctc cacgacggtg       540
     tcttcatcgg atgtaccgtg aatcattccg ttactgacgg aacttccttc tggcacttct       600
     tcaacacctt tgctgacgtc actagcggtg cttgtaagat caaacacctt ccagatttct       660
     cccgccacac cgtcttcgat tctccggtcg ttcttccagt ccctcccggt ggtccacgtg       720
     tcactttcga cgccgaccaa cctctacggg agagaatttt tcatttcagc agagaggcga       780
     ttaccaaact gaaacagagg acgaataaca gagttaacgg aattgagact gccgttaacg       840
     atggaaggaa atgtaacgga gagattaacg gaaaaataac aaccgttttg gatagttttt       900
     tgaataataa gaagagttat gatcggacgg ctgagatttc atcgttccaa tctctcagcg       960
     ctcagctatg gcgatccgtt acacgagcga ggaatctcga tccgagcaag acgacgacgt      1020
     ttcgaatggc ggttaattgc cggcaccggc ttgagccgaa gatggatccg tactacttcg      1080
     gaaacgcgat acagagcata ccgacgttgg cgtctgcggg agatctgcta agcaaagatc      1140
     tcaggtggtc cgccgaacag ttacacagga acgtggtggc gcacgacgac gcgacggtcc      1200
     gccgtggaat cgccgcttgg gaaagcgatc cgaggctgtt tcctctcgga aatccagatg      1260
     gagcttcgat cacgatgggg agctcgccga gattcccaat gtacgacaat gatttcggat      1320
     ggggaaaacc gttagctgtg agaagcggcg gagcgaataa attcgacggg aagatctcgg      1380
     cgtttcccgg tagagaagga aacggaagcg tggatctgga agtagttctg gcgccggaga      1440
     ctatgactgg gattgagaac gatgctgagt ttatgcaata cgtatcagaa gtcacttacg      1500
     attgttgaaa acgacgtagt ttctgataca gaggaaaaaa aagcaaatat ctaaagtgat      1560
     agaggaactt aatggcatgg cactttggac ggttgagatt tatctataaa gtttttagat      1620
     atttcgatct gagagttgtg aagcgaacga cgtcttatga gtcaatctac tggtcttaat      1680
     gtgacagtgt attattaatg tacaaaatcc cgtctttttc aagtttttct ttctaaatta      1740
     aaaaaaaat                                                              1749
//

If you have problems or comments...

PBIL Back to PBIL home page