(data stored in ACNUC13479 zone)

EMBL: AY062859

ID   AY062859; SV 1; linear; mRNA; STD; PLN; 520 BP.
XX
AC   AY062859;
XX
DT   27-NOV-2001 (Rel. 69, Created)
DT   16-APR-2005 (Rel. 83, Last updated, Version 2)
XX
DE   Arabidopsis thaliana light-inducible protein ATLS1 (F7A7.17) mRNA, complete
DE   cds.
XX
KW   FLI_CDNA.
XX
OS   Arabidopsis thaliana (thale cress)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae;
OC   rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis.
XX
RN   [1]
RP   1-520
RA   Southwick A., Karlin-Neumann G., Nguyen M., Lam B., Miranda M., Palm C.J.,
RA   Bowser L., Jones T., Banh J., Carninci P., Chen H., Cheuk R., Chung M.K.,
RA   Hayashizaki Y., Ishida J., Kamiya A., Kawai J., Kim C., Lin J., Liu S.X.,
RA   Narusaka M., Pham P.K., Sakano H., Sakurai T., Satou M., Seki M., Shinn P.,
RA   Yamada K., Shinozaki K., Ecker J., Theologis A., Davis R.W.;
RT   ;
RL   Submitted (14-NOV-2001) to the INSDC.
RL   DNA Sequencing and Technology Center, Stanford University, 855 California
RL   Avenue, Palo Alto, CA 94304, USA
XX
DR   MD5; 360acfa240c58d4a6702fc4402749cb5.
XX
CC   e-mail for correspondence:  arab@sequence.stanford.edu
CC   RIKEN Genomic Sciences Center (GSC) members  carried out the
CC   collection and clustering of RAFL cDNAs (RAFL cDNA : ''RIKEN
CC   Arabidopsis  Full-Length cDNA''): Seki,M., Narusaka,M., Ishida,J.,
CC   Satou,M.,  Kamiya,A., Sakurai,T., Carninci,P., Kawai,J.,
CC   Hayashizaki,Y. and  Shinozaki,K.
CC   The Salk, Stanford, PGEC (SSP) Consortium members carried out  the
CC   sequencing and annotation of the RAFL cDNAs: Nguyen,M.,
CC   Southwick,A.,  Karlin-Neumann,G.,  Lam,B., Miranda,M., Palm,C.J.,
CC   Bowser,L., Jones,T.,  Banh,J., Chen,H., Cheuk,R., Chung,M.K.,
CC   Kim,C., Lin,J., Liu,S.X., Pham,P.K.,  Sakano,H., Shinn,P.,
CC   Yamada,K., Ecker,J., Theologis,A. and  Davis,R.W.
CC   Southwick,A., (SSP/Stanford) and Seki,M. (RIKEN GSC) contributed
CC   equally to this work.  Shinozaki,K. (RIKEN GSC) and Davis,R.W.
CC   (SSP/Stanford)  contributed equally to this work as PIs.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..520
FT                   /organism="Arabidopsis thaliana"
FT                   /chromosome="V"
FT                   /mol_type="mRNA"
FT                   /clone="RAFL06-08-C02"
FT                   /note="This clone is in pBluescript ecotype: Columbia"
FT                   /db_xref="taxon:3702"
FT   CDS_pept        67..414
FT                   /codon_start=1
FT                   /gene="F7A7.17"
FT                   /product="light-inducible protein ATLS1"
FT                   /db_xref="InterPro:IPR001398"
FT                   /db_xref="InterPro:IPR014347"
FT                   /db_xref="UniProtKB/TrEMBL:Q9M011"
FT                   /protein_id="AAL32937.1"
FT                   /translation="MPCLNLSTNVNLDGVDTSSILSEASSTVAKIIGKPENYVMIVLKG
FT                   SVPMSFGGTEDPAAYGELVSIGGLNADVNKKLSAAVSAILETKLSVPKSRFFLKFYDTK
FT                   GSFFGWNGATL"
XX
SQ   Sequence 520 BP; 132 A; 115 C; 119 G; 154 T; 0 other;
     actctcttta tccgcttgac taaaaaaaat tggcgtcgag tgatagagac gaagaagaag        60
     aagaaaatgc cgtgcctcaa cctctccacc aacgttaacc ttgacggcgt cgatacatct       120
     tccattctct cggaagcttc ctccaccgtc gcgaaaatca tcggcaagcc tgagaactat       180
     gtgatgattg tcttgaaagg ctcagtgcct atgtcatttg gcgggaccga ggatcctgca       240
     gcttatggtg aattagtttc tatcggtggc cttaatgcgg atgtgaacaa gaagctaagc       300
     gctgctgttt ccgccattct tgagactaag ctatcggtgc ccaagtctcg attcttcctc       360
     aagttttatg acaccaaggg atccttcttt ggttggaacg gggcgactct ttaattccgt       420
     ggtaggtgat tagtgtgatt gtcttgaaat gtatgatcta ctctcatcga tcaagtaact       480
     ttgaactact tcgtattgta aacatatcta aggtttgatg                             520
//

If you have problems or comments...

PBIL Back to PBIL home page