(data stored in SCRATCH zone)

EMBL: AY063002

ID   AY063002; SV 1; linear; mRNA; STD; PLN; 400 BP.
XX
AC   AY063002;
XX
DT   28-NOV-2001 (Rel. 69, Created)
DT   20-SEP-2002 (Rel. 73, Last updated, Version 3)
XX
DE   Arabidopsis thaliana unknown protein (AT4g26210) mRNA, complete cds.
XX
KW   FLI_CDNA.
XX
OS   Arabidopsis thaliana (thale cress)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae;
OC   rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis.
XX
RN   [1]
RP   1-400
RA   Yamada K., Liu S.X., Sakano H., Pham P.K., Banh J., Etgu P., Lee J.M.,
RA   Toriumi M., Yu G., Brooks S., Chao Q., Chen H., Karlin-Neumann G., Kim C.,
RA   Lam B., Miranda M., Nguyen M., Palm C.J., Shinn P., Southwick A.,
RA   Davis R.W., Ecker J.R., Theologis A.;
RT   "Arabidopsis Open Reading Frame (ORF) Clones";
RL   Unpublished.
XX
RN   [2]
RP   1-400
RA   Yamada K., Banh J., Banno F., Chang E., Dale J.M., Goldsmith A.D.,
RA   Lee J.M., Onodera C.S., Quach H.L., Tang C.C., Toriumi M., Wu H.C.,
RA   Yamamura Y., Yu G., Yu S., Bowser L., Carninci P., Chen H., Cheuk R.,
RA   Hayashizaki Y., Ishida J., Jones T., Kamiya A., Karlin-Neumann G.,
RA   Kawai J., Kim C., Koesema E., Lam B., Lin J., Meyers M.C., Miranda M.,
RA   Narusaka M., Nguyen M., Palm C.J., Sakurai T., Satou M., Seki M., Shinn P.,
RA   Southwick A., Shinozaki K., Davis R.W., Ecker J.R., Theologis A.;
RT   ;
RL   Submitted (15-NOV-2001) to the INSDC.
RL   Plant Gene Expression Center, 800 Buchanan Street, Albany, CA 94710, USA
XX
DR   MD5; cbc34c80f6dfc36abdf854cb84ef2208.
XX
CC   The RIKEN Genomic Sciences Center (GSC) members carried out the
CC   collection and clustering of RAFL cDNAs (RAFL cDNA : 'RIKEN
CC   Arabidopsis  Full-Length  cDNA'): Seki,M., Narusaka,M.,  Ishida,J.,
CC    Satou,M.,  Kamiya,A., Sakurai,T., Carninci,P.,  Kawai, J.,
CC   Hayashizaki,Y.  and  Shinozaki,K.
CC   The Salk, Stanford, PGEC (SSP) Consortium members constructed and
CC   sequenced the pUNI (ORF) clones using the RAFL cDNAs: Yamada,K.,
CC   Banh,J., Banno,F., Chang,E., Dale,J.M., Goldsmith,A.D., Lee,J.M.,
CC   Onodera,C.S., Quach,H.L., Tang,C.C., Toriumi,M., Wu,H.C.,
CC   Yamamura,Y., Yu,G., Yu,S., Bowser,L., Chen,H., Cheuk,R., Jones,T.,
CC   Karlin-Neumann,G., Kim,C., Koesema,E., Lam,B., Lin,J., Meyers,M.C.,
CC   Miranda,M., Nguyen,M., Palm,C.J., Shinn,P., Southwick,A.,
CC   Davis,R.W., Ecker,J.R. and Theologis,A.
CC   Yamada,K. (SSP/PGEC) and Seki, M. (RIKEN GSC) contributed equally
CC   to this work.  Shinozaki,K. (RIKEN GSC) and Theologis,A. (SSP
CC   /PGEC) contributed equally to this work as PIs.
CC   Annotation is based on the January 2002 version of the Arabidopsis
CC   genome submitted to GenBank.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..400
FT                   /organism="Arabidopsis thaliana"
FT                   /chromosome="4"
FT                   /mol_type="mRNA"
FT                   /clone="U09994"
FT                   /note="This clone is in pUNI 51. ecotype: Columbia"
FT                   /db_xref="taxon:3702"
FT   CDS_pept        1..369
FT                   /codon_start=1
FT                   /gene="AT4g26210"
FT                   /product="unknown protein"
FT                   /db_xref="GOA:Q9STR3"
FT                   /db_xref="InterPro:IPR006808"
FT                   /db_xref="UniProtKB/TrEMBL:Q9STR3"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT                   /protein_id="AAL34176.1"
FT                   /translation="MASKLLQLKSKACEASKFVSKHGTTYYKQLLDKNKMYIQEPATIE
FT                   KCNELSKQLLYTRLASIPGRSESFWKEVNHVKGLWKNRADLKVEDAGIAALFGLECFAW
FT                   YCAGEIVGRGFTFTGYYP"
FT   3'UTR           370..400
FT                   /gene="AT4g26210"
XX
SQ   Sequence 400 BP; 122 A; 76 C; 98 G; 104 T; 0 other;
     atggcatcaa agttgctaca attgaaatcc aaggcatgtg aagcatcaaa gtttgtttcc        60
     aagcatggaa caacttacta caaacagttg ctggataaga acaagatgta tatccaggag       120
     ccagctacta tagagaaatg caatgaattg tctaagcagc ttctctacac tcgtcttgct       180
     agcattcctg ggcgttctga gtcattttgg aaggaagtca atcacgtgaa gggtttatgg       240
     aagaatcggg cggatttgaa ggttgaagat gctggaatag ctgcactttt tggtctggaa       300
     tgctttgcgt ggtactgtgc aggagagatt gtaggaaggg gcttcacttt caccggctac       360
     tacccttgaa gaaagaaagc aaccccctca taaacaaaca                             400
//

If you have problems or comments...

PBIL Back to PBIL home page