(data stored in ACNUC7421 zone)

EMBL: AY072351

ID   AY072351; SV 1; linear; mRNA; STD; PLN; 1096 BP.
XX
AC   AY072351;
XX
DT   22-JAN-2002 (Rel. 70, Created)
DT   16-APR-2005 (Rel. 83, Last updated, Version 2)
XX
DE   Arabidopsis thaliana enoyl CoA hydratase-like protein (At5g43280) mRNA,
DE   complete cds.
XX
KW   FLI_CDNA.
XX
OS   Arabidopsis thaliana (thale cress)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae;
OC   rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis.
XX
RN   [1]
RP   1-1096
RA   Nguyen M., Karlin-Neumann G., Southwick A., Lam B., Miranda M., Palm C.J.,
RA   Bowser L., Jones T., Banh J., Carninci P., Chen H., Cheuk R., Chung M.K.,
RA   Hayashizaki Y., Ishida J., Kamiya A., Kawai J., Kim C., Lin J., Liu S.X.,
RA   Narusaka M., Pham P.K., Sakano H., Sakurai T., Satou M., Seki M., Shinn P.,
RA   Yamada K., Shinozaki K., Ecker J., Theologis A., Davis R.W.;
RT   ;
RL   Submitted (02-JAN-2002) to the INSDC.
RL   DNA Sequencing and Technology Center, Stanford University, 855 California
RL   Avenue, Palo Alto, CA 94304, USA
XX
DR   MD5; 83ba72593273e46957c62c33a69e0bba.
XX
CC   e-mail for correspondence: arab@sequence.stanford.edu
CC   RIKEN Genomic Sciences Center (GSC) members carried out the
CC   collection and clustering of RAFL cDNAs (RAFL cDNA : 'RIKEN
CC   Arabidopsis  Full-Length cDNA'): Seki,M., Narusaka,M., Ishida,J.,
CC   Satou,M., Kamiya,A., Sakurai,T., Carninci,P., Kawai,J.,
CC   Hayashizaki,Y. and Shinozaki,K.
CC   The Salk, Stanford, PGEC (SSP) Consortium members carried out the
CC   sequencing and annotation of the RAFL cDNAs: Nguyen,M.,
CC   Southwick,A., Karlin-Neumann,G.,  Lam,B., Miranda,M., Palm,C.J.,
CC   Bowser,L., Jones,T., Banh,J., Chen,H., Cheuk,R., Chung,M.K.,
CC   Kim,C., Lin,J., Liu,S.X., Pham,P.K., Sakano,H., Shinn,P.,
CC   Yamada,K., Ecker,J., Theologis,A. and Davis,R.W.
CC   Nguyen,M, (SSP/Stanford) and Seki,M. (RIKEN GSC) contributed
CC   equally to this work.  Shinozaki,K. (RIKEN GSC) and Davis,R.W.
CC   (SSP/Stanford)  contributed equally to this work as PIs.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1096
FT                   /organism="Arabidopsis thaliana"
FT                   /chromosome="5"
FT                   /mol_type="mRNA"
FT                   /clone="RAFL11-10-D22"
FT                   /note="This clone is in pBluescript ecotype: Columbia"
FT                   /db_xref="taxon:3702"
FT   CDS_pept        60..896
FT                   /codon_start=1
FT                   /gene="At5g43280"
FT                   /product="enoyl CoA hydratase-like protein"
FT                   /db_xref="GOA:Q9FHR8"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9FHR8"
FT                   /protein_id="AAL62343.1"
FT                   /translation="MTMESYKTLEIIRKNTDSSVFHLIINRPSHLNALSLDFFIEFPKA
FT                   LSSLDQNPDVSVIILSGAGKHFCSGIDLNSLSSISTQSSSGNDRGRSSEQLRRKIKSMQ
FT                   AAITAIEQCRKPVIAAIHGACIGGGVDLITACDIRYCSEDAFFSIKEVDLAIVADLGTL
FT                   QRLPSIVGYANAMELALTARRFSGSEAKDLGLVSKVFGSKSELDNGVTTIAEGIGGKSP
FT                   LAVTGTKAVLLRSREVSVEQGLDYVATWNSAMLISDDLNEAVSAQMMKRKPRFAKL"
XX
SQ   Sequence 1096 BP; 305 A; 242 C; 220 G; 329 T; 0 other;
     attagctcat atgatcatat tcctttaacc ttatcatcat catcactgta tttcaaacta        60
     tgacaatgga gtcatacaaa accctagaaa tcattcgcaa gaacactgat tcctccgtat       120
     ttcatctcat catcaacaga ccatcacatc tcaacgcctt atctctcgat ttcttcatcg       180
     aattccccaa agctctctca tctctcgacc aaaatccaga tgtctccgtc atcatcctct       240
     ccggcgccgg aaaacacttc tgctccggta tcgatctcaa ttccctctct tcaatctcga       300
     cacaatcctc ctccggtaac gacagaggac gatctagcga gcagctacgc cgtaagatca       360
     agtcgatgca agcggcgatt acagcgattg aacaatgccg gaaacctgta atcgccgcta       420
     ttcacggcgc gtgtatcggt ggcggtgttg atctgattac cgcttgtgat attaggtatt       480
     gctctgagga tgcgtttttc tcgattaaag aggttgatct agcgattgtt gcggatcttg       540
     gtacacttca gcgattaccg agtatcgttg ggtatgctaa cgccatggaa ttggctttaa       600
     ctgctcggag attctctgga agtgaagcaa aggatcttgg tttggtttct aaagttttcg       660
     gatctaaatc ggagcttgat aatggcgtca ctacaatcgc cgaaggaata ggaggcaagt       720
     ctcctttagc tgtgacaggg acaaaggcag tgttattaag aagcagagag gtgagtgtag       780
     aacaaggact tgactatgta gcaacttgga actcggctat gcttatatca gatgatctca       840
     acgaagctgt ttctgctcag atgatgaaaa gaaaacctcg gtttgctaaa ctttgataca       900
     gtctctctgt tgcttcttta tctttcaaag ctcttctggt aactaaagta ataagatatt       960
     acttcaaata agtttagtta ttgatagttc cctaattacg gattagggct atagataaaa      1020
     tggtcttcta cacatgagaa tatgattaat actctgcaca atgcatattg gtaaatgcta      1080
     tacctcaatg tttatt                                                      1096
//

If you have problems or comments...

PBIL Back to PBIL home page