(data stored in ACNUC31108 zone)

EMBL: AY072785

ID   AY072785; SV 1; linear; mRNA; STD; MAM; 1227 BP.
XX
AC   AY072785;
XX
DT   05-FEB-2002 (Rel. 70, Created)
DT   16-APR-2005 (Rel. 83, Last updated, Version 3)
XX
DE   Sus scrofa CD9 antigen (CD9) mRNA, complete cds.
XX
KW   .
XX
OS   Sus scrofa (pig)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Laurasiatheria; Artiodactyla; Suina; Suidae; Sus.
XX
RN   [1]
RP   1-1227
RX   DOI; 10.1159/000074170.
RX   PUBMED; 14610355.
RA   Yubero N., Jimenez-Marin A., Yerle M., Morera L., Barbancho M.J.,
RA   Llanes D., Garrido J.J.;
RT   "Molecular cloning, expression pattern and chromosomal mapping of pig CD9
RT   antigen";
RL   Cytogenet. Genome Res. 101(2):143-146(2003).
XX
RN   [2]
RP   1-1227
RA   Yubero N., Barbancho M.J., Llanes D., Garrido J.J.;
RT   ;
RL   Submitted (10-JAN-2002) to the INSDC.
RL   Unidad Mixta CSIC-UCO Marcadores Geneticos Moleculares, Departamento de
RL   Genetica, Facultad de Veterinaria, Universidad de Cordoba, Campus de
RL   Rabanales, Edificio C5, Cordoba 14071, Spain
XX
DR   MD5; e7ff66b68f021a2abbfa5760cfa49197.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1227
FT                   /organism="Sus scrofa"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9823"
FT   gene            1..1227
FT                   /gene="CD9"
FT   CDS_pept        96..776
FT                   /codon_start=1
FT                   /gene="CD9"
FT                   /product="CD9 antigen"
FT                   /db_xref="GOA:Q8WMQ3"
FT                   /db_xref="InterPro:IPR000301"
FT                   /db_xref="InterPro:IPR008952"
FT                   /db_xref="InterPro:IPR018499"
FT                   /db_xref="InterPro:IPR018503"
FT                   /db_xref="InterPro:IPR042055"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8WMQ3"
FT                   /protein_id="AAL68966.1"
FT                   /translation="MPVKGGTKCIKYLLFGFNFIFWLAGIAVLAIGLWLRFDSQTKSIF
FT                   EQENNNSSFYTGVYILIGAGALMMVVGFLGCCGAVQESQCMLGLFFGFLLVIFAIEIAA
FT                   AIWGYSHKDQVIKEVQDFYRDTYNKLKGKDDPQRETLKAIHYALDCCGLMGEVEQLLAD
FT                   ICPQRDVLSSLPMKPCPEAIKEVFQNKFHIIGAVGIGIAVVMIFGMIFSMILCCAIRRS
FT                   REMV"
FT   regulatory      1185..1190
FT                   /gene="CD9"
FT                   /regulatory_class="polyA_signal_sequence"
XX
SQ   Sequence 1227 BP; 313 A; 278 C; 287 G; 349 T; 0 other;
     ggcacgagct tcgctccgca gtccagtccc gtgtgtctcg gccgcaagcg ccctcgtccc        60
     gcacccgtcc ggcccaggcc agtctagccc gcaccatgcc ggtcaaagga ggcactaagt       120
     gtatcaaata cttgctcttc ggatttaact tcatcttctg gctcgctggg attgcggtcc       180
     ttgccattgg actatggctc cgatttgact ctcagaccaa gagcatcttc gagcaagaaa       240
     ataataactc tagcttctac acaggagttt atattctcat tggagccggc gccctcatga       300
     tggtggtggg cttcctgggc tgctgcgggg ccgtgcagga gtcccagtgc atgctgggct       360
     tgttctttgg cttcctcttg gtgatatttg ccattgaaat agccgcggcc atctggggat       420
     attcccacaa ggatcaggtg atcaaagaag tccaggattt ctacagggac acttacaaca       480
     agctgaaggg caaggacgac ccccagcggg agactctgaa agccatccac tatgcgctgg       540
     actgctgtgg tttaatgggg gaagtggaac aacttctggc agacatctgc ccccaaaggg       600
     acgtactctc aagcctccca atgaagccct gccctgaggc catcaaagag gtcttccaaa       660
     acaagttcca catcattggc gccgtgggca ttgggatcgc cgtggtgatg attttcggca       720
     tgatcttcag catgatcctg tgctgtgcca tccgtcggag ccgagagatg gtctagagtc       780
     agcctcgcag ccctgagcag gaaagtcctc ccctgaagac tattggtcat cttctcgggg       840
     tcctgtttgt atttcttttg gttttctttg ccactaactt tagtattcag tctgcatttc       900
     taaacaaaac aaaaaaaaag ttattctatg tttatgtttg taatgcttta ttcaatattg       960
     atatttgtag ttaaggggtt tgggtttgct cgggtttata tttgtttggt catttgtttt      1020
     tgcttattat gtaaagcaga aatcctgcaa tgaaaggtac tatatttgct agactctaga      1080
     caaaagatat tgtatataaa gagttttttt tctttaaata gataaaaaaa tgtcctatca      1140
     aatttaatca ggttgtaact tatgttaaag acaatttgat acataataaa agatgatgca      1200
     acgtcctgaa aaaaaaaaaa aaaaaaa                                          1227
//

If you have problems or comments...

PBIL Back to PBIL home page