(data stored in ACNUC7820 zone)

EMBL: AY073016

ID   AY073016; SV 1; linear; genomic DNA; STD; MUS; 930 BP.
XX
AC   AY073016;
XX
DT   05-FEB-2002 (Rel. 70, Created)
DT   04-APR-2002 (Rel. 71, Last updated, Version 3)
XX
DE   Mus musculus olfactory receptor MOR139-1 gene, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-930
RX   PUBMED; 11802173.
RA   Zhang X., Firestein S.;
RT   "The olfactory receptor gene superfamily of the mouse";
RL   Nat. Neurosci. 5(2):124-133(2002).
XX
RN   [2]
RP   1-930
RX   DOI; 10.1093/hmg/11.5.535.
RX   PUBMED; 11875048.
RA   Young J.M., Friedman C., Williams E.M., Ross J.A., Tonnes-Priddy L.,
RA   Trask B.J.;
RT   "Different evolutionary processes shaped the mouse and human olfactory
RT   receptor gene families";
RL   Hum. Mol. Genet. 11(5):535-546(2002).
XX
RN   [3]
RP   1-930
RA   Adams M.;
RT   ;
RL   Submitted (11-JAN-2002) to the INSDC.
RL   Celera Genomics, 45 West Gude Drive, Rockville, MD 20850, USA
XX
DR   MD5; e769dbc1c1a9e1ef6d903094ababb5e4.
DR   Ensembl-Gn; ENSMUSG00000046493; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017436; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0017414; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0017377; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017376; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017199; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017831; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016769; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0017171; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0017279; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0017271; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0017348; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017298; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017871; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016550; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016828; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000058991; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0026014; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0025990; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0025956; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0025959; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0025765; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0026450; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0025332; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0025689; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0025818; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0025814; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0025928; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0025810; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0026498; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0025041; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0025302; mus_musculus_wsbeij.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..930
FT                   /organism="Mus musculus"
FT                   /chromosome="10"
FT                   /map="10C2"
FT                   /mol_type="genomic DNA"
FT                   /note="GA_x5J8B7W5685-288383-287430"
FT                   /db_xref="taxon:10090"
FT   mRNA            <1..>930
FT                   /product="olfactory receptor MOR139-1"
FT   CDS_pept        1..930
FT                   /codon_start=1
FT                   /product="olfactory receptor MOR139-1"
FT                   /db_xref="GOA:Q8VGX5"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:3031186"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VGX5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAL60679.1"
FT                   /translation="MEPRNNTHILEFFLLGFSQDPNLQPVICGLFLSMYLITVVGNLLI
FT                   ILTIISDANLHTPMYFFLSNLSFVDICFVSTTVPKMLVNIQTKRKSISYADCITQMYFF
FT                   LIFVELDNFLLAVMAYDRYVAICHPLHYTGIMNRRLCGFLVLVCWIVSVLHALLQSMMV
FT                   LRLSFCTDLEIPHFFCELNQVAQLTCSDTFLNDVVMYFALVLLAIVPLFGILYSYSKIV
FT                   SSIRAMSTVQGKYKAFSTCASHLSVVSLFYFTGLGVYLSSAVSHSSQASATASVMYTVV
FT                   TPMLNPFIYSLRNKDVKGALKRLLGVKL"
XX
SQ   Sequence 930 BP; 227 A; 218 C; 175 G; 310 T; 0 other;
     atggagccaa gaaacaatac tcatatttta gaattttttc tattgggatt ttcacaggac        60
     ccaaacttgc agcctgttat atgtggcctt ttcctctcca tgtacttgat cactgtagtt       120
     ggaaacttgc tcattattct caccatcatc tcagatgcca acttgcatac acccatgtac       180
     ttttttctct ctaacctgtc atttgtggat atctgctttg tttccaccac tgtcccaaaa       240
     atgcttgtga atattcaaac aaagagaaaa tccattagct atgcagattg catcacccag       300
     atgtactttt ttctgatttt tgtggaattg gacaacttcc tcctggctgt aatggcctat       360
     gaccgttatg tggccatctg ccatccactg cattatactg gtatcatgaa tcgcagactc       420
     tgtggatttt tggttcttgt atgctggatt gtgagtgttc tgcatgcctt gttacaaagc       480
     atgatggtgc tgcggctgtc cttctgcaca gacttggaaa tcccacactt cttctgtgaa       540
     ttgaatcagg tggcacagct aacctgttct gacacctttc tcaatgatgt ggtcatgtat       600
     tttgcacttg ttttattagc cattgttcct ctgtttggca tcctttactc ttactccaag       660
     atagtatcct ccatacgagc aatgtccaca gttcagggga agtataaagc attttccacc       720
     tgtgcatctc atctctccgt tgtctcctta ttttacttca ctggtctagg agtatacctc       780
     agttctgcag taagtcacag ctcacaagca agtgcaacag cctctgtgat gtacacagtg       840
     gtgactccca tgctaaaccc tttcatctac agcctgagga ataaagatgt aaaaggagcc       900
     ctgaagaggc tcttaggggt aaaactatga                                        930
//

If you have problems or comments...

PBIL Back to PBIL home page