(data stored in ACNUC7820 zone)

EMBL: AY073048

ID   AY073048; SV 1; linear; genomic DNA; STD; MUS; 960 BP.
XX
AC   AY073048;
XX
DT   05-FEB-2002 (Rel. 70, Created)
DT   04-APR-2002 (Rel. 71, Last updated, Version 3)
XX
DE   Mus musculus olfactory receptor MOR139-4 gene, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-960
RX   PUBMED; 11802173.
RA   Zhang X., Firestein S.;
RT   "The olfactory receptor gene superfamily of the mouse";
RL   Nat. Neurosci. 5(2):124-133(2002).
XX
RN   [2]
RP   1-960
RX   DOI; 10.1093/hmg/11.5.535.
RX   PUBMED; 11875048.
RA   Young J.M., Friedman C., Williams E.M., Ross J.A., Tonnes-Priddy L.,
RA   Trask B.J.;
RT   "Different evolutionary processes shaped the mouse and human olfactory
RT   receptor gene families";
RL   Hum. Mol. Genet. 11(5):535-546(2002).
XX
RN   [3]
RP   1-960
RA   Adams M.;
RT   ;
RL   Submitted (11-JAN-2002) to the INSDC.
RL   Celera Genomics, 45 West Gude Drive, Rockville, MD 20850, USA
XX
DR   MD5; f063bd8a6ca03fca527226f20a5caefd.
DR   Ensembl-Gn; ENSMUSG00000063216; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0017437; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0017415; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0017378; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0017377; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0017200; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0017832; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0016770; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0017172; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0017280; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0017272; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0017349; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0017299; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0017872; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0016551; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0016829; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000080730; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000216030; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0026016; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0025992; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0025958; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0025961; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0025767; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0026452; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0025334; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0025691; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0025820; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0025816; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0025930; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0025812; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0026500; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0025043; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0025304; mus_musculus_wsbeij.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..960
FT                   /organism="Mus musculus"
FT                   /chromosome="10"
FT                   /map="10C2"
FT                   /mol_type="genomic DNA"
FT                   /note="GA_x5J8B7W5685-255053-254094"
FT                   /db_xref="taxon:10090"
FT   mRNA            <1..>960
FT                   /product="olfactory receptor MOR139-4"
FT   CDS_pept        1..960
FT                   /codon_start=1
FT                   /product="olfactory receptor MOR139-4"
FT                   /db_xref="GOA:Q8VGU6"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:3031185"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VGU6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAL60711.1"
FT                   /translation="MEPGNDTQLSEFFLLELSENQPQIQPLIFGLFLSMYLVTVTGNLL
FT                   IIMAITADSHLHTPMYIFLSNLSFVDICFTSTTVPQMLVTIHTQSKAITYANCITQVYF
FT                   LLLFSVLDIFLLTVMAYDHYVAICHPLHYMIIMNTRRCGLMILACWIIGVINSLLHTFL
FT                   ALRLSFCTDLEIPHFYCELNQVVHHACSDISLNDMVIYIAAMLLVVGPLSGILYSYSKI
FT                   VSSICAISSVQGKYKAFSTCASHLSVVSLFYCTLLGVYLSSAVTQNAQATALASLMYTV
FT                   VTPMLNPFIYSLRNNDMKKALKIVLGRVTRNRLTDLPS"
XX
SQ   Sequence 960 BP; 235 A; 254 C; 172 G; 299 T; 0 other;
     atggaaccag gaaatgacac tcagctttca gaattctttc ttctggaatt atcagagaat        60
     caacctcaaa ttcagcctct catatttgga ctgttccttt ccatgtacct agtgactgtc       120
     actggaaacc tactcatcat catggccatc actgccgact cccacctgca cacacccatg       180
     tacatcttcc tctctaatct gtcctttgtg gacatctgct ttacttccac cactgttcca       240
     cagatgctgg tgaccattca cacacagagc aaggccatca cctatgcaaa ctgcatcacc       300
     caggtatact ttttactact tttttcggta ctggacatct ttctgctgac tgtgatggcc       360
     tatgaccact atgtggccat ctgtcacccc ctgcattaca tgatcatcat gaacacaaga       420
     cgctgtggat tgatgattct ggcatgctgg attataggtg ttataaattc cctgttacac       480
     acctttttgg cattacggct gtcattctgc acagacctgg agatccctca cttttactgt       540
     gaacttaatc aagttgtaca ccatgcctgt tctgacatct ctcttaatga catggtgatt       600
     tacattgcag ctatgctact ggttgtggga cccctctctg gtatccttta ctcttactct       660
     aagatagtgt cctccatttg tgcaatctcc tcagtgcagg ggaagtacaa agcattttcc       720
     acctgtgcat ctcacctctc agttgtctcc ttattttatt gtaccctcct gggagtgtac       780
     ctcagttctg ctgtgactca aaatgcacag gccactgcat tggcttcact gatgtacact       840
     gtggtcaccc ccatgctgaa cccattcatc tatagtttaa ggaataatga catgaaaaag       900
     gctctgaaaa tagttttagg gagggtaact agaaacagac taacggactt accttcttag       960
//

If you have problems or comments...

PBIL Back to PBIL home page