(data stored in ACNUC15260 zone)

EMBL: AY073050

ID   AY073050; SV 1; linear; genomic DNA; STD; MUS; 939 BP.
XX
AC   AY073050;
XX
DT   05-FEB-2002 (Rel. 70, Created)
DT   04-APR-2002 (Rel. 71, Last updated, Version 3)
XX
DE   Mus musculus olfactory receptor MOR103-3 gene, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-939
RX   PUBMED; 11802173.
RA   Zhang X., Firestein S.;
RT   "The olfactory receptor gene superfamily of the mouse";
RL   Nat. Neurosci. 5(2):124-133(2002).
XX
RN   [2]
RP   1-939
RX   DOI; 10.1093/hmg/11.5.535.
RX   PUBMED; 11875048.
RA   Young J.M., Friedman C., Williams E.M., Ross J.A., Tonnes-Priddy L.,
RA   Trask B.J.;
RT   "Different evolutionary processes shaped the mouse and human olfactory
RT   receptor gene families";
RL   Hum. Mol. Genet. 11(5):535-546(2002).
XX
RN   [3]
RP   1-939
RA   Adams M.;
RT   ;
RL   Submitted (11-JAN-2002) to the INSDC.
RL   Celera Genomics, 45 West Gude Drive, Rockville, MD 20850, USA
XX
DR   MD5; 9267ca27564c34811fae3453928df2eb.
DR   Ensembl-Gn; ENSMUSG00000067064; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0016317; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0016297; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0016258; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0016253; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0016082; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0016712; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_DBA2J_G0016162; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0016160; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0016233; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0016186; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0016753; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0015725; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000086837; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000214928; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0021376; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0021345; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0021308; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0021293; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0021112; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0021813; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_DBA2J_T0021190; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0021203; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0021284; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0021176; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0021855; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0020698; mus_musculus_wsbeij.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..939
FT                   /organism="Mus musculus"
FT                   /chromosome="1"
FT                   /map="1D-1E1"
FT                   /mol_type="genomic DNA"
FT                   /note="GA_x5J8B7W88U1-3184557-3185495"
FT                   /db_xref="taxon:10090"
FT   mRNA            <1..>939
FT                   /product="olfactory receptor MOR103-3"
FT   CDS_pept        1..939
FT                   /codon_start=1
FT                   /product="olfactory receptor MOR103-3"
FT                   /db_xref="GOA:Q8VGU4"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:3031250"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VGU4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAL60713.1"
FT                   /translation="MRGENITKVSTFILLGFPTAPELQYLLFLLFLLAYLFVLVENLTI
FT                   ILTVWSSASLHRPMYYFLGSLSFLEIWYVSDIIPKMLDGFLLQRKRISFIGCMTQLYFF
FT                   SSLVCTECVLLASMAYDRYVAICHPLRYQVIMTTGLCVQLVAFSFASGFTISVIKVYFI
FT                   SSATFCGSNVLNHFFCDISPILKLACTDFSTAELVDFILAFIILVFPLLATILSYGHIT
FT                   LAVLRIPSATGRWRAFSTCASHLTVVTFFYMAMIFMYVRPQAIDTRSSNKLISAVYTVL
FT                   TPMMNPLIYCLRNTEFKDAVRRTLGLGNTPQ"
XX
SQ   Sequence 939 BP; 174 A; 302 C; 196 G; 267 T; 0 other;
     atgagggggg agaacatcac caaggtcagc accttcatcc tgctgggctt ccccacagcc        60
     cctgagctgc aatacctgct cttcctcctc ttcctgctcg cctacctctt tgtgctggtg       120
     gagaacctga ccatcatcct cactgtctgg agcagcgcct ccctccacag acccatgtac       180
     tacttcctgg gatccttgtc tttcctagag atctggtatg tgtcagacat catccccaaa       240
     atgctggatg gcttcctctt gcagaggaaa cgcatctctt tcattggatg catgactcag       300
     ctctacttct tcagctccct ggtatgtaca gagtgtgtac tcctggcttc catggcctat       360
     gaccgctatg tggccatctg ccaccccctg cgctaccaag tcatcatgac cacagggctg       420
     tgtgtccagc ttgtggcctt ctcttttgct agtggcttca ccatctctgt gattaaggtc       480
     tactttatct ccagcgccac cttctgtggc tccaatgtct tgaaccactt cttctgtgac       540
     atctccccca tcctcaagct ggcctgcact gacttctcta ctgcagagct ggtggacttc       600
     atcctggcct tcatcattct ggtgttccca ctcttggcca ccattctctc ctatggccac       660
     atcaccctgg ctgtgctgcg catcccttca gccacaggcc ggtggagagc cttctccacc       720
     tgtgcttccc acctcactgt ggtcaccttc ttctacatgg ccatgatctt catgtatgtg       780
     cgaccccagg ccattgatac ccggagctcc aacaagctca tctctgctgt gtacaccgtc       840
     ctcacgccca tgatgaatcc tttgatctac tgtctgagga atactgaatt taaggatgct       900
     gtgagaagaa ctttgggatt gggaaatact ccccagtag                              939
//

If you have problems or comments...

PBIL Back to PBIL home page