(data stored in ACNUC15260 zone)

EMBL: AY073060

ID   AY073060; SV 1; linear; genomic DNA; STD; MUS; 957 BP.
XX
AC   AY073060;
XX
DT   05-FEB-2002 (Rel. 70, Created)
DT   04-APR-2002 (Rel. 71, Last updated, Version 3)
XX
DE   Mus musculus olfactory receptor MOR264-3 gene, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-957
RX   PUBMED; 11802173.
RA   Zhang X., Firestein S.;
RT   "The olfactory receptor gene superfamily of the mouse";
RL   Nat. Neurosci. 5(2):124-133(2002).
XX
RN   [2]
RP   1-957
RX   DOI; 10.1093/hmg/11.5.535.
RX   PUBMED; 11875048.
RA   Young J.M., Friedman C., Williams E.M., Ross J.A., Tonnes-Priddy L.,
RA   Trask B.J.;
RT   "Different evolutionary processes shaped the mouse and human olfactory
RT   receptor gene families";
RL   Hum. Mol. Genet. 11(5):535-546(2002).
XX
RN   [3]
RP   1-957
RA   Adams M.;
RT   ;
RL   Submitted (11-JAN-2002) to the INSDC.
RL   Celera Genomics, 45 West Gude Drive, Rockville, MD 20850, USA
XX
DR   MD5; c61c0fa4809c73e5452c92499fea5b26.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..957
FT                   /organism="Mus musculus"
FT                   /chromosome="2"
FT                   /map="2E1"
FT                   /mol_type="genomic DNA"
FT                   /note="GA_x5J8B7W3Y5M-756846-757802"
FT                   /db_xref="taxon:10090"
FT   mRNA            <1..>957
FT                   /product="olfactory receptor MOR264-3"
FT   CDS_pept        1..957
FT                   /codon_start=1
FT                   /product="olfactory receptor MOR264-3"
FT                   /db_xref="GOA:Q8VGT6"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VGT6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAL60723.1"
FT                   /translation="MNHQQKPQEGNLTNLKEFVLLGFSDVPDLQWVLFGLLIAMYCFIL
FT                   LGNGTIVLITNVDSALQTPMYFFLGNFSFLEICYVSITLPRMVFNLGTQRRTISFIACA
FT                   TQMCFTLILGATECFLLAVMAYDRYVAICNPLHYPLVMNQKVCSQLVIGSWISGIPIQI
FT                   GQTSHIFSLSFCGSNQINHFFCDIPPILHLACGDIFINEMMVFLGAFLFVLFPFMLIVF
FT                   SYSKIISTVLKLSSTKSRAKAFSTCSSHLAVVILFFGSAMITYFRSNASHSGETDKVLS
FT                   LFYTVVTPMFNPMVYSLRNKDVTIALRKFLCKQFVKI"
XX
SQ   Sequence 957 BP; 254 A; 202 C; 163 G; 338 T; 0 other;
     atgaaccatc agcaaaaacc acaagaagga aatctaacca atctgaagga atttgttctt        60
     cttggatttt cagatgttcc tgatctccag tgggttctat ttggactatt gattgctatg       120
     tattgtttca tcctattagg caatggcacc attgtactaa tcacaaacgt agactctgct       180
     cttcagacac ctatgtactt ttttcttggt aacttttcct ttttagagat atgttatgta       240
     tcaattactc ttccaagaat ggtcttcaac cttggaacac aaagaaggac catctctttc       300
     attgcctgtg ctacacaaat gtgcttcact cttatcctgg gagccacaga gtgcttcttg       360
     ctggctgtga tggcctatga ccgttatgtt gctatctgta atcccctgca ttatcctcta       420
     gttatgaacc aaaaggtgtg ttcccaactg gtgattggct cctggataag tggaatccca       480
     attcagatag ggcagacatc acatatcttt tctctgtcat tttgtggttc caaccagatc       540
     aaccacttct tctgtgatat tcccccaata cttcacctgg cctgtgggga catctttatc       600
     aatgagatga tggttttcct aggtgctttt ttatttgtct tgtttccatt catgttaata       660
     gtattttcct atagtaaaat catctctaca gtcttgaagc tatcatcaac caaaagtcga       720
     gccaaagcct tctctacttg ttcttctcat cttgcagttg tgatattatt ttttggatca       780
     gctatgatta catattttag atccaatgct agtcattcag gtgagacaga taaagttctt       840
     tctcttttct ataccgttgt gactcctatg tttaatccca tggtatacag tctaagaaac       900
     aaggatgtca caatagcact gagaaaattc ttatgcaaac aatttgtgaa aatataa          957
//

If you have problems or comments...

PBIL Back to PBIL home page