(data stored in ACNUC7820 zone)

EMBL: AY073084

ID   AY073084; SV 1; linear; genomic DNA; STD; MUS; 936 BP.
XX
AC   AY073084;
XX
DT   05-FEB-2002 (Rel. 70, Created)
DT   04-APR-2002 (Rel. 71, Last updated, Version 3)
XX
DE   Mus musculus olfactory receptor MOR255-1 gene, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-936
RX   PUBMED; 11802173.
RA   Zhang X., Firestein S.;
RT   "The olfactory receptor gene superfamily of the mouse";
RL   Nat. Neurosci. 5(2):124-133(2002).
XX
RN   [2]
RP   1-936
RX   DOI; 10.1093/hmg/11.5.535.
RX   PUBMED; 11875048.
RA   Young J.M., Friedman C., Williams E.M., Ross J.A., Tonnes-Priddy L.,
RA   Trask B.J.;
RT   "Different evolutionary processes shaped the mouse and human olfactory
RT   receptor gene families";
RL   Hum. Mol. Genet. 11(5):535-546(2002).
XX
RN   [3]
RP   1-936
RA   Adams M.;
RT   ;
RL   Submitted (11-JAN-2002) to the INSDC.
RL   Celera Genomics, 45 West Gude Drive, Rockville, MD 20850, USA
XX
DR   MD5; 04dae0195f7b5b5c29e6fb59737cc5cb.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..936
FT                   /organism="Mus musculus"
FT                   /chromosome="11"
FT                   /map="11B4"
FT                   /mol_type="genomic DNA"
FT                   /note="GA_x5J8B7W3YLM-7346099-7347034"
FT                   /db_xref="taxon:10090"
FT   mRNA            <1..>936
FT                   /product="olfactory receptor MOR255-1"
FT   CDS_pept        1..936
FT                   /codon_start=1
FT                   /product="olfactory receptor MOR255-1"
FT                   /db_xref="GOA:Q8VGR2"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VGR2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAL60747.1"
FT                   /translation="MDLGTLGNDSCVSTFVLLGLTETPVLRPILFVIFLLAYVATLGGN
FT                   FSILAAIIIEPKLHTPMYFFLGNLSMLDVGCISVTVPAMLKHFLSNDRHIPYGACLSQL
FT                   FFFHLLAGADCFLLTVMAYDRYLAICHPLTYNTHMSWRIQKASVCLSCVFSFSNALTQT
FT                   VALSTLKFCGPNTINHFYCDLPQLFQLSCSSIQLNEQLLFVAAAFMGVVPLVLITVSYG
FT                   HVAAAVLRIRSAEGRKKAFSTCSSHLTVVGIFYGTGVFSYMRLGSVESSDKDKGIGILN
FT                   TVISPMLNPLIYSLRNPDVQGALWKVLTGR"
XX
SQ   Sequence 936 BP; 189 A; 259 C; 206 G; 282 T; 0 other;
     atggatctgg gaaccttggg aaacgattcc tgtgtgagca catttgtcct actgggtctc        60
     acagagactc cagttttgcg gcccatcctc tttgtcatct tccttcttgc ttatgtagct       120
     acgcttggtg gcaatttcag catcctggct gctatcatta tagagcccaa actccacact       180
     cccatgtatt tcttcttggg gaacttgtct atgctggatg ttggatgcat tagtgtcact       240
     gttcctgcca tgttgaaaca ttttctatcc aatgacagac acattcccta tggggcctgc       300
     ctctcacagc tcttcttctt ccatctcctg gctggggcag actgcttcct tctgactgtc       360
     atggcctatg atcgttatct ggctatctgc caccccctca cctacaacac ccatatgagt       420
     tggaggattc agaaggcctc agtgtgcctg tcatgtgtgt tttcctttag taatgcactg       480
     acccaaactg ttgccttatc tactcttaaa ttctgtggtc caaacacaat caaccacttc       540
     tactgtgacc tccctcagct ctttcagctt tcctgttcca gcatccaact caatgagcag       600
     ctgctctttg tagcagcagc cttcatgggt gtggtcccct tggtcctcat tactgtgtca       660
     tatggccatg tggcagctgc agttcttcgt atccggtctg ctgagggcag gaagaaagcc       720
     ttctctacct gcagctctca tctcactgtg gtaggcatct tctatgggac aggggtcttc       780
     agctacatgc gtctggggtc agtggaatct tcagacaagg acaaaggcat tggcatcctc       840
     aacactgtca tcagtcccat gctgaaccca cttatctaca gccttaggaa ccctgatgtg       900
     cagggtgccc tatggaaggt gctcacaggg aggtag                                 936
//

If you have problems or comments...

PBIL Back to PBIL home page