(data stored in ACNUC15260 zone)

EMBL: AY073124

ID   AY073124; SV 1; linear; genomic DNA; STD; MUS; 936 BP.
XX
AC   AY073124;
XX
DT   05-FEB-2002 (Rel. 70, Created)
DT   04-APR-2002 (Rel. 71, Last updated, Version 3)
XX
DE   Mus musculus olfactory receptor MOR253-1 gene, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-936
RX   PUBMED; 11802173.
RA   Zhang X., Firestein S.;
RT   "The olfactory receptor gene superfamily of the mouse";
RL   Nat. Neurosci. 5(2):124-133(2002).
XX
RN   [2]
RP   1-936
RX   DOI; 10.1093/hmg/11.5.535.
RX   PUBMED; 11875048.
RA   Young J.M., Friedman C., Williams E.M., Ross J.A., Tonnes-Priddy L.,
RA   Trask B.J.;
RT   "Different evolutionary processes shaped the mouse and human olfactory
RT   receptor gene families";
RL   Hum. Mol. Genet. 11(5):535-546(2002).
XX
RN   [3]
RP   1-936
RA   Adams M.;
RT   ;
RL   Submitted (11-JAN-2002) to the INSDC.
RL   Celera Genomics, 45 West Gude Drive, Rockville, MD 20850, USA
XX
DR   MD5; 3aee42bdd54ef872d6f6b571ffbb14f4.
DR   Ensembl-Gn; ENSMUSG00000096069; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0033184; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0033166; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0033098; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0033167; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0032881; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0033678; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0032211; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0032853; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0033006; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0032958; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0033100; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0032991; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0033698; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0031916; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0032322; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000084455; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000210241; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000211685; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0087409; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0087495; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0087431; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0087450; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0087013; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0087954; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0087540; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0086956; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0087151; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0086996; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0087182; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0087033; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0088252; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0086942; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0086051; mus_musculus_wsbeij.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..936
FT                   /organism="Mus musculus"
FT                   /chromosome="7"
FT                   /map="7F4"
FT                   /mol_type="genomic DNA"
FT                   /note="GA_x5J8B7W3EKE-4605794-4604862"
FT                   /db_xref="taxon:10090"
FT   mRNA            <1..>936
FT                   /product="olfactory receptor MOR253-1"
FT   CDS_pept        1..936
FT                   /codon_start=1
FT                   /product="olfactory receptor MOR253-1"
FT                   /db_xref="GOA:Q8VGM2"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:1333885"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VGM2"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAL60787.1"
FT                   /translation="MMFSPNQTEVTEFILEGFSEHATLRLLLTGCFLSLYTIALMGNIV
FT                   IIALVTSSTGLHSPMYFFLCNLATMDIVCTSSVIPKALIGLVSEENTISFKGCMAQLFF
FT                   LLWSLSSELLLLTVMAYDRYVAICFPLHYSSRMSPQLCGALAVGVWSICAVNASVHTGL
FT                   MTRLSFCGPKVITHFFCEIPPLLLLSCSPTYINSVMTLVADAFYGCINFVLTLLSYGCI
FT                   IASVLRMRSAEGKRKAFSTCSSHLIVVSVYYSSVFCAYVSPASSYSPERSKVTSVLYSI
FT                   LSPTLNPLIYTLRNKDVKLALGRLLPFFPK"
XX
SQ   Sequence 936 BP; 188 A; 278 C; 199 G; 271 T; 0 other;
     atgatgttca gtcccaacca gacagaagtg acagagttta tactagaagg gttttcagaa        60
     catgctactc taagacttct cctgacaggc tgcttcctgt ccctctacac aatcgctcta       120
     atgggcaaca ttgttatcat tgctttggtc acctccagca ctgggctcca cagtcccatg       180
     tactttttcc tgtgcaacct ggccaccatg gacattgtgt gcacctcctc tgtgattcct       240
     aaggccctga ttggcctagt gtctgaagaa aacaccatct ccttcaaagg atgcatggct       300
     cagctcttct ttcttctgtg gtccttgtct tcggagctgc tgctgctcac ggtcatggcc       360
     tatgaccgct atgtggccat ctgctttccc ctgcactaca gctctagaat gagcccacag       420
     ctctgtgggg ccctggccgt gggtgtatgg tccatctgtg ctgtgaatgc atctgtgcac       480
     actggcctga tgacacggct gtcattctgt ggccccaagg tcatcaccca cttcttctgt       540
     gagattcccc cactcctcct gctttcctgt agtcccacat acattaatag cgttatgaca       600
     cttgtggcag atgcctttta tgggtgcatc aactttgtgc taaccttgtt atcctatggc       660
     tgcatcattg ccagtgttct gcgcatgcgt tctgctgagg gcaagaggaa ggccttttct       720
     acctgttcat cccacctcat cgtggtctca gtgtactact catctgtgtt ctgtgcctat       780
     gtcagtcctg cctccagcta cagcccagaa agaagcaaag ttacctccgt gctgtactcg       840
     atcctcagcc caaccctgaa ccccctcatc tatacactaa ggaacaagga tgtcaaactc       900
     gccctgggaa gactcttgcc ctttttcccc aagtag                                 936
//

If you have problems or comments...

PBIL Back to PBIL home page