(data stored in ACNUC15260 zone)

EMBL: AY073125

ID   AY073125; SV 1; linear; genomic DNA; STD; MUS; 936 BP.
XX
AC   AY073125;
XX
DT   05-FEB-2002 (Rel. 70, Created)
DT   04-APR-2002 (Rel. 71, Last updated, Version 3)
XX
DE   Mus musculus olfactory receptor MOR253-2 gene, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-936
RX   PUBMED; 11802173.
RA   Zhang X., Firestein S.;
RT   "The olfactory receptor gene superfamily of the mouse";
RL   Nat. Neurosci. 5(2):124-133(2002).
XX
RN   [2]
RP   1-936
RX   DOI; 10.1093/hmg/11.5.535.
RX   PUBMED; 11875048.
RA   Young J.M., Friedman C., Williams E.M., Ross J.A., Tonnes-Priddy L.,
RA   Trask B.J.;
RT   "Different evolutionary processes shaped the mouse and human olfactory
RT   receptor gene families";
RL   Hum. Mol. Genet. 11(5):535-546(2002).
XX
RN   [3]
RP   1-936
RA   Adams M.;
RT   ;
RL   Submitted (11-JAN-2002) to the INSDC.
RL   Celera Genomics, 45 West Gude Drive, Rockville, MD 20850, USA
XX
DR   MD5; b6468a32aef2038820d0ecb82badf212.
DR   Ensembl-Gn; ENSMUSG00000066122; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0033187; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0033169; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0033101; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0033170; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0032884; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0033681; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0032214; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0032856; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0033009; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0032961; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0033103; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0032994; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0033701; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0032325; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000084454; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000214637; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0087412; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0087498; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0087434; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0087453; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0087016; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0087957; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0087543; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0086959; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0087154; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0086999; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0087185; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0087036; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0088255; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0086054; mus_musculus_wsbeij.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..936
FT                   /organism="Mus musculus"
FT                   /chromosome="7"
FT                   /map="7F4"
FT                   /mol_type="genomic DNA"
FT                   /note="GA_x5J8B7W3EKE-4553222-4552290"
FT                   /db_xref="taxon:10090"
FT   mRNA            <1..>936
FT                   /product="olfactory receptor MOR253-2"
FT   CDS_pept        1..936
FT                   /codon_start=1
FT                   /product="olfactory receptor MOR253-2"
FT                   /db_xref="GOA:Q8VGM1"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:1333826"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VGM1"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAL60788.1"
FT                   /translation="MMLRLNQTEVTEFVLEGFSEHPDLRLFLIGCFLTLYIMALMGNIL
FT                   IIALVTSSTGLHNPMYFFLCNLATTDILCTSSVIPKALVGLVSEENTISFKECMSQLFF
FT                   LAWSASSELLLLTVMAYDRYVAICCPLHYSSRMSPQMCGALAMGVWSISAVNASVHTGL
FT                   MTRLSFCGPKVITHFFCEIPPLLLLSCSPTYVNTIMTLLGDSFFGGVNFVLTLLSYGCI
FT                   IASILRMRSAEGKRKAFSTCSSHLIVVSVYYSSVFCAYVSPASSYSPERSKVTSVLYSI
FT                   VSPTLNPLIYTLRNKDVKLALGRILASFSH"
XX
SQ   Sequence 936 BP; 191 A; 260 C; 204 G; 281 T; 0 other;
     atgatgttga gactcaacca gacagaagta acagagtttg tgctggaagg gttctcagag        60
     caccctgatc taagattgtt cctgataggc tgcttcttga ccctctacat aatggctctg       120
     atgggcaaca ttttgatcat cgctttggtt acctccagca ctgggctcca caatcccatg       180
     tactttttcc tgtgcaacct ggctaccacg gatattttgt gcacctcctc tgtgattcct       240
     aaggccttgg ttggcctagt gtctgaggaa aacactatct ccttcaagga atgtatgtct       300
     cagctcttct tccttgcatg gtcagcatct tctgagctgc tgctgctcac ggtcatggcc       360
     tatgaccgct atgtggccat ctgctgtccc ctgcactaca gctctaggat gagcccacag       420
     atgtgtgggg ccctggccat gggtgtatgg tccatcagtg ctgtgaatgc atctgtgcac       480
     actggcctga tgacacggct gtcattctgt ggacccaagg tcatcaccca cttcttctgt       540
     gagattcccc cactcctcct gctctcctgt agtcctacat atgtaaatac cattatgact       600
     cttttgggag attccttttt tggaggcgtc aattttgtgc ttaccttgct atcctatggc       660
     tgcatcattg ccagcatcct gcgcatgcgt tctgctgagg gcaagaggaa ggccttttct       720
     acctgctcat cccacctcat tgtggtctct gtgtactact catctgtgtt ctgtgcctat       780
     gtcagccctg cttccagcta cagtccagaa agaagcaaag ttacctcagt gttatactcg       840
     atcgtcagcc caaccctcaa ccccctcatc tatacactga ggaacaagga tgtcaagctt       900
     gccttgggca gaatattggc ctctttctca cattaa                                 936
//

If you have problems or comments...

PBIL Back to PBIL home page