(data stored in ACNUC7820 zone)

EMBL: AY073132

ID   AY073132; SV 1; linear; genomic DNA; STD; MUS; 930 BP.
XX
AC   AY073132;
XX
DT   05-FEB-2002 (Rel. 70, Created)
DT   04-APR-2002 (Rel. 71, Last updated, Version 3)
XX
DE   Mus musculus olfactory receptor MOR251-2 gene, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-930
RX   PUBMED; 11802173.
RA   Zhang X., Firestein S.;
RT   "The olfactory receptor gene superfamily of the mouse";
RL   Nat. Neurosci. 5(2):124-133(2002).
XX
RN   [2]
RP   1-930
RX   DOI; 10.1093/hmg/11.5.535.
RX   PUBMED; 11875048.
RA   Young J.M., Friedman C., Williams E.M., Ross J.A., Tonnes-Priddy L.,
RA   Trask B.J.;
RT   "Different evolutionary processes shaped the mouse and human olfactory
RT   receptor gene families";
RL   Hum. Mol. Genet. 11(5):535-546(2002).
XX
RN   [3]
RP   1-930
RA   Adams M.;
RT   ;
RL   Submitted (11-JAN-2002) to the INSDC.
RL   Celera Genomics, 45 West Gude Drive, Rockville, MD 20850, USA
XX
DR   MD5; 80f7215323089dc1b482da22264c2471.
DR   Ensembl-Gn; ENSMUSG00000061489; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0033173; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0033155; mus_musculus_aj.
DR   Ensembl-Gn; MGP_BALBcJ_G0033156; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0032870; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0033667; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0032200; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0032843; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0032995; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0032948; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0033089; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0032980; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0033687; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0031906; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0032311; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000078103; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000214594; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0087398; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0087484; mus_musculus_aj.
DR   Ensembl-Tr; MGP_BALBcJ_T0087439; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0087002; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0087943; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0087529; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0086946; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0087140; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0086986; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0087171; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0087022; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0088241; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0086932; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0086040; mus_musculus_wsbeij.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..930
FT                   /organism="Mus musculus"
FT                   /chromosome="7"
FT                   /map="7F4"
FT                   /mol_type="genomic DNA"
FT                   /note="GA_x5J8B7W72BC-171390-170461"
FT                   /db_xref="taxon:10090"
FT   mRNA            <1..>930
FT                   /product="olfactory receptor MOR251-2"
FT   CDS_pept        1..930
FT                   /codon_start=1
FT                   /product="olfactory receptor MOR251-2"
FT                   /db_xref="GOA:Q8VGL5"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:3030359"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VGL5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAL60795.1"
FT                   /translation="MEINNYTTVVEFVLQGLSEDPGLQALFLAFFLLLYILALAGNTLI
FT                   IIAISLNSSLHTPMYFFLANLALLDIVCTSTVLPKLLEGLVGKSSHISYKGCMTQLFFL
FT                   TWFLGAELLLLTAMAYDRYVAICRPLHYSMLMSWPICVLLAGSVWVISAASTSVHTGLM
FT                   ARLNFCGPNQIRHFLCEVPTLLLLSCSPTTLNNIMIVIADVYFGVVNFLLTMISYSFII
FT                   TSILRIRSTEGKKRAFSTCSAHLVVVVLYYSTVIYTYLQPGSGSSLENGKVVALLYTAV
FT                   SPTLNPAIYSLRNKDVKVALKKLFPCFQ"
XX
SQ   Sequence 930 BP; 193 A; 275 C; 195 G; 267 T; 0 other;
     atggaaataa acaattacac aactgtggtg gagtttgtcc tgcagggact ctctgaggac        60
     cctgggctcc aggctctctt cttggccttt ttcttgcttc tttacatcct ggctcttgca       120
     ggaaacaccc tcatcatcat agccatcagc ctcaactcaa gccttcacac ccccatgtac       180
     ttcttccttg caaacctggc cctgttggac atcgtctgta catccactgt tcttcccaag       240
     ctgctggagg gtttggtggg taagagcagc cacatttctt ataagggatg catgacccaa       300
     ctctttttcc tgacctggtt tctaggggct gagctgctgc tgctcactgc catggcctat       360
     gaccgctatg tggccatctg tcgcccactg cactacagca tgctgatgag ctggcccatc       420
     tgtgtcctgc tcgccggcag tgtgtgggtc atcagtgcag ccagcacatc tgtgcacact       480
     ggcttgatgg cacgactcaa tttctgtggc cccaaccaaa ttcgtcactt tttatgtgaa       540
     gtcccaacac tgctgcttct gtcttgcagc ccaaccaccc tcaacaacat catgattgtc       600
     attgcagatg tttattttgg tgtggtcaac tttctgttga ctatgatatc ctatagcttc       660
     atcatcacca gcatcctgcg catccgctcc acagagggca agaagcgagc cttctctacc       720
     tgctctgccc acctggtggt ggttgtcctg tactactcca ccgtcatcta cacctatttg       780
     cagcctggct ccggatcctc cttggagaat ggcaaagtag ttgctttatt gtacacagca       840
     gtcagcccta ccctgaaccc cgccatttat tctctaagga acaaggatgt caaagttgcc       900
     ctcaaaaagt tatttccctg tttccaatga                                        930
//

If you have problems or comments...

PBIL Back to PBIL home page