(data stored in ACNUC7820 zone)

EMBL: AY073182

ID   AY073182; SV 1; linear; genomic DNA; STD; MUS; 918 BP.
XX
AC   AY073182;
XX
DT   05-FEB-2002 (Rel. 70, Created)
DT   04-APR-2002 (Rel. 71, Last updated, Version 3)
XX
DE   Mus musculus olfactory receptor MOR154-1 gene, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-918
RX   PUBMED; 11802173.
RA   Zhang X., Firestein S.;
RT   "The olfactory receptor gene superfamily of the mouse";
RL   Nat. Neurosci. 5(2):124-133(2002).
XX
RN   [2]
RP   1-918
RX   DOI; 10.1093/hmg/11.5.535.
RX   PUBMED; 11875048.
RA   Young J.M., Friedman C., Williams E.M., Ross J.A., Tonnes-Priddy L.,
RA   Trask B.J.;
RT   "Different evolutionary processes shaped the mouse and human olfactory
RT   receptor gene families";
RL   Hum. Mol. Genet. 11(5):535-546(2002).
XX
RN   [3]
RP   1-918
RA   Adams M.;
RT   ;
RL   Submitted (11-JAN-2002) to the INSDC.
RL   Celera Genomics, 45 West Gude Drive, Rockville, MD 20850, USA
XX
DR   MD5; 9a336c55567f4299f840c69c680ff13f.
DR   Ensembl-Gn; ENSMUSG00000051160; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0034396; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0034375; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0034302; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0034367; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0034080; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034890; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0033403; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0034053; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0034210; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0034154; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0034296; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0034199; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034909; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0033112; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0033523; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000058296; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000213834; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0091297; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0091373; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0091314; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0091300; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0090875; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0091824; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0091454; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0090803; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0091018; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0090850; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0091036; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0090871; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0092137; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0090897; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0089909; mus_musculus_wsbeij.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..918
FT                   /organism="Mus musculus"
FT                   /chromosome="9"
FT                   /map="9A2-9A5"
FT                   /mol_type="genomic DNA"
FT                   /note="GA_x5J8B7W6RL5-13319675-13320592"
FT                   /db_xref="taxon:10090"
FT   mRNA            <1..>918
FT                   /product="olfactory receptor MOR154-1"
FT   CDS_pept        1..918
FT                   /codon_start=1
FT                   /product="olfactory receptor MOR154-1"
FT                   /db_xref="GOA:Q8VGG6"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:3030687"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VGG6"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAL60845.1"
FT                   /translation="MELENQTRVIEFFLLGLSEDPELQPILFGLFLLMYLVTVSGNLLI
FT                   ILAIVSDAHLHTPMYFFLSNLSFTDICFSTTTVPKMLTNLQKQSKSISYTGCITQLSFV
FT                   LLFAGMENFLLAAMAYDRYVAICNPLRYTDIMKLHLCFVMIFLSLYISIVDALLHGLMT
FT                   LRLSFCTFLEIPHFFCELYQVIKIACSDTLINNILIYVMSSALGGMPLVGIIFSYYKII
FT                   SSILRMPSPGGRHKAFSTCGSHLSVVSLFYGTAFGVYISSAFTESYRRTSVASLMYTVF
FT                   PPMLNPFIYSLRNKDMKKALRKIV"
XX
SQ   Sequence 918 BP; 230 A; 216 C; 165 G; 307 T; 0 other;
     atggaattag aaaaccagac aagagtaata gaattctttc tcttgggcct ctcagaggat        60
     ccagaacttc agcccatcct ctttggactg ttcctgctta tgtacctagt gacagtctct       120
     gggaacctgc tcatcatcct ggccattgtc tctgacgctc acctccacac tccaatgtac       180
     ttcttcctct caaacctgtc cttcactgat atctgcttca gcaccaccac tgttcctaag       240
     atgctgacaa accttcagaa acagagcaaa tccatcagtt acacaggctg cattacccag       300
     cttagctttg tcctactttt tgctggaatg gaaaactttc ttcttgcagc aatggcttat       360
     gaccgttatg tggccatctg caatcccctt cgctacacag acatcatgaa actccatttg       420
     tgttttgtga tgattttttt gtctttgtac attagcattg tggatgccct tctacatggc       480
     ttaatgacat tgcgtctatc tttctgcaca tttcttgaaa ttccccactt cttctgtgaa       540
     ctttatcagg ttatcaagat tgcatgttct gacactctca tcaataacat tttgatatat       600
     gtcatgagta gtgcattagg tggtatgccc ctagtaggga ttattttctc ttactataaa       660
     attatctctt ccatcctcag aatgccatca ccaggcggta ggcataaggc tttttcaaca       720
     tgtggatctc atctgtcagt ggtttccttg ttctatggga cagcttttgg ggtatacatt       780
     agttctgcat ttacagagtc atacaggaga acttctgtag catcattgat gtatactgtg       840
     tttccgccta tgctgaaccc atttatctat agtctgagga acaaagatat gaagaaagct       900
     ttgagaaaaa tagtctga                                                     918
//

If you have problems or comments...

PBIL Back to PBIL home page