(data stored in ACNUC15260 zone)

EMBL: AY073240

ID   AY073240; SV 1; linear; genomic DNA; STD; MUS; 930 BP.
XX
AC   AY073240;
XX
DT   05-FEB-2002 (Rel. 70, Created)
DT   04-APR-2002 (Rel. 71, Last updated, Version 3)
XX
DE   Mus musculus olfactory receptor MOR220-1 gene, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-930
RX   PUBMED; 11802173.
RA   Zhang X., Firestein S.;
RT   "The olfactory receptor gene superfamily of the mouse";
RL   Nat. Neurosci. 5(2):124-133(2002).
XX
RN   [2]
RP   1-930
RX   DOI; 10.1093/hmg/11.5.535.
RX   PUBMED; 11875048.
RA   Young J.M., Friedman C., Williams E.M., Ross J.A., Tonnes-Priddy L.,
RA   Trask B.J.;
RT   "Different evolutionary processes shaped the mouse and human olfactory
RT   receptor gene families";
RL   Hum. Mol. Genet. 11(5):535-546(2002).
XX
RN   [3]
RP   1-930
RA   Adams M.;
RT   ;
RL   Submitted (11-JAN-2002) to the INSDC.
RL   Celera Genomics, 45 West Gude Drive, Rockville, MD 20850, USA
XX
DR   MD5; b824a63eb93ee1254c93d199acecdba1.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..930
FT                   /organism="Mus musculus"
FT                   /chromosome="7"
FT                   /map="7E1"
FT                   /mol_type="genomic DNA"
FT                   /note="GA_x5J8B7W89HK-6195373-6194378"
FT                   /db_xref="taxon:10090"
FT   mRNA            <1..>930
FT                   /product="olfactory receptor MOR220-1"
FT   CDS_pept        1..930
FT                   /codon_start=1
FT                   /product="olfactory receptor MOR220-1"
FT                   /db_xref="GOA:Q8VGB0"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VGB0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAL60903.1"
FT                   /translation="MANSTLVPEFLLEVFAETWELRILLTVLFLLMYLGSLLGNLIIII
FT                   ATTVDHILNTPMYFFLRNLSILDMGYVSVTVPNACINSLTDHRSISLAGCAGQIFLVFF
FT                   SACVEIQFLTIMAQDRYVAICKPLLYAMIMNHQFCVQMTLASLLTSLILASVHTSKTFQ
FT                   LSFCHSNVVSQFFCDIPSLLRLSCTDTFINKLLLLLTAIVFSGSCFTFIAISYVRILST
FT                   VLKVPVKGERGKAFSTCVPHIIVVSVFLSSGAYVYLKPSAISEIVEDMTLSVFYTIVPP
FT                   FLNPIIYSLRNKQIKKAVKKVIFRFFIV"
XX
SQ   Sequence 930 BP; 213 A; 213 C; 168 G; 336 T; 0 other;
     atggccaatt ccaccctggt gcctgagttc ctcctggaag tttttgctga gacttgggaa        60
     ctcaggatcc tactcactgt gctgttcttg ttgatgtacc tgggcagcct gttggggaat       120
     cttatcatca tcattgctac tacagttgac catatcctga atacacccat gtacttcttc       180
     ctcaggaatc tgtctatttt agacatgggg tatgtatctg ttactgtgcc caatgcttgt       240
     atcaactctc tcactgatca caggagcatt tctttggctg ggtgtgcagg acagatcttt       300
     ttggttttct tttctgcatg tgtagagatt cagtttctca ccatcatggc ccaggaccgc       360
     tatgtggcca tctgtaagcc tcttctctat gctatgatta tgaaccatca attctgtgtt       420
     cagatgacac tggcttccct acttacctct cttatccttg caagtgtgca cacttccaaa       480
     actttccagc tatccttttg tcactctaat gtagtctctc agttcttctg tgatatcccc       540
     tctttgctga ggctttcttg cactgacacc tttatcaaca aactattact tcttctgact       600
     gccattgttt ttagtggtag ctgctttacc ttcattgcca tatcatatgt tcgcatatta       660
     tcaactgtct tgaaggttcc tgtcaaagga gagagaggaa aagccttttc cacctgtgtc       720
     cctcacatta ttgtggtgtc tgtgtttctt agttctggtg cctatgtata tttaaaacct       780
     tcagcaatct cagaaatagt tgaggatatg acactttctg tattttatac cattgttcct       840
     ccattcttaa accctattat ctatagtctt agaaacaaac agataaagaa ggctgtgaag       900
     aaagtaatat ttagattttt catagtttaa                                        930
//

If you have problems or comments...

PBIL Back to PBIL home page