(data stored in ACNUC15260 zone)

EMBL: AY073387

ID   AY073387; SV 1; linear; genomic DNA; STD; MUS; 948 BP.
XX
AC   AY073387;
XX
DT   05-FEB-2002 (Rel. 70, Created)
DT   04-APR-2002 (Rel. 71, Last updated, Version 3)
XX
DE   Mus musculus olfactory receptor MOR255-4 gene, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-948
RX   PUBMED; 11802173.
RA   Zhang X., Firestein S.;
RT   "The olfactory receptor gene superfamily of the mouse";
RL   Nat. Neurosci. 5(2):124-133(2002).
XX
RN   [2]
RP   1-948
RX   DOI; 10.1093/hmg/11.5.535.
RX   PUBMED; 11875048.
RA   Young J.M., Friedman C., Williams E.M., Ross J.A., Tonnes-Priddy L.,
RA   Trask B.J.;
RT   "Different evolutionary processes shaped the mouse and human olfactory
RT   receptor gene families";
RL   Hum. Mol. Genet. 11(5):535-546(2002).
XX
RN   [3]
RP   1-948
RA   Adams M.;
RT   ;
RL   Submitted (11-JAN-2002) to the INSDC.
RL   Celera Genomics, 45 West Gude Drive, Rockville, MD 20850, USA
XX
DR   MD5; 838d7d2640d3d68ddeac6715b2969d0f.
DR   Ensembl-Gn; ENSMUSG00000070379; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0018686; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0018652; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0018622; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0018626; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0018439; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0019077; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0017992; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0018410; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0018518; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0018508; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0018589; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0018534; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0019117; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0017763; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0018046; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000073675; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000216722; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0030614; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0030548; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0030529; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0030546; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0030342; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0031055; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0030045; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0030256; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0030389; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0030388; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0030511; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0030373; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0031077; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0029761; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0029825; mus_musculus_wsbeij.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..948
FT                   /organism="Mus musculus"
FT                   /chromosome="11"
FT                   /map="11B4"
FT                   /mol_type="genomic DNA"
FT                   /note="GA_x5J8B7W3YLM-7252015-7251068"
FT                   /db_xref="taxon:10090"
FT   mRNA            <1..>948
FT                   /product="olfactory receptor MOR255-4"
FT   CDS_pept        1..948
FT                   /codon_start=1
FT                   /product="olfactory receptor MOR255-4"
FT                   /db_xref="GOA:Q8VFX8"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:3030236"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VFX8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAL61050.1"
FT                   /translation="MQTKPRINGTTITEFILLGLVETPELWPLVFILFLLAYMTTVGGN
FT                   LSILAAVLVEPKLHTPMYFFLGNLSVMDVGCISVTIPSMLVRLLVQKHTIPYGDCLTQL
FT                   FFFHLLAGVDCFLLTAMAYDRFLAICQPLTYSTRMNYTIQRILVAMSWACAFSNALTHT
FT                   VAISTLHFCGPNVINHFYCDLPQLFQLSCSSTQLNELLLFGVGFIMAGTPMALIFISYI
FT                   HVAAAVLRIRSAEGRKKAFSTCSSHLTVVAMFYGTGMFNYMRLGSTKFSDKDKAIGIFN
FT                   TVINPMLNPLIYSLRNPDVQAALWRVLTGRRPAA"
XX
SQ   Sequence 948 BP; 215 A; 261 C; 207 G; 265 T; 0 other;
     atgcagacaa agcctagaat caatggaacc actattactg aattcattct tctgggtttg        60
     gtggagacac cagagctgtg gccacttgtc ttcatactct tcctcttggc ttacatgaca       120
     acagttggag gtaacctgag catcctggca gctgtcttgg tggaacccaa actgcacact       180
     cccatgtact tcttcctggg gaatctgtca gtgatggatg tggggtgcat cagtgtcact       240
     attccctcca tgttggttcg gctcttggtc caaaagcata caattccata tggagactgc       300
     ctcacacagc tcttcttctt ccatctgctg gctggggttg actgtttcct gttgacagcc       360
     atggcttatg accgcttcct ggccatctgc cagcccctca cttacagcac ccgaatgaac       420
     tacactatac agaggatctt ggtggctatg tcctgggctt gtgcctttag caatgcactg       480
     acacacacag tagccatatc cacacttcac ttctgtggcc caaatgtaat caatcacttc       540
     tactgtgacc tgcctcagct cttccagctg tcctgctcca gtacccagct caatgagctg       600
     ctgctctttg gagtgggttt cataatggca ggaaccccta tggcactcat ttttatctct       660
     tatatccatg tggcagctgc agttctgcga attcgctctg ctgaaggcag aaagaaagct       720
     ttctccacat gcagctctca cctcactgtg gttgccatgt tctatggcac aggcatgttt       780
     aactacatga gactgggttc caccaaattt tcagataagg acaaagctat tgggattttc       840
     aacactgtca tcaaccctat gctgaaccca ctcatctaca gtctcaggaa ccctgatgtg       900
     caggctgccc tctggagggt actcacaggg agacggccag cagcttga                    948
//

If you have problems or comments...

PBIL Back to PBIL home page