(data stored in ACNUC7820 zone)

EMBL: AY073531

ID   AY073531; SV 1; linear; genomic DNA; STD; MUS; 948 BP.
XX
AC   AY073531;
XX
DT   05-FEB-2002 (Rel. 70, Created)
DT   04-APR-2002 (Rel. 71, Last updated, Version 3)
XX
DE   Mus musculus olfactory receptor MOR152-1 gene, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-948
RX   PUBMED; 11802173.
RA   Zhang X., Firestein S.;
RT   "The olfactory receptor gene superfamily of the mouse";
RL   Nat. Neurosci. 5(2):124-133(2002).
XX
RN   [2]
RP   1-948
RX   DOI; 10.1093/hmg/11.5.535.
RX   PUBMED; 11875048.
RA   Young J.M., Friedman C., Williams E.M., Ross J.A., Tonnes-Priddy L.,
RA   Trask B.J.;
RT   "Different evolutionary processes shaped the mouse and human olfactory
RT   receptor gene families";
RL   Hum. Mol. Genet. 11(5):535-546(2002).
XX
RN   [3]
RP   1-948
RA   Adams M.;
RT   ;
RL   Submitted (11-JAN-2002) to the INSDC.
RL   Celera Genomics, 45 West Gude Drive, Rockville, MD 20850, USA
XX
DR   MD5; 0c093024089274130c2986fde55f48be.
DR   Ensembl-Gn; ENSMUSG00000062868; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0034382; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0034361; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0034288; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0034353; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0034066; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034876; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0033392; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0034039; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0034196; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0034140; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0034282; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0034185; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034895; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0033098; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0033509; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000078861; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0091283; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0091359; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0091300; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0091286; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0090861; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0091810; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0091443; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0090789; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0091004; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0090836; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0091022; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0090857; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0092123; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0090883; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0089895; mus_musculus_wsbeij.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..948
FT                   /organism="Mus musculus"
FT                   /chromosome="9"
FT                   /map="9A2-9A5"
FT                   /mol_type="genomic DNA"
FT                   /note="GA_x5J8B7W6RL5-13964024-13963086"
FT                   /db_xref="taxon:10090"
FT   mRNA            <1..>948
FT                   /product="olfactory receptor MOR152-1"
FT   CDS_pept        1..948
FT                   /codon_start=1
FT                   /product="olfactory receptor MOR152-1"
FT                   /db_xref="GOA:Q8VFJ5"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:3030664"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VFJ5"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAL61194.1"
FT                   /translation="MSNMEVENKSVVLDIFLHGLTNDPELQPFIFVLFLSIYLITVSGN
FT                   LLIMLAIKCDFHLHNPMYFFLCHLSFNDMYLISITVPKMLMNIQTKDQRITFAGCLSQA
FT                   CFVVVCTIFECFLLGVMAYDRYIAICYPLRYTVLMNPSFCVILVLFSLFFSIVNGLLHS
FT                   LMVLYLSFCTDLEILHFFCEIAQILKLACSDSLINNILIFVTASIFAGLPLFAIIFSYT
FT                   HIVSTVLKMPSSEGKYKAFSTCGSHLSVVSLFYGTGFGVYITSKVIDSPKKIAVASVMY
FT                   SVVPPMLNPFVYCLRNRDMKEALKKVIGRTASLL"
XX
SQ   Sequence 948 BP; 236 A; 195 C; 172 G; 345 T; 0 other;
     atgtctaaca tggaagttga aaacaaatca gttgttttgg atatttttct acatggactc        60
     acaaatgacc cagagctgca gccattcatc tttgttcttt ttctaagcat atacttgatt       120
     accgtttctg gaaatcttct tataatgttg gccatcaagt gtgacttcca tcttcacaac       180
     cccatgtact tctttctctg tcatctgtct tttaatgaca tgtatttaat cagcatcaca       240
     gtcccaaaga tgttgatgaa tatacaaaca aaagatcaga ggataacttt tgctggctgc       300
     ctcagccagg cctgctttgt tgtagtttgt acaatatttg aatgttttct ccttggagta       360
     atggcttatg atcgctacat agccatttgt tatcctctaa gatacacagt ccttatgaac       420
     cccagtttct gtgttattct ggttcttttc tctctattct ttagtattgt aaatggtctg       480
     ctgcatagtc tgatggtgct gtacttgtcc ttctgcacag acctggaaat cctccacttc       540
     ttctgtgaaa ttgcacaaat cctgaagctt gcctgttctg acagcctcat caacaacatc       600
     ctgatatttg ttacagcttc tatttttgct ggtcttcctc tgtttgcaat aatcttttct       660
     tatactcata ttgtgtctac agtattgaaa atgccatcat cagaaggaaa gtacaaagcc       720
     ttttccacct gtgggtctca tttgtcagtt gtttccttat tctatgggac agggtttggt       780
     gtatacatta cctcaaaagt aattgattca ccaaagaaga ttgctgtggc ttcagtgatg       840
     tattcagtag ttcctccaat gttgaatccc tttgtctatt gtttgaggaa cagggatatg       900
     aaggaggccc tgaagaaagt tattggtagg acagcttctc ttctgtga                    948
//

If you have problems or comments...

PBIL Back to PBIL home page