(data stored in ACNUC15260 zone)

EMBL: AY073532

ID   AY073532; SV 1; linear; genomic DNA; STD; MUS; 939 BP.
XX
AC   AY073532;
XX
DT   05-FEB-2002 (Rel. 70, Created)
DT   04-APR-2002 (Rel. 71, Last updated, Version 3)
XX
DE   Mus musculus olfactory receptor MOR152-2 gene, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-939
RX   PUBMED; 11802173.
RA   Zhang X., Firestein S.;
RT   "The olfactory receptor gene superfamily of the mouse";
RL   Nat. Neurosci. 5(2):124-133(2002).
XX
RN   [2]
RP   1-939
RX   DOI; 10.1093/hmg/11.5.535.
RX   PUBMED; 11875048.
RA   Young J.M., Friedman C., Williams E.M., Ross J.A., Tonnes-Priddy L.,
RA   Trask B.J.;
RT   "Different evolutionary processes shaped the mouse and human olfactory
RT   receptor gene families";
RL   Hum. Mol. Genet. 11(5):535-546(2002).
XX
RN   [3]
RP   1-939
RA   Adams M.;
RT   ;
RL   Submitted (11-JAN-2002) to the INSDC.
RL   Celera Genomics, 45 West Gude Drive, Rockville, MD 20850, USA
XX
DR   MD5; d8a9522c9a1921fb555b1c137382ad3e.
DR   Ensembl-Gn; ENSMUSG00000110621; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000212482; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000215699; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..939
FT                   /organism="Mus musculus"
FT                   /chromosome="9"
FT                   /map="9A2-9A5"
FT                   /mol_type="genomic DNA"
FT                   /note="GA_x5J8B7W6RL5-13713510-13712572"
FT                   /db_xref="taxon:10090"
FT   mRNA            <1..>939
FT                   /product="olfactory receptor MOR152-2"
FT   CDS_pept        1..939
FT                   /codon_start=1
FT                   /product="olfactory receptor MOR152-2"
FT                   /db_xref="GOA:Q8VFJ4"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:3030671"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VFJ4"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAL61195.1"
FT                   /translation="MEVKNKSVVLDIFLHGLTDDIELQPFIFGFFLCMYLITIFGNLLI
FT                   MLAIICDSHLHKPMYFFLCHLAFNDMYLISITVPKLLVNVQTQDQRITLAGCLSQGCFV
FT                   AVCFIFECFLLGIMAYDRYIAICFPLRYTVLINPFFCVIVVLISLFISIVNGLLHSLMV
FT                   LHLSFCTDLEILHFFCEIAQILKLACSDNLINNILIFVTASSFAGVPLCGIIFSYVHIV
FT                   STVLKMPSSEGKYKAFSTCGSHLSVVSLFYGTGFGVYITSVVIDSPKEIAIASVMYSIV
FT                   PPMLNPFVYSLKNRDMKEALKKVIGRTVSLP"
XX
SQ   Sequence 939 BP; 232 A; 192 C; 172 G; 343 T; 0 other;
     atggaagtta aaaacaagtc ggttgttttg gatattttcc ttcatggact cacagatgac        60
     atagagctgc agcccttcat ctttggcttc tttttatgca tgtatttgat caccatcttt       120
     ggaaatcttc ttataatgtt agccatcatt tgtgactccc acctccacaa acccatgtac       180
     ttctttctct gccatctggc ttttaatgac atgtatttaa tcagcattac agtcccaaag       240
     ttgttggtga atgtacaaac acaggatcag aggatcactt tagctggctg tctgagccag       300
     ggatgctttg tggctgtatg tttcatcttt gaatgttttc tccttggaat aatggcctat       360
     gaccgctaca tagccatttg ttttcctcta agatacacag tcctcatcaa tcccttcttc       420
     tgtgttattg tggttctaat ctctctattt attagtattg taaatggtct gctgcatagt       480
     ctgatggtgc tgcacttgtc cttctgcaca gacctggaaa tcctccactt cttctgtgaa       540
     attgcacaaa tcctcaagct tgcctgttct gacaacctca tcaacaacat cctgatattt       600
     gttacagctt ctagttttgc tggtgttcct ctatgtggaa taatcttttc ttatgttcac       660
     attgtttcta cagtattgaa aatgccatca tcagaaggaa agtataaagc cttctctact       720
     tgtgggtctc atttatcagt tgtttcattg ttttatggga caggttttgg tgtatacatt       780
     acctcagtag taattgattc accgaaggaa attgctattg cttcagtgat gtattccata       840
     gttcctccaa tgttgaatcc ctttgtttat agtttgaaga acagggatat gaaagaagca       900
     ctgaagaagg taattggtag aacagtttct cttccatga                              939
//

If you have problems or comments...

PBIL Back to PBIL home page