(data stored in ACNUC7820 zone)

EMBL: AY073533

ID   AY073533; SV 1; linear; genomic DNA; STD; MUS; 954 BP.
XX
AC   AY073533;
XX
DT   05-FEB-2002 (Rel. 70, Created)
DT   04-APR-2002 (Rel. 71, Last updated, Version 3)
XX
DE   Mus musculus olfactory receptor MOR152-3 gene, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-954
RX   PUBMED; 11802173.
RA   Zhang X., Firestein S.;
RT   "The olfactory receptor gene superfamily of the mouse";
RL   Nat. Neurosci. 5(2):124-133(2002).
XX
RN   [2]
RP   1-954
RX   DOI; 10.1093/hmg/11.5.535.
RX   PUBMED; 11875048.
RA   Young J.M., Friedman C., Williams E.M., Ross J.A., Tonnes-Priddy L.,
RA   Trask B.J.;
RT   "Different evolutionary processes shaped the mouse and human olfactory
RT   receptor gene families";
RL   Hum. Mol. Genet. 11(5):535-546(2002).
XX
RN   [3]
RP   1-954
RA   Adams M.;
RT   ;
RL   Submitted (11-JAN-2002) to the INSDC.
RL   Celera Genomics, 45 West Gude Drive, Rockville, MD 20850, USA
XX
DR   MD5; 9b922c3a2f3026d7dbece0e56e535570.
DR   Ensembl-Gn; ENSMUSG00000059303; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000074986; mus_musculus.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..954
FT                   /organism="Mus musculus"
FT                   /chromosome="9"
FT                   /map="9A2-9A5"
FT                   /mol_type="genomic DNA"
FT                   /note="GA_x5J8B7W6RL5-13729544-13728600"
FT                   /db_xref="taxon:10090"
FT   mRNA            <1..>954
FT                   /product="olfactory receptor MOR152-3"
FT   CDS_pept        1..954
FT                   /codon_start=1
FT                   /product="olfactory receptor MOR152-3"
FT                   /db_xref="GOA:Q8VFJ3"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:3030670"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VFJ3"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAL61196.1"
FT                   /translation="MCKMEVENKSVVFDIFLHGLTDDTELQPFIFGLFLCMYLITIFGN
FT                   LLIILAIICDSHLHTPMYFFLCHLAFNDMYLISITVPKMLVNIQTQDQRITFAGCLSQG
FT                   CFVAVCTIFECFLLGIMAYDRFIAICYPLRYTVLMNPCFCVILTLISLFFSIVNGLLHS
FT                   LMVLHLSFCTDLEILHFFCEIAQILKLACSDSLINNILIFVTSSIFAGVPLCGIIFSYV
FT                   HIVSTVLKMPSLEGKYKAFSTCGSHLSVVSLFYGTGFGVYISSNVIDSPKKIAMASVMY
FT                   SIVPPMMNPFIYSMRNRNMKEALKKVIGRKLLFSDV"
XX
SQ   Sequence 954 BP; 236 A; 195 C; 174 G; 349 T; 0 other;
     atgtgcaaaa tggaagttga aaacaaatca gttgtttttg atatttttct tcatggactt        60
     acagatgata cagagcttca gccctttatc tttggccttt ttctatgcat gtatttgatc       120
     accatctttg gaaatcttct tataatattg gccatcattt gtgactctca cctccacaca       180
     cccatgtact tctttctctg ccatctggct tttaatgaca tgtatttaat cagcattaca       240
     gtcccaaaga tgttggtgaa tatacaaaca caggatcaga ggatcacttt tgctggctgc       300
     ctgagccagg gatgctttgt tgctgtttgt accatctttg agtgttttct ccttggaata       360
     atggcctatg accgcttcat agccatttgt tatcctctaa gatacacagt cctcatgaat       420
     ccctgcttct gtgttattct gactcttatc tctctattct ttagtattgt aaatggtctg       480
     ctgcatagtc tgatggtgct gcacttgtcc ttctgcacag acctggaaat cctccacttc       540
     ttctgtgaaa ttgcacaaat cctcaagctt gcctgttctg acagcctaat caacaacatc       600
     ttgatatttg ttacatcttc tatttttgct ggtgttcctc tatgtggaat aatcttttct       660
     tatgttcaca ttgtttctac agtgttgaaa atgccatcat tagaaggaaa gtacaaagcc       720
     ttctccacgt gtgggtctca tttatcagtt gtttccttgt tctatgggac aggttttggt       780
     gtatacattt cctcaaatgt aattgattca ccaaagaaga ttgccatggc ttcagtgatg       840
     tattcaatag ttcctccaat gatgaatccc tttatctata gtatgaggaa caggaatatg       900
     aaagaggcat tgaagaaggt aattggtagg aagcttcttt tctctgatgt gtga             954
//

If you have problems or comments...

PBIL Back to PBIL home page