(data stored in ACNUC7820 zone)

EMBL: AY073586

ID   AY073586; SV 1; linear; genomic DNA; STD; MUS; 930 BP.
XX
AC   AY073586;
XX
DT   05-FEB-2002 (Rel. 70, Created)
DT   04-APR-2002 (Rel. 71, Last updated, Version 3)
XX
DE   Mus musculus olfactory receptor MOR156-3 gene, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-930
RX   PUBMED; 11802173.
RA   Zhang X., Firestein S.;
RT   "The olfactory receptor gene superfamily of the mouse";
RL   Nat. Neurosci. 5(2):124-133(2002).
XX
RN   [2]
RP   1-930
RX   DOI; 10.1093/hmg/11.5.535.
RX   PUBMED; 11875048.
RA   Young J.M., Friedman C., Williams E.M., Ross J.A., Tonnes-Priddy L.,
RA   Trask B.J.;
RT   "Different evolutionary processes shaped the mouse and human olfactory
RT   receptor gene families";
RL   Hum. Mol. Genet. 11(5):535-546(2002).
XX
RN   [3]
RP   1-930
RA   Adams M.;
RT   ;
RL   Submitted (11-JAN-2002) to the INSDC.
RL   Celera Genomics, 45 West Gude Drive, Rockville, MD 20850, USA
XX
DR   MD5; d4f974e81fc7ff488fba50b54bfbfd4f.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..930
FT                   /organism="Mus musculus"
FT                   /mol_type="genomic DNA"
FT                   /note="GA_x5J8B7W5KGR-1086717-1085788"
FT                   /db_xref="taxon:10090"
FT   mRNA            <1..>930
FT                   /product="olfactory receptor MOR156-3"
FT   CDS_pept        1..930
FT                   /codon_start=1
FT                   /product="olfactory receptor MOR156-3"
FT                   /db_xref="GOA:Q8VFE0"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VFE0"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAL61249.1"
FT                   /translation="MNCSKAPGFILLGLSSDPEKWQPLFNIFLCLYLLGLLGNLLLLLA
FT                   IGTDVHLHTPMYFFLSQLSLVDLCFITTTAPKMLEALWTGDGSISFSGCLTQFYFFAVF
FT                   ADMDNLLLAVMAIDRYAAICHPLFYPFLMTPCRCEVLASGSWGIAHCVSLFYTLLLSQF
FT                   YYHTNQGIPHFFCDSRPLLLLSCSDTHLSEGLMMALSGVLGMSSVLCLVSSYGCIFYAV
FT                   ARVPSAQGKRKSLATCSSHLSVVLLFYSTVFATYLKPPSTSHSSAEVVAAVMYTLVTPT
FT                   LNPFIYSLRNKDVKSSLRKILNMDKFQG"
XX
SQ   Sequence 930 BP; 191 A; 236 C; 188 G; 315 T; 0 other;
     atgaactgta gtaaggctcc tggctttatc ctgttgggac tttccagtga cccagagaaa        60
     tggcagcccc tctttaatat tttcctctgt ctctacttgc tgggcctttt agggaacctg       120
     ctacttctgt tagctattgg cactgatgtc cacctccaca cccccatgta tttcttcctc       180
     agtcagctct cactagtgga tctttgcttc atcaccacaa cagcccctaa aatgctggag       240
     gctctgtgga ctggagatgg atcaatctca ttctctggat gcctgactca gttttacttc       300
     tttgctgttt ttgctgacat ggataacctg cttctggcag tcatggctat tgaccgctat       360
     gctgctatct gccaccccct gttctaccca tttctaatga ctccttgtag atgcgaagtt       420
     cttgccagtg ggtcatgggg aatagctcat tgtgtgtctc tgttctatac cttattactc       480
     tctcagtttt attatcatac caatcaaggg atacctcatt ttttctgtga ttctaggcct       540
     ctcttactgc tttcttgctc agacactcac ctcagtgagg gcctgatgat ggctttgtct       600
     ggagttttgg gaatgagctc agttctctgt cttgtaagtt cttatggttg tattttttat       660
     gctgtggcta gggttccatc agcacagggg aaaaggaaat ccctggccac atgcagttcc       720
     cacctctctg tagtcctcct attctatagc acagtctttg ctacctacct gaagccccca       780
     tctacttctc actcctctgc agaggtggta gctgctgtta tgtatacctt ggttactccc       840
     actctgaacc ccttcattta tagtcttaga aataaggatg ttaagagttc attgagaaag       900
     atcctgaaca tggacaagtt tcagggctaa                                        930
//

If you have problems or comments...

PBIL Back to PBIL home page