(data stored in ACNUC15260 zone)

EMBL: AY073754

ID   AY073754; SV 1; linear; genomic DNA; STD; MUS; 939 BP.
XX
AC   AY073754;
XX
DT   05-FEB-2002 (Rel. 70, Created)
DT   04-APR-2002 (Rel. 71, Last updated, Version 3)
XX
DE   Mus musculus olfactory receptor MOR143-1 gene, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-939
RX   PUBMED; 11802173.
RA   Zhang X., Firestein S.;
RT   "The olfactory receptor gene superfamily of the mouse";
RL   Nat. Neurosci. 5(2):124-133(2002).
XX
RN   [2]
RP   1-939
RX   DOI; 10.1093/hmg/11.5.535.
RX   PUBMED; 11875048.
RA   Young J.M., Friedman C., Williams E.M., Ross J.A., Tonnes-Priddy L.,
RA   Trask B.J.;
RT   "Different evolutionary processes shaped the mouse and human olfactory
RT   receptor gene families";
RL   Hum. Mol. Genet. 11(5):535-546(2002).
XX
RN   [3]
RP   1-939
RA   Adams M.;
RT   ;
RL   Submitted (11-JAN-2002) to the INSDC.
RL   Celera Genomics, 45 West Gude Drive, Rockville, MD 20850, USA
XX
DR   MD5; 1efb4a27ac354ce0a6a418ea78f1a8ae.
DR   Ensembl-Gn; ENSMUSG00000051118; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0034404; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0034384; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0034311; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0034376; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0034088; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0034897; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0033413; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0034062; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0034219; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0034163; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0034304; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0034918; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0033117; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0033528; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000057596; mus_musculus.
DR   Ensembl-Tr; ENSMUST00000217347; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0091305; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0091382; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0091323; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0091309; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0090883; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0091831; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0091464; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0090812; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0091027; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0090859; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0091044; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0092146; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0090902; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0089914; mus_musculus_wsbeij.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..939
FT                   /organism="Mus musculus"
FT                   /chromosome="9"
FT                   /map="9A2-9A5"
FT                   /mol_type="genomic DNA"
FT                   /note="GA_x5J8B7W6RL5-12964457-12963549"
FT                   /db_xref="taxon:10090"
FT   mRNA            <1..>939
FT                   /product="olfactory receptor MOR143-1"
FT   CDS_pept        1..939
FT                   /codon_start=1
FT                   /product="olfactory receptor MOR143-1"
FT                   /db_xref="GOA:Q8VEY9"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:2153206"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VEY9"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAL61417.1"
FT                   /translation="MEAENHTAIVHFLLIGLSEDPKIQSVLFGLFLSMFLITMLGNFLI
FT                   VLVTSCDSHLHTPMYFFLCNLSFVDICLTSTTIPKMLVNIYMHTMKISYTECLTQVYFF
FT                   NNFLGMDNFLLTIMAYDRFVAICHPLNYTVIMNPRICGLLVLLSWIIMFWVSLIHMLLM
FT                   KQLNFSTSTEIPHFFCELTELLRVARSDTHINNIFLYLVTAVLGMFPVIGIAFSYFHIV
FT                   SALMKMSSIKNKYKAFSTCGSHLCVVSMFYGTGFVVHLSSAVAHSSKRNTITSIMYTVV
FT                   TPMLNPFIYSLRNKDVKGALVRLLRRVKFCP"
XX
SQ   Sequence 939 BP; 233 A; 219 C; 153 G; 334 T; 0 other;
     atggaagcag agaaccatac agccatagta catttcctcc ttattggtct ttcagaagat        60
     cctaaaattc aatctgttct ttttggacta ttcctatcta tgttcctgat taccatgctt       120
     ggaaactttc tcattgtctt agtcaccagc tgtgactccc accttcacac ccccatgtac       180
     tttttcctct gcaacctgtc atttgttgac atttgtttaa cctccactac tatccccaaa       240
     atgttggtga acatttacat gcacaccatg aagatatcct acacagagtg ccttactcaa       300
     gtatattttt ttaataattt tcttggaatg gataattttc tactgaccat tatggcctat       360
     gatcgttttg tggccatctg tcatccactt aactacacag tcatcatgaa ccctcgaatc       420
     tgtggccttc tggttctttt atcttggatc attatgttct gggtttcctt gattcatatg       480
     ctgttgatga aacaactgaa cttctctact agcactgaaa tcccacattt cttttgtgaa       540
     ctcactgagc ttctcagggt ggcccgctct gatacccaca taaataacat ttttctgtat       600
     ttggttactg cagtgctagg tatgtttcct gtcattggga tagctttctc ttattttcac       660
     attgtctctg ctttaatgaa aatgtcctcc attaagaata agtataaagc cttttccacc       720
     tgtgggtctc acctctgtgt ggtatccatg ttctatggga caggatttgt agttcatctc       780
     agttctgctg tagcccattc atccaagaga aacacaatca cttcaataat gtacactgtt       840
     gtcaccccta tgttgaaccc cttcatctat agcttgcgaa acaaggatgt aaagggggcc       900
     ttagtaagac tccttagaag agttaaattt tgtccttga                              939
//

If you have problems or comments...

PBIL Back to PBIL home page