(data stored in ACNUC15260 zone)

EMBL: AY073812

ID   AY073812; SV 1; linear; genomic DNA; STD; MUS; 918 BP.
XX
AC   AY073812;
XX
DT   05-FEB-2002 (Rel. 70, Created)
DT   04-APR-2002 (Rel. 71, Last updated, Version 3)
XX
DE   Mus musculus olfactory receptor MOR160-4 gene, complete cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-918
RX   PUBMED; 11802173.
RA   Zhang X., Firestein S.;
RT   "The olfactory receptor gene superfamily of the mouse";
RL   Nat. Neurosci. 5(2):124-133(2002).
XX
RN   [2]
RP   1-918
RX   DOI; 10.1093/hmg/11.5.535.
RX   PUBMED; 11875048.
RA   Young J.M., Friedman C., Williams E.M., Ross J.A., Tonnes-Priddy L.,
RA   Trask B.J.;
RT   "Different evolutionary processes shaped the mouse and human olfactory
RT   receptor gene families";
RL   Hum. Mol. Genet. 11(5):535-546(2002).
XX
RN   [3]
RP   1-918
RA   Adams M.;
RT   ;
RL   Submitted (11-JAN-2002) to the INSDC.
RL   Celera Genomics, 45 West Gude Drive, Rockville, MD 20850, USA
XX
DR   MD5; 1fde91fd4694c1400f2df3900f4b8914.
DR   Ensembl-Gn; ENSMUSG00000051793; mus_musculus.
DR   Ensembl-Gn; MGP_129S1SvImJ_G0022293; mus_musculus_129s1svimj.
DR   Ensembl-Gn; MGP_AJ_G0022252; mus_musculus_aj.
DR   Ensembl-Gn; MGP_AKRJ_G0022226; mus_musculus_akrj.
DR   Ensembl-Gn; MGP_BALBcJ_G0022258; mus_musculus_balbcj.
DR   Ensembl-Gn; MGP_C3HHeJ_G0022027; mus_musculus_c3hhej.
DR   Ensembl-Gn; MGP_C57BL6NJ_G0022703; mus_musculus_c57bl6nj.
DR   Ensembl-Gn; MGP_CASTEiJ_G0021549; mus_musculus_casteij.
DR   Ensembl-Gn; MGP_CBAJ_G0021995; mus_musculus_cbaj.
DR   Ensembl-Gn; MGP_DBA2J_G0022121; mus_musculus_dba2j.
DR   Ensembl-Gn; MGP_FVBNJ_G0022101; mus_musculus_fvbnj.
DR   Ensembl-Gn; MGP_LPJ_G0022193; mus_musculus_lpj.
DR   Ensembl-Gn; MGP_NODShiLtJ_G0022121; mus_musculus_nodshiltj.
DR   Ensembl-Gn; MGP_NZOHlLtJ_G0022718; mus_musculus_nzohlltj.
DR   Ensembl-Gn; MGP_PWKPhJ_G0021291; mus_musculus_pwkphj.
DR   Ensembl-Gn; MGP_WSBEiJ_G0021599; mus_musculus_wsbeij.
DR   Ensembl-Tr; ENSMUST00000063289; mus_musculus.
DR   Ensembl-Tr; MGP_129S1SvImJ_T0042439; mus_musculus_129s1svimj.
DR   Ensembl-Tr; MGP_AJ_T0042401; mus_musculus_aj.
DR   Ensembl-Tr; MGP_AKRJ_T0042364; mus_musculus_akrj.
DR   Ensembl-Tr; MGP_BALBcJ_T0042393; mus_musculus_balbcj.
DR   Ensembl-Tr; MGP_C3HHeJ_T0042129; mus_musculus_c3hhej.
DR   Ensembl-Tr; MGP_C57BL6NJ_T0042879; mus_musculus_c57bl6nj.
DR   Ensembl-Tr; MGP_CASTEiJ_T0042225; mus_musculus_casteij.
DR   Ensembl-Tr; MGP_CBAJ_T0042039; mus_musculus_cbaj.
DR   Ensembl-Tr; MGP_DBA2J_T0042192; mus_musculus_dba2j.
DR   Ensembl-Tr; MGP_FVBNJ_T0042159; mus_musculus_fvbnj.
DR   Ensembl-Tr; MGP_LPJ_T0042263; mus_musculus_lpj.
DR   Ensembl-Tr; MGP_NODShiLtJ_T0042136; mus_musculus_nodshiltj.
DR   Ensembl-Tr; MGP_NZOHlLtJ_T0042919; mus_musculus_nzohlltj.
DR   Ensembl-Tr; MGP_PWKPhJ_T0041813; mus_musculus_pwkphj.
DR   Ensembl-Tr; MGP_WSBEiJ_T0041522; mus_musculus_wsbeij.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..918
FT                   /organism="Mus musculus"
FT                   /chromosome="15"
FT                   /map="15F3"
FT                   /mol_type="genomic DNA"
FT                   /note="GA_x5J8B7W76D0-7768109-7767192"
FT                   /db_xref="taxon:10090"
FT   mRNA            <1..>918
FT                   /product="olfactory receptor MOR160-4"
FT   CDS_pept        1..918
FT                   /codon_start=1
FT                   /product="olfactory receptor MOR160-4"
FT                   /db_xref="GOA:Q8VET7"
FT                   /db_xref="InterPro:IPR000276"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="MGI:MGI:3030118"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VET7"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAL61475.1"
FT                   /translation="MRNHSAVHEFVLLGLSTDPHIQPALFVLFLLVYLLTVVGNSLMLL
FT                   VIVADSHLHTPMYFFLRQLSFLDLCHSSVTAPKMLENLLSEEKTILVESCLAQAFFVFA
FT                   TGGTEACLLAAMAYDRYVAIGSPLLYSQVMSSQLCVGLVWLSWCLAVVDALLNTLPAVS
FT                   LDFCEDQTISHFSCELSSLFPLSCSDTAANFTLLLCSSVVHFFGTLVMIVCSYGRIVTT
FT                   VLRVSSSTGRSKAFSTCLSHLTTVILFYGSGFISYLLPASGSPLEKVFSLQYSVITPML
FT                   NPLIYSLKNKEVKAALGRMIRKHF"
XX
SQ   Sequence 918 BP; 157 A; 283 C; 212 G; 266 T; 0 other;
     atgaggaacc acagcgctgt ccatgagttt gttcttctag gactatccac cgacccccac        60
     attcaacctg cactctttgt cctgttcctt ctggtttacc tcctcaccgt ggtggggaac       120
     tccctgatgt tgcttgtgat tgtggccgat tcccacctcc acacacctat gtacttcttc       180
     ctgagacagc tgtccttcct ggatctctgt cactcctctg tcacggcgcc caagatgctc       240
     gagaatctac tctctgagga gaaaaccatc ttggttgaaa gctgcttggc tcaggccttc       300
     ttcgtcttcg ccaccggcgg caccgaggcc tgtctgcttg cagcgatggc ctatgaccgc       360
     tacgttgcca tcggttcccc tttgctctac agccaggtga tgagtagcca gctctgtgtg       420
     gggctggtgt ggctctcctg gtgtctggct gttgtggatg ctctcctcaa taccctcccg       480
     gctgtcagtt tagatttctg tgaggaccaa acgatttctc acttcagctg tgagctgtct       540
     tctctcttcc ctctgtcttg ctctgacacc gccgccaact tcacactcct gctctgctcc       600
     tccgtcgtgc atttctttgg aacgcttgtc atgattgttt gctcttatgg ccgcattgtc       660
     accactgtcc tgagggtcag ctccagcacg gggagaagca aggccttctc cacctgtttg       720
     tcccatctca ctaccgtcat cttgttctat ggctcggggt ttatcagtta tctcttaccg       780
     gcttcagggt cccccctgga gaaggtcttc tctctgcagt acagcgtcat cacccccatg       840
     ctgaaccccc tcatctacag cctgaagaac aaggaggtga aggcagcgct gggaagaatg       900
     atcagaaagc atttttag                                                     918
//

If you have problems or comments...

PBIL Back to PBIL home page