(data stored in ACNUC7820 zone)

EMBL: AY073842

ID   AY073842; SV 1; linear; genomic DNA; STD; MUS; 576 BP.
XX
AC   AY073842;
XX
DT   05-FEB-2002 (Rel. 70, Created)
DT   04-APR-2002 (Rel. 71, Last updated, Version 3)
XX
DE   Mus musculus olfactory receptor MOR150-2 gene, partial cds.
XX
KW   .
XX
OS   Mus musculus (house mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Myomorpha; Muroidea; Muridae;
OC   Murinae; Mus; Mus.
XX
RN   [1]
RP   1-576
RX   PUBMED; 11802173.
RA   Zhang X., Firestein S.;
RT   "The olfactory receptor gene superfamily of the mouse";
RL   Nat. Neurosci. 5(2):124-133(2002).
XX
RN   [2]
RP   1-576
RX   DOI; 10.1093/hmg/11.5.535.
RX   PUBMED; 11875048.
RA   Young J.M., Friedman C., Williams E.M., Ross J.A., Tonnes-Priddy L.,
RA   Trask B.J.;
RT   "Different evolutionary processes shaped the mouse and human olfactory
RT   receptor gene families";
RL   Hum. Mol. Genet. 11(5):535-546(2002).
XX
RN   [3]
RP   1-576
RA   Adams M.;
RT   ;
RL   Submitted (11-JAN-2002) to the INSDC.
RL   Celera Genomics, 45 West Gude Drive, Rockville, MD 20850, USA
XX
DR   MD5; 5f92b9368c9184739f7ae06553015789.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..576
FT                   /organism="Mus musculus"
FT                   /mol_type="genomic DNA"
FT                   /note="GA_x5J8B7TY9VC-3-581"
FT                   /db_xref="taxon:10090"
FT   mRNA            <1..>576
FT                   /product="olfactory receptor MOR150-2"
FT   CDS_pept        <1..>576
FT                   /codon_start=1
FT                   /product="olfactory receptor MOR150-2"
FT                   /db_xref="GOA:Q8VEQ8"
FT                   /db_xref="InterPro:IPR000725"
FT                   /db_xref="InterPro:IPR017452"
FT                   /db_xref="UniProtKB/TrEMBL:Q8VEQ8"
FT                   /inference="non-experimental evidence, no additional
FT                   details recorded"
FT                   /protein_id="AAL61505.1"
FT                   /translation="DRYVAICHPLRYTVIMNSCFCSILIVVSLAISAVNALLLSLMVLH
FT                   LNFCTEVEIPHFFCELAQIIKLACSDTLINNILIYISAFMFGGIPFFGIFLSYTEIVSS
FT                   VLKIPSRQGRHKAFSTCGSHLSVVSLFYGTGLGVYISSAVTESPRKTAVASVMYSIVTQ
FT                   MLNPFIYSLRNRDMKEALRKHVGRIASIV"
XX
SQ   Sequence 576 BP; 142 A; 125 C; 114 G; 195 T; 0 other;
     gaccgctatg tggccatttg ccaccctctg aggtacacag tcatcatgaa ctcatgcttc        60
     tgtagtatac ttattgtagt ttccttggct attagtgctg tcaatgcact actgctcagt       120
     ctcatggtgc tgcatctgaa tttctgcaca gaggttgaaa tcccacactt cttctgtgaa       180
     cttgctcaga tcataaagct tgcctgctca gatactctca taaataatat tttgatttat       240
     atctcagctt tcatgtttgg tggtattcct ttctttggaa tatttctttc ttatactgaa       300
     attgtctcct ctgttttgaa aattccatca aggcaaggaa ggcataaagc attttccacg       360
     tgtggctctc acctgtcagt agtttccttg ttttatggga caggcttagg agtgtacatt       420
     agctctgcag ttactgaatc tcccaggaaa acagccgttg cttcagtaat gtactctatt       480
     gtcactcaga tgctgaaccc ttttatctac agcctgagga acagagacat gaaggaagct       540
     ttaaggaagc acgttggaag gatagcttcc attgta                                 576
//

If you have problems or comments...

PBIL Back to PBIL home page