(data stored in ACNUC9543 zone)

EMBL: AY074318

ID   AY074318; SV 1; linear; mRNA; STD; PLN; 3599 BP.
XX
AC   AY074318;
XX
DT   29-JAN-2002 (Rel. 70, Created)
DT   20-SEP-2002 (Rel. 73, Last updated, Version 3)
XX
DE   Arabidopsis thaliana putative RNA helicase (At1g32490) mRNA, complete cds.
XX
KW   FLI_CDNA.
XX
OS   Arabidopsis thaliana (thale cress)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae;
OC   rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis.
XX
RN   [1]
RP   1-3599
RA   Yamada K., Liu S.X., Sakano H., Pham P.K., Banh J., Chung M.K.,
RA   Goldsmith A.D., Lee J.M., Quach H.L., Toriumi M., Yu G., Bowser L.,
RA   Carninci P., Chen H., Cheuk R., Hayashizaki Y., Ishida J., Jones T.,
RA   Kamiya A., Karlin-Neumann G., Kawai J., Kim C., Lam B., Lin J., Miranda M.,
RA   Narusaka M., Nguyen M., Palm C.J., Sakurai T., Satou M., Seki M., Shinn P.,
RA   Southwick A., Shinozaki K., Davis R.W., Ecker J.R., Theologis A.;
RT   "Arabidopsis Full Length cDNA Clones";
RL   Unpublished.
XX
RN   [2]
RP   1-3599
RA   Yamada K., Banh J., Chan M.M., Chang C.H., Chang E., Dale J.M., Deng J.M.,
RA   Goldsmith A.D., Lee J.M., Onodera C.S., Quach H.L., Tang C.C., Toriumi M.,
RA   Wu H.C., Yamamura Y., Yu G., Bowser L., Carninci P., Chen H., Cheuk R.,
RA   Hayashizaki Y., Ishida J., Jones T., Kamiya A., Karlin-Neumann G.,
RA   Kawai J., Kim C., Lam B., Lin J., Meyers M.C., Miranda M., Narusaka M.,
RA   Nguyen M., Palm C.J., Sakurai T., Satou M., Seki M., Shinn P.,
RA   Southwick A., Shinozaki K., Davis R.W., Ecker J.R., Theologis A.;
RT   ;
RL   Submitted (11-JAN-2002) to the INSDC.
RL   Plant Gene Expression Center, 800 Buchanan Street, Albany, CA 94710, USA
XX
DR   MD5; f8d494fc7e02114da78eb5ab8d5ff1f9.
XX
CC   RIKEN Genomic Sciences Center (GSC) members carried out the
CC   collection and clustering of RAFL cDNAs (RAFL cDNA : 'RIKEN
CC   Arabidopsis Full-Length cDNA'): Seki,M., Narusaka,M., Ishida,J.,
CC   Satou,M., Kamiya,A., Sakurai,T., Carninci,P., Kawai,J.,
CC   Hayashizaki,Y. and Shinozaki,K.
CC   The Salk, Stanford, PGEC (SSP) Consortium members carried out the
CC   sequencing and annotation of the RAFL cDNAs: Yamada,K., Banh,J.,
CC   Chan,M.M., Chang,C.H., Chang,E., Dale,J.M., Deng,J.M.,
CC   Goldsmith,A.D., Lee,J.M., Onodera,C.S., Quach,H.L., Tang,C.C.,
CC   Toriumi,M., Wu,H.C., Yamamura,Y., Yu,G., Bowser,L., Chen,H.,
CC   Cheuk,R., Jones,T., Karlin-Neumann,G., Kim,C., Lam,B., Lin,J.,
CC   Meyers,M.C., Miranda,M., Nguyen,M., Palm,C.J., Shinn,P.,
CC   Southwick,A., Davis,R.W., Ecker,J.R. and Theologis,A.
CC   Yamada,K. (SSP/PGEC) and Seki,M. (RIKEN GSC) contributed equally to
CC   this work.  Shinozaki,K. (RIKEN GSC) and Theologis,A. (SSP/PGEC)
CC   contributed equally to this work as PIs.
CC   Annotation is based on the January 2002 version of the Arabidopsis
CC   genome submitted to GenBank.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3599
FT                   /organism="Arabidopsis thaliana"
FT                   /chromosome="1"
FT                   /mol_type="mRNA"
FT                   /clone="RAFL04-09-P08 (R09737)"
FT                   /note="This clone is in a modified pBluescript vector
FT                   (Lambda ZAP) as a XhoI/SstI insert. ecotype: Columbia"
FT                   /db_xref="taxon:3702"
FT   5'UTR           1..146
FT                   /gene="At1g32490"
FT   CDS_pept        147..3281
FT                   /codon_start=1
FT                   /gene="At1g32490"
FT                   /product="putative RNA helicase"
FT                   /db_xref="GOA:Q8VY00"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002464"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR011709"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8VY00"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT                   /protein_id="AAL67014.1"
FT                   /translation="MASNDLKTWVSDKLMMLLGYSQAAVVNYLIAMAKKTKSPTELVGE
FT                   LVDYGFSSSGDTRSFAEEIFARVPRKTAGVNLYQKHEAEAAMLVRKQKTYALLDADDDE
FT                   DEVVVEKKSSVSESRKSDKGKKRFRKKSGQSDESDGEVAVREDSRHVRRKVSEEDDGSE
FT                   SEEERVRDQKEREELEQHLKDRDTARTRKLTEQTLSKKEKEEAVRRANALEKDDLYSLR
FT                   KVSRQEYLKKREQKKLDELRDEIEDEQYLFGGEKLTETELREFRYKKELYDLVKKRTQD
FT                   EDNVEEYRIPDAYDQEGGVDQEKRFSVAVQRYRDLDSTEKMNPFAEQEAWEDHQIGKAT
FT                   LKFGAKNKQASDDYQFVFEDQINFIKESVMAGENYEDAMDAKQKSQDLAEKTALEELQE
FT                   VRRSLPIYTYRDQLLKAVEEHQVLVIVGDTGSGKTTQIPQYLHEAGYTKRGKVGCTQPR
FT                   RVAAMSVAARVAQEMGVKLGHEVGYSIRFEDCTSDKTVLKYMTDGMLLRELLGEPDLAS
FT                   YSVVIVDEAHERTLSTDILFGLVKDIARFRPDLKLLISSATMDAEKFSDYFDTAPIFSF
FT                   PGRRYPVEINYTSAPEADYMDAAIVTILTIHVREPLGDILVFFTGQEEIETAEEILKHR
FT                   IRGLGTKIRELIICPIYANLPSELQAKIFEPTPEGARKVVLATNIAETSLTIDGIKYVV
FT                   DPGFSKMKSYNPRTGMESLLITPISKASATQRAGRAGRTSPGKCYRLYTAFNYNNDLEE
FT                   NTVPEVQRTNLASVVLALKSLGIHDLINFDFMDPPPAEALVKSLELLFALGALNKLGEL
FT                   TKAGRRMAEFPLDPMLSKMIVVSDKYKCSDEIISIAAMLSIGGSIFYRPKDKQVHADNA
FT                   RMNFHTGNVGDHIALLKVYSSWKETNFSTQWCYENYIQVRSMKRARDIRDQLEGLLERV
FT                   EIDISSNLNELDSVRKSIVAGFFPHTAKLQKNGSYRTVKHPQTVHIHPNSGLSQVLPRW
FT                   VVYHELVLTSKEYMRQVTELKPEWLIELAPHYYQLKDVEDAASKKMPKGAGKAAM"
FT   3'UTR           3282..3599
FT                   /gene="At1g32490"
XX
SQ   Sequence 3599 BP; 1171 A; 644 C; 864 G; 920 T; 0 other;
     atccacccac tcgggtgaaa tacttcgata gactccgata tatatattcg cgcccaccgg        60
     tagcttcgaa aacagagatc ctcactctcg aaatcttctc actctcgaga aacctgaacc       120
     cttagtttac cgaaatctag gtaagaatgg cgagcaatga tttgaagact tgggtttcgg       180
     ataagctgat gatgctactt ggctactctc aagcggctgt tgttaactat ctcattgcaa       240
     tggctaaaaa aacaaaatca ccaactgaac ttgtgggaga gttggtggat tacgggtttt       300
     cgtcttctgg tgatactcgt tcgtttgcag aagaaatttt tgccagagtt ccccgtaaaa       360
     ctgctggtgt aaatctctac caaaaacatg aagcagaggc agcaatgcta gtgaggaagc       420
     agaaaacata tgctctttta gatgctgatg atgatgaaga cgaagttgtt gtggagaaaa       480
     aatcttcagt ttctgaatct agaaaatcag ataagggcaa gaaaaggttt agaaagaaaa       540
     gtgggcagtc agatgaaagt gatggcgagg tggccgttag agaggatagt agacacgtta       600
     gaagaaaggt ttctgaagag gatgatggtt ctgagtcaga agaggaaaga gtgcgtgacc       660
     aaaaggagag agaagaactg gagcagcatt taaaagatcg tgatactgca cggacacgaa       720
     agctaacaga gcaaacgttg tcaaagaaag agaaagaaga ggctgttcga agagcaaatg       780
     ctttggagaa ggatgattta tattccttaa ggaaagtctc gagacaagaa tacttaaaga       840
     agagagaaca aaagaaactg gatgaactaa gggatgagat agaagatgaa caatatcttt       900
     tcggaggtga aaagctcaca gaaacggagc ttcgtgagtt taggtacaag aaagagcttt       960
     atgacctcgt gaagaaaaga acacaagatg aagataacgt cgaggagtat agaattccag      1020
     atgcttatga tcaagaggga ggtgttgatc aggagaagag gttttctgtt gctgttcaac      1080
     gatacaggga cctggattca acagagaaaa tgaatccatt cgcagagcaa gaagcttggg      1140
     aggaccatca gattggaaaa gcaacattaa aatttggtgc aaagaataag caagcctcag      1200
     acgattatca gtttgtgttt gaagaccaaa taaacttcat aaaggaatct gtcatggctg      1260
     gtgaaaatta tgaagatgct atggatgcaa aacaaaaatc tcaagatttg gcagagaaaa      1320
     cagctttaga ggaacttcag gaagtcagaa gaagtctgcc gatttatacg tatcgtgatc      1380
     aactgcttaa ggctgtggaa gagcatcagg ttcttgtcat tgtgggagac actggttcag      1440
     gaaaaacgac acaaatacca caatatctcc atgaagctgg ttacacaaag cgtggaaagg      1500
     ttggttgtac gcagccccga agagttgcag ctatgagtgt tgctgcccgt gtggctcaag      1560
     agatgggtgt caaactcgga catgaggttg gctattccat tcgatttgag gattgtactt      1620
     cagacaaaac agttctgaag tatatgactg atggaatgct tttgcgcgag ctgcttggtg      1680
     agccagacct ggccagctac agtgtcgtta ttgtggatga ggcacatgaa aggaccttgt      1740
     caaccgatat actgtttgga ttagtcaagg atatagcgcg gtttcgacct gatttgaagt      1800
     tgttgatatc tagtgcaaca atggatgcag aaaaattttc tgattatttt gatacagccc      1860
     cgatttttag ttttcctgga agaaggtatc cagttgaaat caactataca agtgcacctg      1920
     aagctgatta catggacgca gccatagtta ctatccttac gatccatgtg agggagccac      1980
     ttggagatat attggtcttc ttcactggtc aagaggaaat tgaaactgca gaagagatct      2040
     tgaagcacag gataagaggt ttgggtacaa agatccgtga attaatcata tgcccaattt      2100
     acgcaaatct tccaagtgaa ctccaagcaa aaatatttga gccaactcca gaaggggcac      2160
     gtaaagttgt cctagcaaca aatatcgccg aaacatcatt gacaattgat ggtataaagt      2220
     atgttgttga tccaggcttt agcaagatga agtcatataa cccgaggaca gggatggaat      2280
     ctttgcttat tactcctatc tctaaggctt ctgcaactca acgagctggt cgtgctggaa      2340
     gaacaagtcc agggaagtgt tatcgtctgt acactgcgtt taattacaac aatgacttgg      2400
     aggaaaacac ggtgccagaa gtacagagga cgaatcttgc tagtgtggtg cttgctttga      2460
     agagtcttgg aattcatgat ctcataaact tcgatttcat ggaccctcca cctgctgaag      2520
     cacttgtaaa gtctttagaa ctgctctttg ctctgggtgc tctaaataag ctcggggaat      2580
     tgactaaagc tggtagaagg atggcagagt tcccccttga tccaatgctg tcgaaaatga      2640
     ttgttgtttc tgacaagtat aagtgctccg atgagataat atcaatcgct gctatgttgt      2700
     caattggtgg ctctatcttc taccgtccca aggacaaaca agttcatgcg gacaacgcaa      2760
     gaatgaattt ccacaccggg aatgtcggtg accatattgc tttgctaaag gtttacagtt      2820
     catggaagga aacaaacttc tctactcagt ggtgctacga gaactacatt caggtccgga      2880
     gcatgaaaag agccagagat atccgtgatc aattggaggg acttctcgaa agggtggaaa      2940
     tagatatcag ctcaaacctg aatgaattgg attcagttag aaaatccatc gtagccgggt      3000
     tttttccgca cactgcaaag ctacagaaga atggatcgta ccgaacagtg aaacatcccc      3060
     agacagtgca catacatccc aattcgggct tatctcaggt attgccgaga tgggttgtat      3120
     atcacgaact agtacttacg tccaaggaat acatgcgaca ggtaacagag ttgaaaccag      3180
     agtggttgat tgagttagct cctcactact accagctcaa ggacgttgaa gacgctgcat      3240
     caaagaaaat gcccaaagga gctggaaaag ctgcaatgta agaactcaga tgggattggc      3300
     aaaagaataa tggaaacaga tgcgagtaca tacgactttg acagattgtt agaaaagctc      3360
     tcttcactac attaactcat ttttggtcag cctcctgagt ttttgttaga aaatacttaa      3420
     aatgttatga acagttcaat gtagtgccat ttattcccat tgttatatat tgtaaggtcg      3480
     agctacatta tgtctgaatc agtaacttct tttccgctgc atggagcagt tgtgaaaact      3540
     tttacaaaga gaacccaaat aaagtatcaa gcaaacttat ttgaaaaaaa aaaaaaaaa       3599
//

If you have problems or comments...

PBIL Back to PBIL home page