(data stored in ACNUC8465 zone)

EMBL: AY080651

ID   AY080651; SV 1; linear; mRNA; STD; PLN; 1932 BP.
XX
AC   AY080651;
XX
DT   13-MAR-2002 (Rel. 71, Created)
DT   20-SEP-2002 (Rel. 73, Last updated, Version 3)
XX
DE   Arabidopsis thaliana unknown protein (At3g21300) mRNA, partial cds.
XX
KW   FLI_CDNA.
XX
OS   Arabidopsis thaliana (thale cress)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae;
OC   rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis.
XX
RN   [1]
RP   1-1932
RA   Yamada K., Liu S.X., Sakano H., Pham P.K., Banh J., Chung M.K.,
RA   Goldsmith A.D., Lee J.M., Quach H.L., Toriumi M., Yu G., Bowser L.,
RA   Carninci P., Chen H., Cheuk R., Hayashizaki Y., Ishida J., Jones T.,
RA   Kamiya A., Karlin-Neumann G., Kawai J., Kim C., Lam B., Lin J., Miranda M.,
RA   Narusaka M., Nguyen M., Palm C.J., Sakurai T., Satou M., Seki M., Shinn P.,
RA   Southwick A., Shinozaki K., Davis R.W., Ecker J.R., Theologis A.;
RT   "Arabidopsis Full Length cDNA Clones";
RL   Unpublished.
XX
RN   [2]
RP   1-1932
RA   Yamada K., Banh J., Chan M.M., Chang C.H., Chang E., Dale J.M., Deng J.M.,
RA   Goldsmith A.D., Lee J.M., Onodera C.S., Quach H.L., Tang C.C., Toriumi M.,
RA   Wu H.C., Yamamura Y., Yu G., Bowser L., Carninci P., Chen H., Cheuk R.,
RA   Hayashizaki Y., Ishida J., Jones T., Kamiya A., Karlin-Neumann G.,
RA   Kawai J., Kim C., Lam B., Lin J., Meyers M.C., Miranda M., Narusaka M.,
RA   Nguyen M., Palm C.J., Sakurai T., Satou M., Seki M., Shinn P.,
RA   Southwick A., Shinozaki K., Davis R.W., Ecker J.R., Theologis A.;
RT   ;
RL   Submitted (19-FEB-2002) to the INSDC.
RL   Plant Gene Expression Center, 800 Buchanan Street, Albany, CA 94710, USA
XX
DR   MD5; f53c37f9985b0059a60ee8ac9b14d35e.
XX
CC   RIKEN Genomic Sciences Center (GSC) members carried out the
CC   collection and clustering of RAFL cDNAs (RAFL cDNA : 'RIKEN
CC   Arabidopsis Full-Length cDNA'): Seki,M., Narusaka,M., Ishida,J.,
CC   Satou,M., Kamiya,A., Sakurai,T., Carninci,P., Kawai,J.,
CC   Hayashizaki,Y. and Shinozaki,K.
CC   The Salk, Stanford, PGEC (SSP) Consortium members carried out the
CC   sequencing and annotation of the RAFL cDNAs: Yamada,K., Banh,J.,
CC   Chan,M.M., Chang,C.H., Chang,E., Dale,J.M., Deng,J.M.,
CC   Goldsmith,A.D., Lee,J.M., Onodera,C.S., Quach,H.L., Tang,C.C.,
CC   Toriumi,M., Wu,H.C., Yamamura,Y., Yu,G., Bowser,L., Chen,H.,
CC   Cheuk,R., Jones,T., Karlin-Neumann,G., Kim,C., Lam,B., Lin,J.,
CC   Meyers,M.C., Miranda,M., Nguyen,M., Palm,C.J., Shinn,P.,
CC   Southwick,A., Davis,R.W., Ecker,J.R. and Theologis,A.
CC   Yamada,K. (SSP/PGEC) and Seki,M. (RIKEN GSC) contributed equally to
CC   this work.  Shinozaki,K. (RIKEN GSC) and Theologis,A. (SSP/PGEC)
CC   contributed equally to this work as PIs.
CC   Annotation is based on the January 2002 version of the Arabidopsis
CC   genome submitted to GenBank.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1932
FT                   /organism="Arabidopsis thaliana"
FT                   /chromosome="3"
FT                   /mol_type="mRNA"
FT                   /clone="RAFL09-36-D15 (R18814)"
FT                   /note="This clone is in a modified pBluescript vector
FT                   (FLC-1) as a BamHI/XhoI insert. ecotype: Columbia"
FT                   /db_xref="taxon:3702"
FT   CDS_pept        <1..1697
FT                   /codon_start=3
FT                   /gene="At3g21300"
FT                   /product="unknown protein"
FT                   /db_xref="GOA:Q8RXV6"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030391"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RXV6"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT                   /protein_id="AAL85018.1"
FT                   /translation="KLAPDSGSVSMLAATPAHGLRYVVVPTRSWLHRFRCCSSSLAPLS
FT                   PSEFSGGNKAQKKLNDENNTNVSNEKTAPYYPKRGETVELVCESLGFKGKGICKVDGTG
FT                   YVVMCDRALPGERFLGRVTRRKGSYAEVTKMKTISPHKDLVEAPCEYASYCGGCKTQNL
FT                   SYEAQLRAKEEQVHELIRHVGRFSDNNPGLEIVLKPIVACDIQFHYRNKMEFSFGPQRW
FT                   LPIEMLNERQDGPKNFALGLHAPGFFDKVLNVDKCLLQSEPGNLVLAAVQDCWRDPELS
FT                   LSPYDCRSHVGFLKHLMLRTGRNVETGSLELMVNFVTSSYKPELLKPLVDRISSIPQVV
FT                   SIMNNVNSSVGNTSVGEKEYTLYGKDTITEVLRGLTFQISANSFFQTNTHQAEVLYKLI
FT                   EESAGLKGDGSEVVLDLFCGTGTIGLTLARRAKHVYGYEVVPQAITDAHKNAQINGIEN
FT                   ATFIQGDLNKIGEDFGNNFPKPDIVISDPNRPGMHMKLIKFLLKLKSPRIIYVSCNPAT
FT                   CARDLDYLCHGVEEKNLKGCYKLMSVQPVDMFPHTPHIECVCLLELA"
FT   3'UTR           1698..1932
FT                   /gene="At3g21300"
FT   misc_difference 1876
FT                   /gene="At3g21300"
FT                   /note="not present in genomic sequence"
FT   misc_difference 1916
FT                   /gene="At3g21300"
FT                   /note="not present in genomic sequence"
XX
SQ   Sequence 1932 BP; 565 A; 378 C; 435 G; 554 T; 0 other;
     agaaattagc acccgactcg ggctccgttt caatgttggc cgcgacgcct gctcatggac        60
     tcaggtacgt ggtggtgccc acacgctcat ggcttcatag gtttcgatgc tgctcgtctt       120
     ctctcgctcc tctctcccct tctgaattct cgggcggtaa taaagcccag aagaagctca       180
     acgacgagaa caacaccaac gtaagcaatg agaaaacggc gccgtattat ccgaaacgag       240
     gagaaacagt ggagcttgtg tgcgagagtt taggattcaa aggcaaagga atctgtaaag       300
     ttgatggaac tggctacgtc gttatgtgtg accgagctct tcccggcgaa cgttttcttg       360
     gccgtgtcac tcgccgcaaa ggcagctatg ctgaagtgac aaaaatgaag acaatatctc       420
     cacataagga cttagtagaa gctccatgtg agtatgcatc ttactgtggt ggttgcaaaa       480
     ctcagaatct ctcttatgaa gctcagctta gagctaaaga agagcaagtt catgagctta       540
     tcagacatgt tggaaggttt tctgataaca atcctggcct tgagattgtc ttgaagccta       600
     ttgttgcttg cgatattcaa ttccattatc ggaataagat ggagttttca tttggtccac       660
     aaagatggct tccgattgaa atgttaaacg agagacaaga tggtcctaag aactttgcat       720
     tggggctcca tgcacctgga ttttttgata aggttttaaa tgttgataag tgcttattac       780
     agagcgagcc aggaaacttg gttcttgctg ctgtccaaga ttgctggaga gatcctgaat       840
     taagtctttc accatatgat tgtcgttcac atgttgggtt tcttaaacat ttgatgctga       900
     gaactggaag gaatgtggag actggttcac tagaacttat ggtcaatttt gtgacatcgt       960
     cttataagcc agagctgttg aaacccctgg ttgataggat ttcatcaatt cctcaagtgg      1020
     taagcattat gaataatgta aattcttcgg taggaaacac atccgttggc gaaaaggaat      1080
     atactcttta tgggaaggat acaatcacag aggtcttaag agggcttaca tttcaaattt      1140
     cagccaactc tttctttcag actaacactc atcaggctga agttttatat aagcttattg      1200
     aggaatctgc tggacttaaa ggagatggct cagaagtcgt gctcgatctt ttctgtggaa      1260
     ctggtaccat aggccttaca cttgccagaa gggcgaaaca cgtgtatggt tatgaagtag      1320
     taccacaagc aataacagat gcacacaaga atgcccaaat aaacggcata gagaatgcaa      1380
     cattcatcca aggggatcta aacaaaatag gagaagattt tgggaacaat ttccctaagc      1440
     ctgatatcgt tatttctgat cccaatcgac ctggtatgca catgaagttg atcaagtttc      1500
     tgctaaagct taaatctcca cggatcattt atgtttcctg taatcctgca acctgcgcca      1560
     gggatctcga ttacctctgt cacggcgtgg aggagaagaa tctaaaaggt tgctacaaac      1620
     tgatgagtgt tcagccagtg gatatgttcc ctcacactcc tcacatcgaa tgtgtctgct      1680
     tgttagagct tgcttgagct ctattgtcac catggctgct tcatttggtc tctaatcaga      1740
     tgagagacaa atgaaaacag agattttttt agattgaggg agttttggtt ttccattaga      1800
     gttaagtatc tgtaatcttt ttcatcgagt tctttaatag cattcataga caagaatgta      1860
     aacgtttttt aaaaaagtta aaatcccacc aaggcaagtg gtctttaaga gttaataaaa      1920
     aaaaaaaaaa aa                                                          1932
//

If you have problems or comments...

PBIL Back to PBIL home page