(data stored in ACNUC13479 zone)

EMBL: AY080736

ID   AY080736; SV 1; linear; mRNA; STD; PLN; 1541 BP.
XX
AC   AY080736;
XX
DT   13-MAR-2002 (Rel. 71, Created)
DT   20-SEP-2002 (Rel. 73, Last updated, Version 3)
XX
DE   Arabidopsis thaliana unknown protein (At5g01620) mRNA, complete cds.
XX
KW   FLI_CDNA.
XX
OS   Arabidopsis thaliana (thale cress)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae;
OC   rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis.
XX
RN   [1]
RP   1-1541
RA   Yamada K., Liu S.X., Sakano H., Pham P.K., Banh J., Chung M.K.,
RA   Goldsmith A.D., Lee J.M., Quach H.L., Toriumi M., Yu G., Bowser L.,
RA   Carninci P., Chen H., Cheuk R., Hayashizaki Y., Ishida J., Jones T.,
RA   Kamiya A., Karlin-Neumann G., Kawai J., Kim C., Lam B., Lin J., Miranda M.,
RA   Narusaka M., Nguyen M., Palm C.J., Sakurai T., Satou M., Seki M., Shinn P.,
RA   Southwick A., Shinozaki K., Davis R.W., Ecker J.R., Theologis A.;
RT   "Arabidopsis Full Length cDNA Clones";
RL   Unpublished.
XX
RN   [2]
RP   1-1541
RA   Yamada K., Banh J., Chan M.M., Chang C.H., Chang E., Dale J.M., Deng J.M.,
RA   Goldsmith A.D., Lee J.M., Onodera C.S., Quach H.L., Tang C.C., Toriumi M.,
RA   Wu H.C., Yamamura Y., Yu G., Bowser L., Carninci P., Chen H., Cheuk R.,
RA   Hayashizaki Y., Ishida J., Jones T., Kamiya A., Karlin-Neumann G.,
RA   Kawai J., Kim C., Lam B., Lin J., Meyers M.C., Miranda M., Narusaka M.,
RA   Nguyen M., Palm C.J., Sakurai T., Satou M., Seki M., Shinn P.,
RA   Southwick A., Shinozaki K., Davis R.W., Ecker J.R., Theologis A.;
RT   ;
RL   Submitted (19-FEB-2002) to the INSDC.
RL   Plant Gene Expression Center, 800 Buchanan Street, Albany, CA 94710, USA
XX
DR   MD5; e9dfa034f4c008cca4a30b90ed0075ad.
XX
CC   RIKEN Genomic Sciences Center (GSC) members carried out the
CC   collection and clustering of RAFL cDNAs (RAFL cDNA : 'RIKEN
CC   Arabidopsis Full-Length cDNA'): Seki,M., Narusaka,M., Ishida,J.,
CC   Satou,M., Kamiya,A., Sakurai,T., Carninci,P., Kawai,J.,
CC   Hayashizaki,Y. and Shinozaki,K.
CC   The Salk, Stanford, PGEC (SSP) Consortium members carried out the
CC   sequencing and annotation of the RAFL cDNAs: Yamada,K., Banh,J.,
CC   Chan,M.M., Chang,C.H., Chang,E., Dale,J.M., Deng,J.M.,
CC   Goldsmith,A.D., Lee,J.M., Onodera,C.S., Quach,H.L., Tang,C.C.,
CC   Toriumi,M., Wu,H.C., Yamamura,Y., Yu,G., Bowser,L., Chen,H.,
CC   Cheuk,R., Jones,T., Karlin-Neumann,G., Kim,C., Lam,B., Lin,J.,
CC   Meyers,M.C., Miranda,M., Nguyen,M., Palm,C.J., Shinn,P.,
CC   Southwick,A., Davis,R.W., Ecker,J.R. and Theologis,A.
CC   Yamada,K. (SSP/PGEC) and Seki,M. (RIKEN GSC) contributed equally to
CC   this work.  Shinozaki,K. (RIKEN GSC) and Theologis,A. (SSP/PGEC)
CC   contributed equally to this work as PIs.
CC   Annotation is based on the January 2002 version of the Arabidopsis
CC   genome submitted to GenBank.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1541
FT                   /organism="Arabidopsis thaliana"
FT                   /chromosome="5"
FT                   /mol_type="mRNA"
FT                   /clone="RAFL06-68-C06 (R11768)"
FT                   /note="This clone is in a modified pBluescript vector
FT                   (Lambda ZAP) as a XhoI/SstI insert. ecotype: Columbia"
FT                   /db_xref="taxon:3702"
FT   5'UTR           1..147
FT                   /gene="At5g01620"
FT   CDS_pept        148..1497
FT                   /codon_start=1
FT                   /gene="At5g01620"
FT                   /product="unknown protein"
FT                   /db_xref="GOA:Q8RXQ1"
FT                   /db_xref="InterPro:IPR025846"
FT                   /db_xref="InterPro:IPR026057"
FT                   /db_xref="InterPro:IPR029962"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RXQ1"
FT                   /experiment="experimental evidence, no additional details
FT                   recorded"
FT                   /protein_id="AAL86006.1"
FT                   /translation="MSQRWSRKKSRLPLAGLLFILVVTFMILFNERSIQQIHHHAASHT
FT                   QNLREPSTFDFVKPNVPRINYLGAHEVLDRFSKCNSTKEYSGKKIGWVDPFEDHPGQVT
FT                   KEEQKCDVFSGKWVFDNSSSYPLHKESQCPYMSDQLACQKHGRKDLEYQHWRWQPHACN
FT                   LKRWNAIEMWEKLRGKRLMFVGDSLNRGQWISMVCLLQSVIPRDKQSMSPNAHLTIFRA
FT                   EDYNATVEFLWAPLLVESNSDDPVNHRLSERIIRPDSVLKHASKWQHADILIFNTYLWW
FT                   RQDSVKLRWSSEEKGSCEEVKSAEGMEMAMDSWGDWVANNVDPNKKRVFFVTMSPTHQW
FT                   SREWNPGSEGNCYGEKKPIEEESYWGSGSDIPTMRMVKRVLERLGPKVSVINITQLSEY
FT                   RKDGHPSVYRKFWEPLNEDRLKNPASYSDCTHWCVPGVPDVWNQLLFHFL"
FT   3'UTR           1498..1541
FT                   /gene="At5g01620"
FT   misc_feature    1525
FT                   /gene="At5g01620"
FT                   /note="artifact within poly A tail"
XX
SQ   Sequence 1541 BP; 456 A; 303 C; 384 G; 398 T; 0 other;
     attaatctct ctctgcctct actcactgga tcatcatagc tccaaacttg taccagtcgc        60
     atcaaagcaa gttttggtga agaagaagag acgaggtctt cctcttactg tggtggtgac       120
     attttctcta aaaagaaagt ctccgatatg tcgcagagat ggagtagaaa gaagagtaga       180
     cttccattag cgggtctcct ctttattctc gttgtcacct ttatgattct cttcaacgag       240
     cgtagcattc agcagatcca tcaccacgcc gcgagtcaca ctcaaaatct ccgagaacct       300
     tccacgttcg atttcgtcaa gcctaatgtt cctcggatta actacttggg agctcatgag       360
     gttttggata gattcagcaa atgcaactcg acgaaagagt acagtgggaa gaaaatcgga       420
     tgggttgacc cgtttgaaga ccacccgggt caagtaacaa aggaggagca gaaatgtgat       480
     gtcttttctg ggaaatgggt ctttgataat tcatcatcat accctttaca caaggaatct       540
     cagtgtcctt acatgtccga ccagttggct tgtcagaagc atggtaggaa ggatttggag       600
     tatcagcatt ggagatggca acctcatgcc tgcaacttga agagatggaa tgcgatagaa       660
     atgtgggaga agctgagagg aaagagattg atgtttgttg gagactcgtt aaacagaggc       720
     caatggattt caatggtttg tctcttacag tctgtcattc cacgtgacaa gcagtctatg       780
     tctcctaacg ctcacctcac cattttcagg gctgaggact acaatgccac agtggagttt       840
     ctctgggcac cgttgctcgt ggagtcgaat tctgatgacc ctgttaatca cagattgagc       900
     gagcggatta tccgacccga ttctgttctt aaacatgcat caaagtggca acatgctgat       960
     attctaatct tcaacaccta cttatggtgg agacaagact ctgtcaagct ccgatggagc      1020
     agtgaagaaa aagggtcatg cgaggaggtg aagagcgccg agggaatgga gatggcaatg      1080
     gatagttggg gtgattgggt tgctaacaat gtcgatccaa acaaaaagcg agttttcttc      1140
     gttacaatgt ctcctacaca tcaatggagc cgagaatgga acccgggaag cgaaggaaac      1200
     tgctacgggg agaagaaacc aatagaggaa gagagttatt ggggaagtgg gtcggacatt      1260
     ccgacaatga ggatggtgaa gagagttttg gagagattgg gaccaaaggt ctcagttata      1320
     aacatcactc agttgtctga gtatcgaaaa gatggtcatc catcggtgta ccggaaattc      1380
     tgggaacctc taaatgaaga ccggttgaaa aacccggcat cgtattctga ctgtactcat      1440
     tggtgtgtac ctggagttcc tgatgtctgg aatcaattgc ttttccattt tttgtgaaaa      1500
     tgaaatgaat ataaccttaa aaaagaaaaa aaaaaaaaaa a                          1541
//

If you have problems or comments...

PBIL Back to PBIL home page