(data stored in SCRATCH zone)

EMBL: AY081357

ID   AY081357; SV 1; linear; mRNA; STD; PLN; 895 BP.
XX
AC   AY081357;
XX
DT   25-MAR-2002 (Rel. 71, Created)
DT   25-MAR-2002 (Rel. 71, Last updated, Version 1)
XX
DE   Arabidopsis thaliana unknown protein (At4g26240) mRNA, complete cds.
XX
KW   FLI_CDNA.
XX
OS   Arabidopsis thaliana (thale cress)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae;
OC   rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis.
XX
RN   [1]
RP   1-895
RA   Nguyen M., Karlin-Neumann G., Southwick A., Lam B., Miranda M., Palm C.J.,
RA   Bowser L., Jones T., Banh J., Carninci P., Chen H., Cheuk R., Chung M.K.,
RA   Hayashizaki Y., Ishida J., Kamiya A., Kawai J., Kim C., Lin J., Liu S.X.,
RA   Narusaka M., Pham P.K., Sakano H., Sakurai T., Satou M., Seki M., Shinn P.,
RA   Yamada K., Shinozaki K., Ecker J., Theologis A., Davis R.W.;
RT   ;
RL   Submitted (26-FEB-2002) to the INSDC.
RL   DNA Sequencing and Technology Center, Stanford University, 855 California
RL   Avenue, Palo Alto, CA 94304, USA
XX
DR   MD5; 097527a7f34cb1ba3404148fe7b7519f.
XX
CC   e-mail for correspondence: arab@sequence.stanford.edu
CC   RIKEN Genomic Sciences Center (GSC) members carried out the
CC   collection and clustering of RAFL cDNAs (RAFL cDNA : 'RIKEN
CC   Arabidopsis  Full-Length cDNA'): Seki,M., Narusaka,M., Ishida,J.,
CC   Satou,M., Kamiya,A., Sakurai,T., Carninci,P., Kawai,J.,
CC   Hayashizaki,Y. and Shinozaki,K.
CC   The Salk, Stanford, PGEC (SSP) Consortium members carried out the
CC   sequencing and annotation of the RAFL cDNAs: Nguyen,M.,
CC   Southwick,A., Karlin-Neumann,G.,  Lam,B., Miranda,M., Palm,C.J.,
CC   Bowser,L., Jones,T., Banh,J., Chen,H., Cheuk,R., Chung,M.K.,
CC   Kim,C., Lin,J., Liu,S.X., Pham,P.K., Sakano,H., Shinn,P.,
CC   Yamada,K., Ecker,J., Theologis,A. and Davis,R.W.
CC   Nguyen,M, (SSP/Stanford) and Seki,M. (RIKEN GSC) contributed
CC   equally to this work.  Shinozaki,K. (RIKEN GSC) and Davis,R.W.
CC   (SSP/Stanford)  contributed equally to this work as PIs.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..895
FT                   /organism="Arabidopsis thaliana"
FT                   /chromosome="4"
FT                   /mol_type="mRNA"
FT                   /clone="RAFL09-66-D16 (R24659)"
FT                   /note="This clone is in pBluescript ecotype: Columbia"
FT                   /db_xref="taxon:3702"
FT   CDS_pept        75..671
FT                   /codon_start=1
FT                   /gene="At4g26240"
FT                   /product="unknown protein"
FT                   /db_xref="GOA:Q8RXC0"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RXC0"
FT                   /protein_id="AAL91246.1"
FT                   /translation="MKKLARKWRRTRRDEDDDKFVLPTSEDVDSRPIDTQEQEEYVRYL
FT                   EEAHAQQSLQWRSVFVVLLICFGAFLFYSIFQQFMSPWELRYHAYFMEDLKSWMVISAE
FT                   WIAIMACSLSIVGLRDKKNDHRRWFWYSCVVGSALTIFWLYYLLRLPKFRWDAIWLPFG
FT                   PLCGAGICLYVDHLLEESSEEVKKLRNYMYAYKAR"
XX
SQ   Sequence 895 BP; 235 A; 171 C; 206 G; 283 T; 0 other;
     gaagaaacga tgatgctcat tgaagttttc ctaatttctc catcttctac ttctgcaatc        60
     tgaagaaaaa tcaaatgaag aagttagcga gaaaatggcg gagaactcgt cgtgacgaag       120
     atgatgataa gttcgtcctt cctacttctg aagacgtcga ttctcggcct attgatacgc       180
     aagagcagga ggagtacgtt cggtatcttg aggaagctca tgctcagcaa agtcttcaat       240
     ggaggagcgt gtttgtggtt cttctgatct gctttggagc tttcctcttc tactccattt       300
     tccagcagtt catgtcacca tgggaactgc ggtatcatgc ctactttatg gaagatctca       360
     agtcatggat ggtcatttca gctgagtgga tcgctatcat ggcttgctcc ctctccattg       420
     tcgggctacg agataagaag aatgatcata gacgatggtt ctggtactct tgtgttgttg       480
     gatctgcatt gaccatcttt tggctttatt acttgctgag gcttccgaaa ttccggtggg       540
     atgctatctg gcttccgttt gggccgcttt gtggagctgg aatttgtcta tacgtggacc       600
     atcttctaga ggagtcatct gaggaagtga aaaaactgag gaactatatg tatgcatata       660
     aagcacggta gagagataat agctactttc aaacctcgtc agagtgaatt tgtgatagca       720
     agagtgcaag ttttgactct attatcccct aaagaacatt cttctgttgt tgtaaataga       780
     tacgaaactc tgaagttcgt tttgtttaaa aactcatgat tgactcgaac tagattccag       840
     ttcatacatg taatactctt gatttattca agcaattcac ttgagagagg tgcat            895
//

If you have problems or comments...

PBIL Back to PBIL home page