(data stored in ACNUC21429 zone)

EMBL: AY081450

ID   AY081450; SV 1; linear; mRNA; STD; PLN; 1651 BP.
XX
AC   AY081450;
XX
DT   15-APR-2002 (Rel. 71, Created)
DT   16-APR-2005 (Rel. 83, Last updated, Version 2)
XX
DE   Arabidopsis thaliana putative ubiquitin-like protein (At2g17190) mRNA,
DE   complete cds.
XX
KW   FLI_CDNA.
XX
OS   Arabidopsis thaliana (thale cress)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae;
OC   rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis.
XX
RN   [1]
RP   1-1651
RA   Southwick A., Karlin-Neumann G., Nguyen M., Lam B., Miranda M., Palm C.J.,
RA   Bowser L., Jones T., Banh J., Carninci P., Chen H., Cheuk R., Chung M.K.,
RA   Hayashizaki Y., Ishida J., Kamiya A., Kawai J., Kim C., Lin J., Liu S.X.,
RA   Narusaka M., Pham P.K., Sakano H., Sakurai T., Satou M., Seki M., Shinn P.,
RA   Yamada K., Shinozaki K., Ecker J., Theologis A., Davis R.W.;
RT   ;
RL   Submitted (27-FEB-2002) to the INSDC.
RL   DNA Sequencing and Technology Center, Stanford University, 855 California
RL   Avenue, Palo Alto, CA 94304, USA
XX
DR   MD5; 6696c071ecf3ab9ce69a229ce0c3f415.
XX
CC   comment 'e-mail for correspondence: arab@sequence.stanford.edu
CC   RIKEN Genomic Sciences Center (GSC) members carried out the
CC   collection and clustering of RAFL cDNAs (RAFL cDNA : 'RIKEN
CC   Arabidopsis  Full-Length cDNA'): Seki,M., Narusaka,M., Ishida,J.,
CC   Satou,M., Kamiya,A., Sakurai,T., Carninci,P., Kawai,J.,
CC   Hayashizaki,Y. and Shinozaki,K.
CC   The Salk, Stanford, PGEC (SSP) Consortium members carried out the
CC   sequencing and annotation of the RAFL cDNAs: Nguyen,M.,
CC   Southwick,A., Karlin-Neumann,G.,  Lam,B., Miranda,M., Palm,C.J.,
CC   Bowser,L., Jones,T., Banh,J., Chen,H., Cheuk,R., Chung,M.K.,
CC   Kim,C., Lin,J., Liu,S.X., Pham,P.K., Sakano,H., Shinn,P.,
CC   Yamada,K., Ecker,J., Theologis,A. and Davis,R.W.
CC   Nguyen,M, (SSP/Stanford) and Seki,M. (RIKEN GSC) contributed
CC   equally to this work.  Shinozaki,K. (RIKEN GSC) and Davis,R.W.
CC   (SSP/Stanford) contributed equally to this work as PIs.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1651
FT                   /organism="Arabidopsis thaliana"
FT                   /chromosome="2"
FT                   /mol_type="mRNA"
FT                   /clone="U15405"
FT                   /note="This clone is in pENTR/SD-dTopo   This is a cloned
FT                   PCR product using RIKEN clone RAFL04-16-J06 (AY042828) as a
FT                   template ecotype: Columbia"
FT                   /db_xref="taxon:3702"
FT   CDS_pept        1..1617
FT                   /codon_start=1
FT                   /gene="At2g17190"
FT                   /product="putative ubiquitin-like protein"
FT                   /db_xref="GOA:Q9SII9"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR006636"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR015496"
FT                   /db_xref="InterPro:IPR015940"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9SII9"
FT                   /protein_id="AAM10012.1"
FT                   /translation="MGGEADSRQPLTAEGVAVAVNVRCSNGTKFSVTTSLDSTVESFKE
FT                   LIAQNSDVPANQQRLIYKGRILKDDQTLLSYGLQADHTVHMVRGFVPSSPSAPAANAGN
FT                   QTTAPQAVGSNDSSNLGGGESLFPGLGFNPLGGGNAMAGLFGSGLPDLEQAQQQLAQNP
FT                   NMIREMMNTPAIQNLMNNPEFMRSMIMNNPQMRELVDRNPELGHVLNDPSILRQTLEAA
FT                   RNPELMREMMRNTDRAMSNIESMPEGFNMLRRMYENVQEPLMNATTMSENAGNNTSSNP
FT                   FAALLGNQGVTTQGSDTSNNISAPNAETGTPNANPLPNPWGATAGQTTAPGRTNAGLGG
FT                   LGGLGGLGGLGMLGADSPLGATPDASQLSQILQNPAMSQMMQSVLSNPQYMNQLMSLNP
FT                   QLRSMLDMNPQLREMMQNPDFLRQFSSPEMMQQMMSLQQSLFSQNRNTAGQDPTQTGAA
FT                   TGTANNGGLDLLMNMFGSLGAGGLSGTNQPNVPPEERFATQLQQLQEMGFYDRAENIRA
FT                   LLATNGNVNAAVERLLGSIGQ"
XX
SQ   Sequence 1651 BP; 450 A; 378 C; 411 G; 412 T; 0 other;
     atgggtggtg aagcagattc gaggcagccg ctgactgctg aaggcgtagc tgttgccgtg        60
     aacgtcagat gctccaatgg cacgaaattt agtgtgacga cgagcctcga ttccacggtg       120
     gagtctttca aagagttaat tgcgcagaac agcgatgtgc cggcaaatca gcagcgtttg       180
     atttacaagg gacgtatcct caaagacgat cagactctcc tcagctatgg tttgcaggct       240
     gatcacaccg ttcatatggt tcgaggtttt gtgccttctt ctccttctgc tcccgctgca       300
     aatgctggaa accaaaccac tgctcctcaa gcggttggtt caaatgatag ctcaaacctc       360
     ggaggaggtg aatctttgtt ccctggcctt ggatttaatc ctttgggtgg tggaaatgct       420
     atggctggat tatttggatc tggtcttcct gatcttgagc aggcacagca acaactagct       480
     cagaacccta acatgattag agagatgatg aatactccag ccatccagaa tcttatgaac       540
     aacccagaat ttatgaggag tatgattatg aataaccctc aaatgcgtga gcttgtagat       600
     cgcaatcctg agcttggtca tgtgctcaat gacccaagca tccttcgtca aactctagaa       660
     gcggcgagaa acccagagct tatgcgtgaa atgatgagaa atactgatag ggctatgagt       720
     aatattgagt ctatgcctga gggatttaac atgcttaggc gtatgtatga aaatgtccag       780
     gaaccgttaa tgaatgctac cactatgtcc gagaatgctg gaaacaatac gagctctaat       840
     ccatttgctg ctcttctggg aaaccagggg gttactacac aaggaagcga tacttctaat       900
     aatatttcgg caccgaatgc tgaaacgggt acacctaatg caaatccact tcctaatcct       960
     tggggtgcca cggctggcca gacaactgcc cctggaagga caaatgctgg acttggtggt      1020
     cttggtgggc ttggaggcct tggtggactc ggtatgctgg gagcggactc acctcttggt      1080
     gcgactccag atgcttctca attgagccaa atactgcaaa accccgctat gtcgcagatg      1140
     atgcaaagcg tactttccaa tccacagtac atgaatcagc ttatgagtct taacccacaa      1200
     ctccgaagca tgctagatat gaatcctcag ttgagggaaa tgatgcagaa ccctgatttc      1260
     cttcgccagt ttagctctcc cgagatgatg cagcaaatga tgtctctaca acaatcactt      1320
     ttctctcaga ataggaacac ggctggccag gatcctacgc aaactggtgc tgcgacaggg      1380
     acagccaata acggaggact agatttattg atgaatatgt ttggcagcct tggtgctggc      1440
     ggcctaagtg gcacaaacca acccaatgtt cctcctgaag agcgatttgc gactcagttg      1500
     caacagttgc aagaaatggg attctacgac agagcagaga acataagggc tttgcttgca      1560
     accaatggta acgttaacgc tgctgtagaa cgactcttgg ggagtattgg ccagtaacat      1620
     acaggatcgc gaacttgtgg atagaaaagc c                                     1651
//

If you have problems or comments...

PBIL Back to PBIL home page