(data stored in ACNUC13479 zone)

EMBL: AY081575

ID   AY081575; SV 1; linear; mRNA; STD; PLN; 380 BP.
XX
AC   AY081575;
XX
DT   15-APR-2002 (Rel. 71, Created)
DT   16-APR-2005 (Rel. 83, Last updated, Version 2)
XX
DE   Arabidopsis thaliana light-inducible protein ATLS1 (F7A7.17) mRNA, complete
DE   cds.
XX
KW   FLI_CDNA.
XX
OS   Arabidopsis thaliana (thale cress)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae;
OC   rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis.
XX
RN   [1]
RP   1-380
RA   Southwick A., Karlin-Neumann G., Nguyen M., Lam B., Miranda M., Palm C.J.,
RA   Bowser L., Jones T., Banh J., Carninci P., Chen H., Cheuk R., Chung M.K.,
RA   Hayashizaki Y., Ishida J., Kamiya A., Kawai J., Kim C., Lin J., Liu S.X.,
RA   Narusaka M., Pham P.K., Sakano H., Sakurai T., Satou M., Seki M., Shinn P.,
RA   Yamada K., Shinozaki K., Ecker J., Theologis A., Davis R.W.;
RT   ;
RL   Submitted (27-FEB-2002) to the INSDC.
RL   DNA Sequencing and Technology Center, Stanford University, 855 California
RL   Avenue, Palo Alto, CA 94304, USA
XX
DR   MD5; 9a2ecef09a8faee0fe50f3de9e2074d1.
XX
CC   comment 'e-mail for correspondence: arab@sequence.stanford.edu
CC   RIKEN Genomic Sciences Center (GSC) members carried out the
CC   collection and clustering of RAFL cDNAs (RAFL cDNA : 'RIKEN
CC   Arabidopsis  Full-Length cDNA'): Seki,M., Narusaka,M., Ishida,J.,
CC   Satou,M., Kamiya,A., Sakurai,T., Carninci,P., Kawai,J.,
CC   Hayashizaki,Y. and Shinozaki,K.
CC   The Salk, Stanford, PGEC (SSP) Consortium members carried out the
CC   sequencing and annotation of the RAFL cDNAs: Nguyen,M.,
CC   Southwick,A., Karlin-Neumann,G.,  Lam,B., Miranda,M., Palm,C.J.,
CC   Bowser,L., Jones,T., Banh,J., Chen,H., Cheuk,R., Chung,M.K.,
CC   Kim,C., Lin,J., Liu,S.X., Pham,P.K., Sakano,H., Shinn,P.,
CC   Yamada,K., Ecker,J., Theologis,A. and Davis,R.W.
CC   Nguyen,M, (SSP/Stanford) and Seki,M. (RIKEN GSC) contributed
CC   equally to this work.  Shinozaki,K. (RIKEN GSC) and Davis,R.W.
CC   (SSP/Stanford) contributed equally to this work as PIs.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..380
FT                   /organism="Arabidopsis thaliana"
FT                   /chromosome="5"
FT                   /mol_type="mRNA"
FT                   /clone="U17152"
FT                   /note="This clone is in pENTR/SD-dTopo   This is a cloned
FT                   PCR product using RIKEN clone RAFL06-08-C02 (AY062859) as a
FT                   template ecotype: Columbia"
FT                   /db_xref="taxon:3702"
FT   CDS_pept        1..348
FT                   /codon_start=1
FT                   /gene="F7A7.17"
FT                   /product="light-inducible protein ATLS1"
FT                   /db_xref="InterPro:IPR001398"
FT                   /db_xref="InterPro:IPR014347"
FT                   /db_xref="UniProtKB/TrEMBL:Q9M011"
FT                   /protein_id="AAM10137.1"
FT                   /translation="MPCLNLSTNVNLDGVDTSSILSEASSTVAKIIGKPENYVMIVLKG
FT                   SVPMSFGGTEDPAAYGELVSIGGLNADVNKKLSAAVSAILETKLSVPKSRFFLKFYDTK
FT                   GSFFGWNGATL"
XX
SQ   Sequence 380 BP; 81 A; 93 C; 93 G; 113 T; 0 other;
     atgccgtgcc tcaacctctc caccaacgtt aaccttgacg gcgtcgatac atcttccatt        60
     ctctcggaag cttcctccac cgtcgcgaaa atcatcggca agcctgagaa ctatgtgatg       120
     attgtcttga aaggctcagt gcctatgtca tttggcggga ccgaggatcc tgcagcttat       180
     ggtgaattag tttctatcgg tggccttaat gcggatgtga acaagaagct aagcgctgct       240
     gtttccgcca ttcttgagac taagctatcg gtgcccaagt ctcgattctt cctcaagttt       300
     tatgacacca agggatcctt ctttggttgg aacggggcga ctctttaatt ccgtggtagg       360
     tgattagtgt gattgtcttg                                                   380
//

If you have problems or comments...

PBIL Back to PBIL home page