(data stored in SCRATCH zone)

EMBL: AY085228

ID   AY085228; SV 1; linear; mRNA; STD; PLN; 537 BP.
XX
AC   AY085228;
XX
DT   14-JUN-2002 (Rel. 72, Created)
DT   24-FEB-2006 (Rel. 86, Last updated, Version 4)
XX
DE   Arabidopsis thaliana clone 14013 mRNA, complete sequence.
XX
KW   FLI_CDNA.
XX
OS   Arabidopsis thaliana (thale cress)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae;
OC   rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis.
XX
RN   [1]
RP   1-537
RX   PUBMED; 12093376.
RA   Haas B.J., Volfovsky N., Town C.D., Troukhan M., Alexandrov N.,
RA   Feldmann K.A., Flavell R.B., White O., Salzberg S.L.;
RT   "Full-length messenger RNA sequences greatly improve genome annotation";
RL   Genome Biol. 3(6):RESEARCH0029-RESEARCH0029(2002).
XX
RN   [2]
RP   1-537
RA   Alexandrov N.A., Troukhan M.E., Brover V.V., Flavell R.B., Feldmann K.A.;
RT   "Features of Arabidopsis genes and genome discovered using full-length
RT   cDNAs";
RL   Plant Mol. Biol. 60(1):71-87(2006).
XX
RN   [3]
RP   1-537
RA   Brover V., Troukhan M., Alexandrov N., Lu Y.-P., Flavell R., Feldmann K.;
RT   ;
RL   Submitted (11-MAR-2002) to the INSDC.
RL   Ceres, Inc, 3007 Malibu Canyon Road, Malibu, CA 90265, USA
XX
DR   MD5; c9f3fc7d39484e1fb336cf990f91a500.
XX
CC   This clone sequence is one of 5,000 Ceres full-length cDNAs made
CC   available to TIGR and Genbank. The following quality assessment of
CC   this set was done by comparison with known proteins: two percent of
CC   the clones are estimated to be 5'-truncated; less than one percent
CC   are 3'-truncated; approximately two percent represent alternative
CC   splice variants, including unspliced introns and spliced exons; one
CC   percent may contain premature stop codons; five percent may have
CC   frame shifts in a coding region. A sequence is considered to be
CC   5'-truncated if it lacks the translation initiation start (ATG). A
CC   sequence is considered to be 3'-truncated if it lacks the
CC   C-terminal end of the encoded protein. Please note that these cDNA
CC   sequences are derived from the Ws or LAer ecotypes and therefore
CC   may contain polymorphisms when compared to sequences from Col-0.
CC   Genset carried out the library production and sequencing of the
CC   full-length clones. Ceres, Inc. carried out the clustering of the
CC   5' sequences, selection of clones, and sequence assembly.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..537
FT                   /organism="Arabidopsis thaliana"
FT                   /mol_type="mRNA"
FT                   /clone="14013"
FT                   /db_xref="taxon:3702"
FT   CDS_pept        73..432
FT                   /codon_start=1
FT                   /product="putative ribosomal protein"
FT                   /db_xref="GOA:Q9STR1"
FT                   /db_xref="InterPro:IPR000054"
FT                   /db_xref="InterPro:IPR020052"
FT                   /db_xref="InterPro:IPR023621"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9STR1"
FT                   /protein_id="AAM62461.1"
FT                   /translation="MSEKKGRKEEVVTREYTINLHRRLHSCTFKKKAPKAIKEIRKFAE
FT                   KEMGTKDVRVDVKLNKQIWSKGIRGPPRRIRVRVARKRNDDEDAKEEFFSLVTVAEIPA
FT                   EGLSGLGTKIIEEED"
XX
SQ   Sequence 537 BP; 174 A; 91 C; 138 G; 134 T; 0 other;
     tccgtcacca ccggctctgt atttcggcgt ttgtggagag aagaaggtac agagagaaga        60
     tagaaacata aaatgtcgga gaagaaggga aggaaagagg aggtggtgac cagagagtac       120
     accatcaacc ttcacagacg ccttcatagc tgtaccttta agaagaaggc tccaaaggcg       180
     atcaaggaga taaggaagtt tgctgagaag gaaatgggga caaaggatgt gagagtggat       240
     gttaaattga acaagcagat ttggagcaaa ggtatcagag gtcctccgag gagaatcaga       300
     gtccgagttg ctcgtaagag aaatgatgat gaagatgcaa aggaagagtt cttctctctt       360
     gtcactgttg ctgaaatccc tgctgaagga ctctctggcc tcggcactaa gatcattgaa       420
     gaagaggatt aaactatctt atagtaacaa caacatttta tcagattttt cgagttttgt       480
     ttttcgaatc tttattgcag agaacattta tcttcttgaa tccttaagcc ttgaacc          537
//

If you have problems or comments...

PBIL Back to PBIL home page