(data stored in ACNUC13479 zone)

EMBL: AY085237

ID   AY085237; SV 1; linear; mRNA; STD; PLN; 998 BP.
XX
AC   AY085237;
XX
DT   14-JUN-2002 (Rel. 72, Created)
DT   24-FEB-2006 (Rel. 86, Last updated, Version 5)
XX
DE   Arabidopsis thaliana clone 14084 mRNA, complete sequence.
XX
KW   FLI_CDNA.
XX
OS   Arabidopsis thaliana (thale cress)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae;
OC   rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis.
XX
RN   [1]
RP   1-998
RX   PUBMED; 12093376.
RA   Haas B.J., Volfovsky N., Town C.D., Troukhan M., Alexandrov N.,
RA   Feldmann K.A., Flavell R.B., White O., Salzberg S.L.;
RT   "Full-length messenger RNA sequences greatly improve genome annotation";
RL   Genome Biol. 3(6):RESEARCH0029-RESEARCH0029(2002).
XX
RN   [2]
RP   1-998
RA   Alexandrov N.A., Troukhan M.E., Brover V.V., Flavell R.B., Feldmann K.A.;
RT   "Features of Arabidopsis genes and genome discovered using full-length
RT   cDNAs";
RL   Plant Mol. Biol. 60(1):71-87(2006).
XX
RN   [3]
RP   1-998
RA   Brover V., Troukhan M., Alexandrov N., Lu Y.-P., Flavell R., Feldmann K.;
RT   ;
RL   Submitted (11-MAR-2002) to the INSDC.
RL   Ceres, Inc, 3007 Malibu Canyon Road, Malibu, CA 90265, USA
XX
DR   MD5; 0ec9f775784d7a59a15f8dadbbded614.
XX
CC   This clone sequence is one of 5,000 Ceres full-length cDNAs made
CC   available to TIGR and Genbank. The following quality assessment of
CC   this set was done by comparison with known proteins: two percent of
CC   the clones are estimated to be 5'-truncated; less than one percent
CC   are 3'-truncated; approximately two percent represent alternative
CC   splice variants, including unspliced introns and spliced exons; one
CC   percent may contain premature stop codons; five percent may have
CC   frame shifts in a coding region. A sequence is considered to be
CC   5'-truncated if it lacks the translation initiation start (ATG). A
CC   sequence is considered to be 3'-truncated if it lacks the
CC   C-terminal end of the encoded protein. Please note that these cDNA
CC   sequences are derived from the Ws or LAer ecotypes and therefore
CC   may contain polymorphisms when compared to sequences from Col-0.
CC   Genset carried out the library production and sequencing of the
CC   full-length clones. Ceres, Inc. carried out the clustering of the
CC   5' sequences, selection of clones, and sequence assembly.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..998
FT                   /organism="Arabidopsis thaliana"
FT                   /mol_type="mRNA"
FT                   /clone="14084"
FT                   /db_xref="taxon:3702"
FT   CDS_pept        117..899
FT                   /codon_start=1
FT                   /product="putative signal recognition particle receptor
FT                   beta subunit"
FT                   /db_xref="GOA:Q9ZV42"
FT                   /db_xref="InterPro:IPR019009"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q9ZV42"
FT                   /protein_id="AAM62470.1"
FT                   /translation="MDNLEDLKIVAEQWSKQGLEFVQKIPPPQLYTAIGVLLLATIWLL
FT                   SIRLFRRTKSNTVLLSGLSGSGKTVLFYQLRDGSSHQGAVTSMEPNEGTFVLHNENNTK
FT                   KGKVKPVHLIDVPGHSRLISKLEEYLPRAAAVVFVVDALEFLPNIRAASEYLYDILTNA
FT                   SVIKNKTPVLLCCNKTDKVTAHTKEFIRKQMEKEIDKLRVSRSAISTADIANDFTLGIE
FT                   GEVFSFSHCHNKVTVAEASGLTGETDQVQEFIREHVKP"
XX
SQ   Sequence 998 BP; 306 A; 206 C; 210 G; 276 T; 0 other;
     acaaataaca acaacaattt cgccggcgtc gtcgtcgtcg tctctccatc accgtctctg        60
     ctgcattgat tcgcagcact gagtcctaaa tttccagtgt aaaaaaaaat cagaaaatgg       120
     acaacttgga agatttgaag attgtggcag agcagtggtc taaacaagga cttgaatttg       180
     ttcaaaaaat accaccacct cagctttata ctgccattgg tgttctctta ttagctacca       240
     tttggctctt atctattcgt ttgtttagac gtacaaaatc caatactgta ctcctctctg       300
     ggctaagtgg aagtggcaaa acagttctct tctatcaact acgagatgga tcttcccatc       360
     agggtgctgt aacgtcaatg gaaccgaacg aaggcacctt tgtgcttcac aatgaaaaca       420
     acactaagaa aggaaaagta aagcctgttc atcttattga tgttcctgga cactctcggc       480
     ttatatctaa gctagaagaa tacttgcctc gagccgccgc tgttgtgttt gtagtagatg       540
     cattggagtt cctcccaaat atccgggcag cttcagagta cctttacgac attctgacca       600
     atgctagcgt tattaagaat aagaccccgg ttctgctttg ctgtaacaag acagataaag       660
     taactgcaca caccaaagag ttcatccgca agcagatgga gaaagaaata gataaactta       720
     gggtttcgag gagcgcaata tcaacagctg atatagcgaa tgacttcact cttgggattg       780
     aaggagaagt gttttccttt tcgcattgcc ataacaaagt cacggtcgct gaggcgtctg       840
     gactaacagg agaaacagat caggtacaag agttcatcag agaacacgta aagccatgag       900
     gattgtgtaa gcatctcaga gaatgtactt aaatgtcttt tcatttgttt gtaaatgaaa       960
     ttataatttg agaacttaga tgatattcgt tggaaggc                               998
//

If you have problems or comments...

PBIL Back to PBIL home page