(data stored in SCRATCH zone)

EMBL: AY085291

ID   AY085291; SV 1; linear; mRNA; STD; PLN; 897 BP.
XX
AC   AY085291;
XX
DT   14-JUN-2002 (Rel. 72, Created)
DT   24-FEB-2006 (Rel. 86, Last updated, Version 4)
XX
DE   Arabidopsis thaliana clone 14312 mRNA, complete sequence.
XX
KW   FLI_CDNA.
XX
OS   Arabidopsis thaliana (thale cress)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae;
OC   rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis.
XX
RN   [1]
RP   1-897
RX   PUBMED; 12093376.
RA   Haas B.J., Volfovsky N., Town C.D., Troukhan M., Alexandrov N.,
RA   Feldmann K.A., Flavell R.B., White O., Salzberg S.L.;
RT   "Full-length messenger RNA sequences greatly improve genome annotation";
RL   Genome Biol. 3(6):RESEARCH0029-RESEARCH0029(2002).
XX
RN   [2]
RP   1-897
RA   Alexandrov N.A., Troukhan M.E., Brover V.V., Flavell R.B., Feldmann K.A.;
RT   "Features of Arabidopsis genes and genome discovered using full-length
RT   cDNAs";
RL   Plant Mol. Biol. 60(1):71-87(2006).
XX
RN   [3]
RP   1-897
RA   Brover V., Troukhan M., Alexandrov N., Lu Y.-P., Flavell R., Feldmann K.;
RT   ;
RL   Submitted (11-MAR-2002) to the INSDC.
RL   Ceres, Inc, 3007 Malibu Canyon Road, Malibu, CA 90265, USA
XX
DR   MD5; 615aa6fc42f3e93010b2cafd8be8a7da.
XX
CC   This clone sequence is one of 5,000 Ceres full-length cDNAs made
CC   available to TIGR and Genbank. The following quality assessment of
CC   this set was done by comparison with known proteins: two percent of
CC   the clones are estimated to be 5'-truncated; less than one percent
CC   are 3'-truncated; approximately two percent represent alternative
CC   splice variants, including unspliced introns and spliced exons; one
CC   percent may contain premature stop codons; five percent may have
CC   frame shifts in a coding region. A sequence is considered to be
CC   5'-truncated if it lacks the translation initiation start (ATG). A
CC   sequence is considered to be 3'-truncated if it lacks the
CC   C-terminal end of the encoded protein. Please note that these cDNA
CC   sequences are derived from the Ws or LAer ecotypes and therefore
CC   may contain polymorphisms when compared to sequences from Col-0.
CC   Genset carried out the library production and sequencing of the
CC   full-length clones. Ceres, Inc. carried out the clustering of the
CC   5' sequences, selection of clones, and sequence assembly.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..897
FT                   /organism="Arabidopsis thaliana"
FT                   /mol_type="mRNA"
FT                   /clone="14312"
FT                   /db_xref="taxon:3702"
FT   CDS_pept        67..663
FT                   /codon_start=1
FT                   /product="unknown"
FT                   /db_xref="GOA:Q8RXC0"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:Q8RXC0"
FT                   /protein_id="AAM62523.1"
FT                   /translation="MKKLARKWRRTRRDEDDDKFVLPTSEDVDSRPIDTQEQEEYVRYL
FT                   EEAHAQQSLQWRSVFVVLLICFGAFLFYSIFQQFMSPWELRYHAYFMEDLKSWMVISAE
FT                   WIAIMACSLSIVGLRDKKNDHRRWFWYSCVVGSALTIFWLYYLLRLPKFRWDAIWLPFG
FT                   PLCGAGICLYVDHLLEESSEEVKKLRNYMYAYKAR"
XX
SQ   Sequence 897 BP; 234 A; 172 C; 204 G; 287 T; 0 other;
     gatgatgctc attgaagttt tcctaatttc tccatcttct acttctgcaa tctgaagaaa        60
     aatcaaatga agaagttagc gagaaaatgg cggagaactc gtcgtgacga agatgatgat       120
     aagttcgtcc ttcctacttc tgaagacgtc gattctcggc ctattgatac gcaagagcag       180
     gaggagtacg ttcggtatct tgaggaagct catgctcagc aaagtcttca atggaggagc       240
     gtgtttgtgg ttcttctgat ctgctttgga gctttcctct tctactccat tttccagcag       300
     ttcatgtcac catgggaact gcggtatcat gcctacttta tggaagatct caagtcatgg       360
     atggtcattt cagctgagtg gatcgctatc atggcttgct ccctctccat tgtcgggcta       420
     cgagataaga agaatgatca tagacgatgg ttctggtact cttgtgttgt tggatctgca       480
     ttgaccatct tttggcttta ttacttgctg aggcttccga aattccggtg ggatgctatc       540
     tggcttccgt ttgggccgct ttgtggagct ggaatttgtc tatacgtgga ccatcttcta       600
     gaggagtcat ctgaggaagt gaaaaaactg aggaactata tgtatgcata taaagcacgg       660
     tagagagata atagctactt tcaaacctcg tcagagtgaa tttgtgatag caagagtgca       720
     agttttgact ctattatccc ctaaagaaca ttcttctgtt gttgtaaata gatacgaaac       780
     tctgaagttc gttttgttta aaaactcatg attgactcga actagattcc agttcataca       840
     tgtaatactc ttgatttatt caagcaattc acttgagaga ggtgcataaa cttattc          897
//

If you have problems or comments...

PBIL Back to PBIL home page