(data stored in ACNUC13479 zone)

EMBL: AY085369

ID   AY085369; SV 1; linear; mRNA; STD; PLN; 856 BP.
XX
AC   AY085369;
XX
DT   14-JUN-2002 (Rel. 72, Created)
DT   24-FEB-2006 (Rel. 86, Last updated, Version 4)
XX
DE   Arabidopsis thaliana clone 14817 mRNA, complete sequence.
XX
KW   FLI_CDNA.
XX
OS   Arabidopsis thaliana (thale cress)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae; Pentapetalae;
OC   rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis.
XX
RN   [1]
RP   1-856
RX   PUBMED; 12093376.
RA   Haas B.J., Volfovsky N., Town C.D., Troukhan M., Alexandrov N.,
RA   Feldmann K.A., Flavell R.B., White O., Salzberg S.L.;
RT   "Full-length messenger RNA sequences greatly improve genome annotation";
RL   Genome Biol. 3(6):RESEARCH0029-RESEARCH0029(2002).
XX
RN   [2]
RP   1-856
RA   Alexandrov N.A., Troukhan M.E., Brover V.V., Flavell R.B., Feldmann K.A.;
RT   "Features of Arabidopsis genes and genome discovered using full-length
RT   cDNAs";
RL   Plant Mol. Biol. 60(1):71-87(2006).
XX
RN   [3]
RP   1-856
RA   Brover V., Troukhan M., Alexandrov N., Lu Y.-P., Flavell R., Feldmann K.;
RT   ;
RL   Submitted (11-MAR-2002) to the INSDC.
RL   Ceres, Inc, 3007 Malibu Canyon Road, Malibu, CA 90265, USA
XX
DR   MD5; b3fe84094b66a241b075551969a5d3c1.
XX
CC   This clone sequence is one of 5,000 Ceres full-length cDNAs made
CC   available to TIGR and Genbank. The following quality assessment of
CC   this set was done by comparison with known proteins: two percent of
CC   the clones are estimated to be 5'-truncated; less than one percent
CC   are 3'-truncated; approximately two percent represent alternative
CC   splice variants, including unspliced introns and spliced exons; one
CC   percent may contain premature stop codons; five percent may have
CC   frame shifts in a coding region. A sequence is considered to be
CC   5'-truncated if it lacks the translation initiation start (ATG). A
CC   sequence is considered to be 3'-truncated if it lacks the
CC   C-terminal end of the encoded protein. Please note that these cDNA
CC   sequences are derived from the Ws or LAer ecotypes and therefore
CC   may contain polymorphisms when compared to sequences from Col-0.
CC   Genset carried out the library production and sequencing of the
CC   full-length clones. Ceres, Inc. carried out the clustering of the
CC   5' sequences, selection of clones, and sequence assembly.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..856
FT                   /organism="Arabidopsis thaliana"
FT                   /mol_type="mRNA"
FT                   /clone="14817"
FT                   /db_xref="taxon:3702"
FT   CDS_pept        108..632
FT                   /codon_start=1
FT                   /product="unknown"
FT                   /db_xref="GOA:Q9LZX1"
FT                   /db_xref="InterPro:IPR007612"
FT                   /db_xref="InterPro:IPR025659"
FT                   /db_xref="InterPro:IPR038595"
FT                   /db_xref="PDB:1ZXU"
FT                   /db_xref="PDB:2Q4M"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9LZX1"
FT                   /protein_id="AAM62599.1"
FT                   /translation="MEQPYVYAYPQGSGPSGAPTPQAGGVVVDPRYCAPYPIDMAIVRK
FT                   MMSLTDGNFVITDVNGNLLFKVKEPVFGLHDKRVLLDGSGTPVVTLREKMVSMHDRWQV
FT                   FRGGSTEQRDLLYTVKRSSMLQLKTKLDVFLGHNKDEKRCDFRVKGSWLERSCVVYAGE
FT                   SDAIVAQVYYL"
XX
SQ   Sequence 856 BP; 246 A; 159 C; 222 G; 229 T; 0 other;
     acggcataat aagaccaaga agaaaaagaa aacattaatt tcaaccaaag caaaacagag        60
     agaaaaaaat agagagagtg aatcaatttc ggtggagaaa gagaagaatg gagcagccgt       120
     acgtgtacgc atacccgcaa ggtagtggcc cctcgggagc tccgactcca caagccggag       180
     gagtggtagt ggatccaagg tactgcgctc cttaccctat agatatggcg atcgtacgga       240
     agatgatgtc gttgacggac ggtaatttcg tgataacgga cgtcaacgga aacctgctgt       300
     tcaaggtgaa ggaaccggtg tttggtctcc acgacaagag ggtcttgctg gatggttctg       360
     gtactccggt cgtcactttg agagaaaaga tggtgagcat gcatgacagg tggcaagtgt       420
     ttagaggagg gagtacggag cagcgtgatc tgctgtacac ggtgaaaaga tcgtcgatgc       480
     ttcagctaaa gaccaaactc gatgtgtttt tgggacacaa caaagatgag aagagatgtg       540
     atttcagagt caaagggagt tggctcgagc gttcttgtgt tgtttacgcc ggcgaatctg       600
     acgccattgt tgcccaagta tactatctct aactctcttt ccttcattaa gggcccatcc       660
     atctcattta tcaatgcatc tcacatgtct ctacacagta cacatttatt agcaatgttt       720
     taatctggtt ttggtctact gctttagaat ccggttttga tggacaggtt taggtagttt       780
     ttgatttcgg tttagatcaa aagatacatt tatcttagcc catatattgt atgtttgatg       840
     aaattgggaa gatttg                                                       856
//

If you have problems or comments...

PBIL Back to PBIL home page