(data stored in ACNUC16935 zone)

EMBL: AY086062

ID   AY086062; SV 1; linear; mRNA; STD; PLN; 759 BP.
XX
AC   AY086062;
XX
DT   14-JUN-2002 (Rel. 72, Created)
DT   24-FEB-2006 (Rel. 86, Last updated, Version 5)
XX
DE   Arabidopsis thaliana clone 20908 mRNA, complete sequence.
XX
KW   FLI_CDNA.
XX
OS   Arabidopsis thaliana (thale cress)
OC   Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
OC   Spermatophyta; Magnoliophyta; eudicotyledons; Gunneridae; Pentapetalae;
OC   rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis.
XX
RN   [1]
RP   1-759
RX   PUBMED; 12093376.
RA   Haas B.J., Volfovsky N., Town C.D., Troukhan M., Alexandrov N.,
RA   Feldmann K.A., Flavell R.B., White O., Salzberg S.L.;
RT   "Full-length messenger RNA sequences greatly improve genome annotation";
RL   Genome Biol. 3(6):RESEARCH0029-RESEARCH0029(2002).
XX
RN   [2]
RP   1-759
RA   Alexandrov N.A., Troukhan M.E., Brover V.V., Flavell R.B., Feldmann K.A.;
RT   "Features of Arabidopsis genes and genome discovered using full-length
RT   cDNAs";
RL   Plant Mol. Biol. 60(1):71-87(2006).
XX
RN   [3]
RP   1-759
RA   Brover V., Troukhan M., Alexandrov N., Lu Y.-P., Flavell R., Feldmann K.;
RT   ;
RL   Submitted (11-MAR-2002) to the INSDC.
RL   Ceres, Inc, 3007 Malibu Canyon Road, Malibu, CA 90265, USA
XX
DR   MD5; baf86784ec2c1be81fcdf6c6abdbace7.
XX
CC   This clone sequence is one of 5,000 Ceres full-length cDNAs made
CC   available to TIGR and Genbank. The following quality assessment of
CC   this set was done by comparison with known proteins: two percent of
CC   the clones are estimated to be 5'-truncated; less than one percent
CC   are 3'-truncated; approximately two percent represent alternative
CC   splice variants, including unspliced introns and spliced exons; one
CC   percent may contain premature stop codons; five percent may have
CC   frame shifts in a coding region. A sequence is considered to be
CC   5'-truncated if it lacks the translation initiation start (ATG). A
CC   sequence is considered to be 3'-truncated if it lacks the
CC   C-terminal end of the encoded protein. Please note that these cDNA
CC   sequences are derived from the Ws or LAer ecotypes and therefore
CC   may contain polymorphisms when compared to sequences from Col-0.
CC   Genset carried out the library production and sequencing of the
CC   full-length clones. Ceres, Inc. carried out the clustering of the
CC   5' sequences, selection of clones, and sequence assembly.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..759
FT                   /organism="Arabidopsis thaliana"
FT                   /mol_type="mRNA"
FT                   /clone="20908"
FT                   /db_xref="taxon:3702"
FT   CDS_pept        83..547
FT                   /codon_start=1
FT                   /product="unknown"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR019954"
FT                   /db_xref="InterPro:IPR019956"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="UniProtKB/TrEMBL:Q8LDD7"
FT                   /protein_id="AAM63271.1"
FT                   /translation="MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQXLIF
FT                   AGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
FT                   KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGSF"
XX
SQ   Sequence 759 BP; 186 A; 169 C; 158 G; 227 T; 19 other;
     cctttcgtct ttttctgact cttcaatctc tcccaaagcc taaagcgatc tctgcaaatc        60
     tctcgcgact ctctctttca agatgcaaat cttcgtgaaa acactcactg gcaagacaat       120
     cactctcgag gttgagagct ctgacaccat cgacaatgtt aaggcaaaga ttcaggacaa       180
     ggaaggmatt cctccggatc agcaragmtt aatmtttgcc ggtaagcagc thgargatgg       240
     acghacyctk gcdgattaca acatccaaaa ggagtcdacc cttcatttgg tkcttcgtct       300
     cagaggtggt atgcagatct ttgtsaagac cctbacyggh aaraccatta ctctggaggt       360
     tgaragctca gacactatyg ataatgtcaa ggctaagatt caggacaagg aagggatccc       420
     accagaccaa cagagactca tcttcgctgg taaacagctt gaggatggtc gcacacttgc       480
     agattacaac atccagaagg agtcgactct tcacttggtt cttcgtcttc gtggtggaag       540
     cttctaagct ttttttgatc tgatgataag tggttggttc gtgtctcatg cacttgggag       600
     gtgaactatt tcacctggtg tagtttgtgt ttccgtctgt tggaaaaact tatccctatc       660
     gatttcgttt tcattttctg cttttctttt atgtaccttc gtttgggctt gtaacgggcc       720
     tttgtatttc aactctcaat aataatccaa gtgcatgtt                              759
//

If you have problems or comments...

PBIL Back to PBIL home page